ViewVC logotype

Contents of /mitgcm.org/devel/buildweb/bin/swish-e

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph

Revision - (show annotations) (download) (vendor branch)
Fri Sep 20 19:47:31 2002 UTC (18 years, 8 months ago) by adcroft
Branch: Import, MAIN
CVS Tags: baseline, HEAD
Changes since 1.1: +0 -0 lines
Importing web-site building process.

1 ELF44 (444``pp8;% /lib/ld-linux.so.2GNUam_LA(U'M1d<WJ2[fSc^Rbeh>#X7 PgBYj?T6kG&`-OaC9,3i*="]lI.QV%
2 ! $/+40)@;K FE Z8\:H5ND71n1:? 3W0@gmP`.fp@"+ /)Д.w6y $06o@Pu`pd.(
3 f
4 Е:W:
5 "l@G 0t@xPJ`\Np$"]2^&Ж5If@0} (0&@Q P"`pgABЗ"G'. 7!8 0~@:P`pLUw@И E|
6 hlz| %ı%0)P@CP `9p&r' Vlibm.so.6loglog10__gmon_start__libxml2.so.2xmlUTF8StrposxmlCreatePushParserCtxtxmlParserError_DYNAMIChtmlCreatePushParserCtxtxmlParseChunk_inithtmlParseChunkxmlParserWarningUTF8Toisolat1htmlFreeParserCtxthtmlTagLookup_finixmlFreeParserCtxtxmlBuildURI_GLOBAL_OFFSET_TABLE_xmlFreelibz.so.1uncompresscompress2libc.so.6strcpystdoutstrerrorfdopenmemmove__ctype_bgetenv__strtol_internalgetpidfgetsmemcpypclosemallocremovesleepvsnprintfreaddir__strtoul_internalfflush__ctype_toupperstrncasecmpabortchmodpopen__lxstatrenamestrrchrcallocstrcat__deregister_frame_infofseekstdinwaitumaskstrstrstrncmpstrncpyunlinkstrcasecmpreallocforkfreadregcompgettimeofdaylocaltimememsetftellclearerrregexecopendir__assert_failstrcmpfgetcsprintffclosesetlocalestderrmkstempfputcstrftimefwriteaccess__xstat__errno_locationexitfopen_IO_putc_IO_stdin_used__libc_start_mainclockregfreestrchrexecvpclosedir__ctype_tolower__register_frame_infovfprintfstrpbrk_edata__bss_start_endGLIBC_2.0GLIBC_2.1 ii  Lii *ii  k /0 =]_d
7   ĦȦ̦ЦԦئܦ !" #%&'( )$*(+,,0-4.81<2@3D4H5L6P7T8X9\:`;d<h>l?p@tAxB|CEFGHIKLMNOPQRSTUVħXȧZ̧\Ч^ԧ`اaܧbefghijlU5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%Ħhp%Ȧhx%̦h%Цh%Ԧh%ئh%ܦh%h%h%hp%h`%hP%h@%h0%h %h%h%h% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@%xh0%|h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%ħhp%ȧhx%̧h%Чh%ԧh%اh%ܧh%h%h%hp%h`%hP%h@%h01^PTRhhQVhUSP[ò |tЋ]ÉU puIptt&Bpp
8 upt h4 p]ÍvU]ÍUthh]Ð&U]ÍUWVSh²j] ǡp N VSWwC$@VW>VWz2VW&VWVWPhòm V<$XZjh߲w$<UWVSE}EE mE]m}< :)U܉E؋E܍)RV)QRh e[^_]ÐUSh$@$$$@$$$ $ XZ5j
9 T$`x$l$`$ T=²²u h`1;u h;uSh $`$$$ Y[hh$XZjh $`$$}$ q$e$Y$ M$A$5$ )$`$$$`$$$BY[hh@$hUhh-$GvUWVSh9u1Džt h_11ۅtPpph>=@upu(QjhLuu E pF vt j1e[^_]ÉUWj(rE}1
10 E@ E}ÍvUSR]Ct PrC t PmCt Pm]]rvUE@t8-u1]ÉUS]3tv1]ÐUVSE uEƃuEPhhjj
12 MAM qu1hgM A
13 8-tPhgM XuPhgM xt AE iup u mu hig}?t] !vVEPjUP S1ƃu vw u u h@f] >MQ1щtыtD;EM|D1ʉэD
14 P}EpoUBM VA8²tCR}whSw S)ƃ0vku[ ] Sƃu he1ʃt he}GPSus ] Sƃu hep1ۅptÃsVLt uuVhZ suW u u he] VEp hUB  Sƃu}puO u u h@d] Vul Sƃu*L u `t,E PJtE P4u h0dE p ppu u ufE vfuW u u hc] VMq4h}G4 SƃuAcug u |u hxcE8t] VUrgMA SGƃulu}G @(bujb] S5MQmujm] S}WBxvNu[ ] Sƃu h@bQEPVjtVhbEȋUXt ] Sgƃu hqIbMA ;B2w]$`}O \vEH PvUJ DvMI 8v}O @,vEH  vUJ RhaC;uPvu#MA] jvS}GL%Vuzt
15 ht?uM u Bu h>aE] ? u tVUr4ceMA4v Vy}G$ Sƃu{vTuK] /uV`t DzVh@` Sƃu(Euk u du 5?` ] STXZh##VÃuVhr` S_Pu; ] S ƃu h_EP`zd ] Sƃu h_VUBpxM‹APdu BquBu}G@f"1DžxDž|1ۃvxu2|7\uDžxMA@C|7Bwf$0vUB@ C]MA@
16 CM}G@ C=UB@ C-MA@\AC@\CRh@f^Džx1|ҍB9| }G@euE@xuS ] Sƃu h]VuMQuBPuWHujHE P}W8vouUB %uu MPh_]U ZBۉE ne[^_]ÉUWS]1эT 9s1hRƒ1e[_]ÍvUSQ]C4uhs4-aC4t-vs4S謣XZ5j
17 C4C4u֋]ÐUWVS,uP1N4E1E]]؋E Pt hH\U Zt*MMԍ} E puWsVX uF4uhv4R`F4}u h@[^LyFLM VA9`OusQjF4pV1V4BVTt VW^PF4pF4PV)V4FDFVHX[_E 0hM[+vF4pV51NTV4ɉBt V]VL~ 0h:Pt<FLtsh_5sVUuŃjhʳ^dFL~5j
18 FLt h 5U 1:PjuuuujVAe[^_]ÐUWVSu }訮]̮]Vt h ZG4u hY Wu W\^$u h@Y v$YStv$hY2v$s4]C4SF`OZYv$Sd/S4BCTt S\SW8jjuuuujS&$SUF$Ee[^_]bUVS]K4ɋu uhjC]C4FE ]e[^]UWVS,}?]W4uhw4\G4U B tkEƋFE؋t@hٳs8u Ehݳsu EPuuWg6uGX@ W0u WZhhjWU rhjW PQ]E p pWÃy WoZRh jW~oShjWUЋEЉPe$Uh&jW]ЉuEe]ЃuV]ShDjWlW h uSh_jWFe[^_]ÍvUWVS(E]E Eu]E܋] v4XZv4V$ V4$VLtwt`F4y
19 ǀt0h1l04hrCF4;t0|ۃ hB hwoVLt hXF4u hVFLt h v4V"^Lt hʹ 5 uWF4ppPV5NLt hv4V#VLt+PF4²tRhcF4pV/^Tt VWv4V軕NLt- F4pp ²tPWh  h h*e$1$9e$$B$EF4@E Ee[^_]DUWVSu;u uVhhju&E@4vUrhju} *ubQuPu"'Ãt5;t0Shju1эD ÃCtxuF~QRuu u&Ãt8;t3vShjuf1эD ÃCtxuPhBju8EE e[^_]ÐUVS ]hO\ hOjVsdžXFdžH$[DdžP$[LdžTFAJydž`O'LOvJy džXOSH[\OdžPO$0[TOdžOedžO'džOdžOdždOdžhO@džtOdžlOdžpO0dž|OdžxO1xDŽ`DŽDDŽ(JydžO'džOdžOPjjh[ OjjhZ OjjhZ OjjhZOFF$ YF $Vi\e[^]ÐUWVS EX`E@E x;tN PJt>UDt PtOMDt PtO 4;;t PYEENy\t PY D~Y^LrYY\OfYZTOZYOtaM1Q4;}@ vOt# pYXO4YEP4F;|Ń OXOt OPYOt OPYOt OPYOt OPYCt PlX 3_X$WXUBe[^_]ÐUWVSE xUZ7hVE;U :1Q\W\U _XBp\Y\.GZ\zGuP\VhM h u$ hu hWP\hN~vVh$^h;VBuSE 8u7jj
20 jwU OBjj
22 nvG(uuuWVw8TjjSuWV EPEPjjEX;uGPV! ;t STe[^_]ÐUWVS EEO1ɋu EvA9u%]uUOU9~ϋBÉMэ9u-B9u Mu UOUE^9~ȉMх{t,G9~%Љ :9WQt#9ߋUOu E [^_]Tȃ [^_]ÉUj uÉUUu& Ѓ 9!9u1]UWVSE4V}t56Pu z VWSU OwOe[^_]UWVSLE@4EE@EEEEUX] t<9C$}7zL~sh mJ3 SWEvK4t) SBuNsh`H9u.h`s us h_5JC M`t WEP`sEZuCC(1v+ E\s41uCP3su%Cǃ MCQ4B C(H$PETXTܛvEHTMLEovEXMLlcEXML2ELOEHTMLfE29ETXT2E('EWMLvQjhEP<ExL~EPhS,tE P7vUXMXEWEPSu։ƋC u!{4t 3HA# 3ZCt;C} S+CExL~e~ Vh=u h/u hu hu h 5FwuuX=v2DztEPu<sEPu2nUuEVHPRuwEvM<1t%1E\tRSuu?uEFOyʋUXt~љOt OPU;O~UM\tPSuuuOy؃ EOKPUǂO MO*Pe[^_]ÉUWVS UB4ErVu j.NF@ u (E\tu CPtuEƄu|} 1уQON_Xu CP>E VCCFC CCE؍e[^_]ÍvUWVS MAQ4EBDz} uuBPt uVGPutPuh  E@t hE t hEt h}y hEt hkEt hREt h"9Et h)  h/_uB uËME uKC CsG_O_G 19tM9KuM9KuuE uEM uCGC KsE9G_tIGGAQs uS#9tG9uO ‹9u
23 C utC e[^_]UWVS4MAEԋUB4EЋU rh3uЉEsÃt" j1IQVSue h3uqÃt)CWEEPEPjjuVuE Udt uudE pR Mh@u[rÃt% j}1IQuSu@e h@u%qÃt+CREEPEPjjuuuE EhKuqÃt% j}1IQuSud hKupÃt+CWE܍EPEPjjuuuEK U r$tGh\uBqÃt.U B$PE?$EjEPSud hnupÃt.U BPE$EjEPSuc h{upÃt+ EPE$EjEPSuc e[^_]UWVS]EEEEPusu W$k}uACH@REEPEPjjUBXCpR svC@EPEPEPjjUBXVRC0uoƒt" j1IQVRub VGEe[^_]ÍvUE]ÉUE@O]ÍvUWVSEDž@4PDžE@ǁOǁOOdEpLt h`k[5o jDžLFDžDžDžDžUB4vN;O;O^SWZYSWt EPUB@9u/P]E4A6 PDDž9}'vA9щ|DžDžu񋍴9vMILɋ4t FPhZ5
24 UB`Ot5 FP@)¹1hS VRuN'v A1J9ΉDž}+ߍv> F J;|Džmv=~ PBǃWP))4Fu- j3BË$ BC^ËPs+BC1 9ƍ }%KBFB9| 9t WBUB`Ot O,C9Dž9}?thhj0p葈9|‹OEOHLt hZ5e[^_]ÉUWVShESډ$_-DžDžP=~ P?ǃWPQu]MTDž
25 9}FB;}9։ʍv9}$F;|;ur1;}hUAB;}P9u 9D~ى+) ЉF;| W+PD WP9t Wt>8u@Dž+UM ;;9t+UR5 PZYP#_IDž]U +E2e[^_]ÉUE UPR諿ÉUWVS }GPOLt Rh@X5迿G@ P<OQB1ۉȃTtG@@CuGIyhj@0G@pɃe[^_]ÐUWVS,]EUBElj?Eu kE P;E܋Exut^UEUȉE̍UEUЉEԍv GuȉEuuЍUuԉÉPUEF>? uhhj uu1;Eu}'>u UzvU؉:@;E}| u;e[^_]ÉUWVS UBtPSu uG uNyԍe[^_]UWVS,E E}G@EEUrWAGLt h~^5肽G OP;GO$;G`Ot O<EE9EE1OLt<}'~3d}+E ~ Sh߿Z5]UBUCPEPuPuSWh
26 vCEE9EnGLt+ hj$^[5bGLE1EGLtMF 'F|
27 Ӊ )É+E ~ ShY5]GU\t%S~EpsCPWuE}좆eGLt( h艾$}^5聻EUEEEԜw`Ot?Eع1hSӋE);]t# O9 ]jSWfwE\vw`Ot SWWLt>}'~5EdEԙ}+E ~ Vh 蚽X5螺us~QuSW~ uSWtEEx}좆WLt h1UrWKGO$8GO$s8UBEe[^_]W7ve[^_]UWS] 1эQ~OQM t7ϐ1HAHx<\ttJ~Ju[_]UVuS1ɋ] Jt<\uQ<t u؅tʊ1Ʉt BAu[^]UWVS 1;]} u }.6E4uuuWZYPWC ;]|e[^_]ÉUWVS u:t-DC tvȍPxt @DC u1ۀ:tiDP uZvE;uUWE 0w5U E BCztRDP ttU 1e[^_]ÉUWVS E U19r4tYV^(EU]v]]시u'uE苔tAU yu‰1ۀ9tst\utE;u$U@PM1\4UE EM BCzutEt5U2^S^_M1S]]11e[^_]ÉUWVS EX@4E{ uh(PZƃ1tFC CE1O9}[MO4FtCFt<SB;CC~CP3U3FKDEOG9|CuS t C@Ce[^_]ÐUWVSLEE@4EȋE@Eċ\OUĉEԋXOE؋]TOEۋPOEu$ uEu1GEċEE EЍU؉UEԍUЉEUvDztuh5/ u>EȋL@tuԃPRJUȋ0tcuԃS^_uS_Eԃ8OPSt'Su uuuuuu EEuP,?EԉE܍EEUE܉UEUȋJ\t>uۉt(ËtAtËu|uUȃ^1D<WuVu$Uȋ$pSPuu< u/vuVu[E8u: P0Yu0 u uuuuuu ERu uuuuuPE̋Eȃ u=];t5Su葲t"U
28 WRuuuuuS Ẽ u0Yv0PhRZ& u uuuu Ruuu UċEԉ\OE؉XOE艂TOE쉂POE̍e[^_]ÐUWVS UB`O}tE uWPRLU ZE1Eދt CuE;E~߅uU Bz>e[^_]ÉUWVS\EDžpDžuSuu uDžUJ11Dž@ A9Љ1)K;}'v FK;|⋕@R]COM.Ë -@Ph@S)Y-@PSuu hDPDžDo11T-@=vu h#1)K;}% FK;|⋕@RMAO-Ë -@Ph@SZ-@PSuuhDSDžD*‹-@11=~ P@+ÃSP$)P SP~ S!+F1)K;}$ FK;|⋕@RMAOI+Ë -@Ph@S%X-@PSuu UB`O]CC t O+e[^_]ÐUWVS|E @DžDžUz4tywhgM;y4uu Q\u Wu WAXZWuF LJ,TLJ8T?u jPhHhMuà u uWS  u
29 ǃu܋Ex4t# (T)LJ(T?u߃ S誮[^hP蘯ÃuhSpUz4t(vQu WuXZWS @T?uWjDžM A4ph^5 DžDž<?DvUz4wPuS wPPRuS\؉$Lt DžvR=~ P&ƃ vVPP1;};4@Tu WuCT ;|NjZt*dљuQE p4P9t V5&+;tf; RDžt$ BDžQtPQE p4Pe %?wVU r4R`љu@U B O&M AǀO A4ph訪SU B4ph YY5]My4' @T$Z$T$LJ$T?uӃ yXm$e[^_]ÐUSEU Z4P4rSPC|Cx$LCHt P$CHCD]ÐUWVS E E]u9}tQWuh`/svtE}E Ee[^_]ve[^_]UWVS E x4]GEsPVhksjG$PC$PhzsU G,PC,Phs=G4PC4Phs( G<PC<PhsGDPCDPhsUBt 9Ftt, PPvt Psh U9tsh@Ǩ8tCE Ee[^_]e[^_]UWVS(E @4EEE싀OP!EU싂O Pju莨E1ɋE;ObvU싂OM<Gt7uJH 7u3IEMujw7uEE GU9BtRMq7hMAWMG$GtPuH PupIƅuPEp7h |Ft6uG 6usHÅuU2h`<MA$u CA$)v;Ct!SPE0v67Urh EME;OMU$Te[^_]ÐUEU @ LT9Ѹ|19]UWVS4] h3SuGNjE EuPh3U rh `E 0Tgh\SG U 4TWRVPu. jEPWu VEEE?UG, G,@ uE ph`]ԃ S SjV1҃;U} B;U|hjuV[fU (T[w,)G,e[^_]ÉUWVS]8Tu} 0Te/ZYWE4TT/[X8T0T?/ZYu4T-/$SWuh;e[^_]ÍvUWVS,EEEEX41Et P`EEE,T;uy(T8T҉Eu! j0TpVSua=8T t'P8T8T0T9t j4TpVSu =EԋE t PEEE,T (TjE؋4TpVWu<Vu4T(9~9uSVW8T,Tt PLJ8T5VWuS8T,Tt Pǃ8T u,4$,@Et Pu1?,T(T@,T8T<Tt PeLJ8Te[^_]ÉUWVS`E@4EExE EEE<TPUREEJ<1ۋ9}:Tt,E $T jE2BPEPEP6 C9|XEUt&XE؍EPuU94$f+ujE j<TPFujjE P6E ufÃu؋Nt9|3 v NPE <TDe[^_]UWVSU }PJEU Pju<$} jjW1]E 9Eu EU4WjjS(FtWjjEPuNjEe[^_]UWVS$u Evu jvh萟[5蔜EE܍E1ۃE} vuWEPu]EM tMuuZuXvuWuu EuQjvhUuC~Puvh [_vue[^_]ÐUSRUEҋM ]$t*E $Tt؃PQPRuuB]ÐUMS11҄vt/t
30 itGb<atX<etT<itP<otL<uAv<at<et<it <ot <uuu"C<at<et<it <ot<ut<yuAu؋$ÐUSPEu1:1ۀat*et%it otut@hP6t؋]ÍvUWVS u1ӍC1WDPh襙1u9DPh艙tDPhoue[^_]ÐUVS ]Ss1Hu SVte[^]ÐUVS ]S;1Hu Sue[^]ÐUWVS 1}ыu E|+^ 9]w{vSuh Eu9F}HFt uЃt21}Nw'vuEn1e[^_]UWVS E1ISS/t vDAtvB:u1ۍ4yWBwhqWƒt;Cvō1щKRIAE ;|& U2DM [}VE0M1e[^_]UWVS,EؠE܋uDPt1эy 119}1Ѓa<w3CA9|31ъyEػ9y}-E؉Eԉ1y8t tUԈCA9}~ۃEPVbe[^_]ÉU]ÉUS]j@C]ÍvUWVS }wt PFt^É sC $9Ct PCt P ؋PpuF wWGe[^_]UWVSE XUrhPECuPU :u8s6"$m_68S6uhtuh$fvhuܘuY} w4 s Y6Gp GpGpvF uhhulEE 8 h@ jEZU Bp!C$c} XGp CjG PC Pu1F u^ ‹uv1e[^_]ÉUWVSj] ƺ1щ$y }Ft ua 1]ۉFtdE8/t\}1ʋ}э
31 PZYuS臖_XhmSzZYuSo^v uFEuuUv‹u2Ee[^_]ÍvUWVS E@Xۋu te1эLMC tPV2t041{IE)9rPsOtЋu1e[^_]UWVS Ur4Ft8uRPE~1U׉˹ى $VZvuVhSvh`S(E4$$Xu|Ee[^_]ÐU$UWVS]hpډ]:tc<%t<\uFEPuFU8QBu EBPV7U:tBE E@EF€:ue[^_]ÉUE V<PSuUtJ<P&<D<D<%<Ft<v<ft8<f <dtdv<ptvBu/(B vBvB tQP[ZvzPV\\vBvB t PzSV$$ v%Fv%FFF>ue[^]ÐUWVS$h`u DžDžDž Dž+t u cuu hExL~u hhUr4MA4Dž"t
32  "0"x;#k"hS蒒uGN~4MF"EQPPjDž.'"Sh@ "hS6uGu2 woZuuuBpu% !Sh$!hSڑu/N~PEhPj&|!Sh@i!hS薑u{M9M!uYDž Bt P= @ r"A$y Sh$ hSu;u&M jjSw>!UBL vSh$ hS趐u3uj jSw MW vSh$A hSnuRjjW!U hS:uPjj#!MhSu7u"hjSwF Sh$h)S躏u7u"hjSwUSh$Ah6SnuWjjW UthDS:usu^VTPwqX6BX$Y[PqX@\vSh`hkS貎ucuNRPwr A $!_XPp A Sh$ hzS:ucuNV$Pwr(6A($Y[Pp(Sh$hSucuNR,Pwr0 A0$1_XPp0Q0Sh$hSJuWV4Pwr8B A8$ Y[Pp8hSތuWR<Pwr@ A@$I _X Pp@iHhVSru3~EV`PrS ShhcS*uWN~DjË hPSql Bl$ShmhS辋uWN~Dj Ë pPSqt Bt$U8Shm%hSRuWN~DjË xPSq|> B|$ShmhSu_N~LjHË PS
33 $wZSh$EhSru;Sjj[ hhS"u;Qjj  h[h+S҉uGt Sh$@ rLhSvu#Rjj_hS>uCNPwApPgShhS Sh@@rVK)ƒujjApVh&ƒAPRuSL#vhSJt Shd@rW(ƃujjApW%ƃFtP6Sh BpFovhS薇NSh@Dž9A4V't!WA4Sh <jjA4V$;|vhS趆' Sh@rV&ǃuQApSh W$tPBpSh``Dž;B4VI&t!QB4ShjwB4V#WP$;|Oh+Sv Sh@j
34 jSrDž;B4VI%Ãt4S$t3h@C(t53h-!vjjB4V"Ã{(;j8h9S^uwN Sh$~@rS$MjjBpS!MhKS҃N Sh$@h_r莃u7Mǁ7 PCEǀUǂt PMǁ Bp MhgSuwN Sh$@rSY#M`jjBpSk M9hzSbu/uj jSwUB@Sh$hSNSh@:Dž9A4VY#t!QA4ShjjFA4VY;|vhS>NSh@ZDž9A4Wy"ƃu$jjFA4W7vFu$RA4ShF@F;jhSBNSh@^Dž9A4W}!ƃu$jjA4W7vFu$PA4ShF࿉F;j hSFNSh@bDž9A4V t!QA4Shjj
35 A4V;|BvhSf~NSh@Dž9 A4Vt!RA4Sh jjA4V;|b vhS}' Sh@rVǃuPApSh@RO$tRBpSh`0Dž; B4Vt!PB4ShjwB4VdWP$;| hSF|3 Sh`@hjSr\ Dž; B4W ƃtXN$t6h Vt6h`FuAPB4ShjjB4W$ƃF;@
36 vhSzNh*wt h<
37 vh7BpOtL9u1A p Bpuv)
38 h
39 vDž; B4Sa;| vSh@ h=SyNh7wXtM9u2A p Bpug2 hG vDž; B4S;|vSh@heSxǁL@8h7‹BpCtL9u1A p BpuR hn
40 vDž;B4Sј;|vSh@hSwu/VjjMALeALYhS~wu/N~ESTPj1 Sh@ hS:w j ZYj CCDž;}:A4sC;|NjMp1H!‰pVvSh=hSjvF j_Xj
41 FFF DžBP:<uK1р|
42 >u6׹D
43 B@ @PFDž9}^ B4^t/hjSB4F u-Nu&V uSh]uFt~ uSh@'Ux1҅J!ЋMxhKS_wjjhKS`ShMhSztu3N~ jUlSh@hS2tucN~PVDPwqH0BH$Y[PqHSh@hSsu;ERPS} ETSh>vhSjsuEWPS- hS:su[N~HEV|PjU| s CuSh@h'Sru[N~HESPj}M` sCuCSh@-h:SZru/N~EQPj Sh@hVSru/N~ERPjSh@hpSquOu: wt(Bjj
44 jp]pM\WShAu+uu uzu{ucu@uCuku7ZuSuWu;u h@o~ hpPhn )_ot jptEu tUue[^_]ÉUWVS u} uuuWhjj
45 EPV/nÃtuPVWhE8tVWPh@j;]|;]~ uuSWhH e[^_]ÍvUEVSMu tB9}SVA0h9Yh4nt.h4nth4nu
46 ^vh4hntBh4Qnt+h4:nuYRV3hW1e[^]ÉUWVS EEE} E싇d1]Ƌt9Xuu- j EtdX@EEE EEe[^_]OvUWVS }dt! FP 4$BރuLJde[^_]ÍvUWVSEE] EEEh3m11u hXsh3lu" h^svh3lu& s{$²mE~h3ilu" s?Ys4EEh31luCEEE EEe[^_],R3uh4jujVWu Wue[^_]UWVS }11ۃW zku
47 z Fv1e[^_]ÐUVSu ];3}. C4u,QC4C0h`RVC0hn1e[^]ÐUWVS u] ;}}F47C;|e[^_]ÉUWVSh`]Sfkt SuSh/]<#tQ<
48 tM Ãt6t019}} C4WF褈;3| SdShhu ie[^_]ÐUWVSh`]S~jt SuShG]<#tQ<
49 tM Ãt6t019}} C4WFd;3| S|Vhgu he[^_]ÐUu u P ÉUWVSh`]S~it SuShG]<#tQ<
50 tM Ãt6t019}} C4WF8;3| S|Whfu ge[^_]ÐUWVS ] ;}utWh$3[h7sguvh_&sgu yhsgu Yhsgu 9hs`gu } Ee[^_]re[^_]UVSuPt PTt Pht P|t Pt Pt Pt Ppt8؉@t Pj p9ۉpűxt4@t P x؃xu΍e[^]ÍvUWVSuh&EE6euNt
51 EUuujjj6u :EEPuE:aǃu6uuhG_t8v<iuM$<muMP6uh YCu˃ujujuu E e[^_]ÉUWVS(EEE EEEPE8EEZYWCS_`ƃuSWuh S`E^^XWS)`ƃuSWuh@ S*NJF^tEv<iuM1<muM%<guEvPuuh 0CujuuWuuwu<$EEe[^_]vUWVS ] }萋K4t! jWjuCPi_ 1҅ jWjuCPH_ 1҅‰Dzt7 *u2Ps8S41H=Puh7b u e1e[^_]ÍvUWVS Dzu] }t<t8VhP%WjSV2DzƋtVhhbuэe[^_]ÍvUWVSl1DzEEtM jEPEj
52 EPE P4^uRE p$p8EEPha jEPEj
53 EPE P] tEU1}Uэ\
54 M Y,}I} O( DP1҃;UE}M
55 }]BG;U}|E~*U9}!vM
56 }]EBEG9‰}|E X$vUtMUAME<\u{tE<${C11<`uU}~luЍ `<'u$EEU4}1ыUL
57 60< w)ŀD*tEM4ED* sKt+9s'U}F:B9ΉUr}MG}uCEUEEEPur__uM Y0t)1}I9suVu uUEEe[^_]UWVS }7tGF$t PF8t Pq FP\4$Xރue[^_]ÐUWVS} ]j< SWFPE#_tRPWhWt W h²]ۉF8t u h²‹EF4EF0V$1IN,F(.Mt E<\u Ev<$u ztF(BuUt2e[^_]ÉUWVS²juEÃuhj@hhZuu1эA CKQZuhjIhhZvPC@PV36^C e[^_]ÉUSQ]t(S tt P^]]Ov]ÍvUVS] uF
58 P6uh&jchhZv^C
59 Fe[^]UE9tv A9u]ÉUU ҋEx+;P}&<At<Et<It <Ot<Ut<Yu 1]US jW]3]Xu)jK3JXuh3[t h73Zƒ1]UE@]ÐUU ҋEx;P|1]UU ҋEMx
60 ;P} ]UWVS M ɋUx<;J| 5.:ύu;tPuSWZtҀ;u1e[^_]ÍvUWVS u ]t91эySCJ9~ WSV3Z{e[^_]UWVS(UE EE1эAM܉ER[^h<Wd$²E$²UEB E@ <$$²hBhEhHhKhNjjW0tEjWO<XhuZYhBuW<L5<L<E<E9<A<A<Q<`<CX<CXv<H,<H<F, <G\ 'v<J`<Jxv<S<S8<Otp<O<M<Nv<Q<Q Ov<W<W<Ut,<U8v<Yt<Y<ZvEh{u[^h{uvZh"u\ZYh"uM^]XCSW<Bghu Y[h뙍v}uVW h²hQjEHPWy tf]SW&<ItOSW<Eu"h²hUh\jVW/ thutXZhuu= h²hcjjW thu3Y[h
61 v h²hjjuW thuXZh h²hRjuWt u~> h²hojuWJ thuY[hvUh²hthzjjW u*h²hhkhhjjW t< h²hjjW uhu^Xh h²hhjjWt  h²hjjWR Sh²hhhjEPW# h²hhj]SW u~h²h'hhoh{jEHPW uMuhh²hCh5hhhShyhhhhjjSWy@thuXZhu~Y h²hjjW6 thu{Y[hvhu\XZh|hu@[^h` h²hjuW tA h²hjEPW uhuZYh h²hjE@PW^ thu^X h²hjuW( }ujW<MSh²hSh'hj]SW  h²hjSW uu}ujWh<At&h²hhjEHPW~ thuZYhvhu^XhuY[hRh²hhhjuW thuI^XhiSh²hhhjuW taQh²hhhjuW thuXZhhu[^hhuZYhu h²hhhj]CSW t
62 EPPh²hhh~jSW #h²hhjSW C h²hjuW tuVh²hh'hj]SWm thuY[hhuXZhu]ih²hhjuW thuD[^hdhu(ZYh]CSWv<FuE]hu^X]CSW><H]~4EHPWjuhuZYhv}NEuGjW<Iuhua[^huHZYhh}~/Ph²hhShyjEPW >}~/Vh²hhShyjEPW  }~,h²hShyjEPWO }~jEHPW<UuU h²hhhjhh~jEPW0thu>Y[h^U\EHPW<IChu^XhSWN<N}uAjW~t/ WuhKuY[hv h²h jEPW u9E@PW<Yt$ WCuhu<XZhKu([^hKH h²hjSW t/ WuhuZYhjvEjW"<YtNVh²hhhhhhh h h#h&h<jjW@t1huUY[huFE&v h²hj]CSW uSWq<YRh²h)h0h7jjW u`h²hh'j]KSW] u:h²h>hBjSW; uhu^XSh²hhh'j]CSW u*h²hFhKjEHPW h²hhjjW u; h²hjjW u h²hPjSWr thuZYIv h²hSjSW> thu^XhulY[hSW<GuE]hu5XZh utEHPWE@PWhSuY[hS v h²hXjuW\ u h²h]jjW> tgUujW< t h²h]jjW thSuL^Xhu8Y[hSUu= h²hXjjW uhu^Xh{vEHPWtS WuC]CSW<AtSW <OuhuY[hSU9UuhuhXZh²h²hhyhhhhhhjjE@PW0uKVh²hjhhjEHPW u"huY[hu]CSW*<J5 ]CSW
63 <KuE]huXZh ]CSW<LE9Eu+Vh²hbhghljEPW ukh²hqhtjEHPW u$h²hoh{juW t? h²hbjEHPWe thjuY[h²
64 E]hjuXZhj h²hwjEHPW t,E@;Et8 h²hjEPW u]CSW<MuE]hu[^h]CSWF<NuE]huZYh[Ehu^Xh;]CSW<HuhukY[h vh²hyh"jSW tE]h"u!XZh"]CSWn<QuE]hu[^hE9Eup Wu` h²hjEPWH t=h²h{hjEPW uh²ueZYhuP^XhuA]CSW<RWh²h~hjEHPW ]uO h²hjjW| t1huZYhuEv h²hjuW, teh²hhhhjE@PW thuD^Xhdhu(Y[hHh²hhjuW u h²hjuW tE WuhuXZhu[^hMu*h²h5hjhhjjW u! h²hjE@PW tJhu2XZhu#$²hj]CSW }1 h²hjuW  EPW-<Hh²hhhhhhj]SW)0tRh²hhjSW thuL[^hu8ZYhgEuAjWu/jWp<Wthu[^h huZYU9Uu<h²hhjEPWG th²u^XhuxY[huih²hhj]CSW nv h²hjuW thuXZ7h²hhjuW t,hu[^huE h²h$juW< u# h²hjuW h²hhjEPW uAh²hhjjW u h²hjjW thuZYhu^Xhh²hhj]CSWY tE]huY[h6]CSW<VuE]hu]XZhuN5 h²hEjuW thu[^h5MujWu h²hjjW| tOjWzth{uXZhh{u[^h{uE9EuEHPW uKh²hhhhjEHPW u h²hjjW th²u
65 ZYhh²h7hjuW h%u^XhuEU9UuPh²hhjEPW# uJh²hhjEPW u"hu@Y[hu1h²hh~j]CSW 9]CSWZ<Hu+huXZhuEVh²hhh jSWF u, Wt7]~0EHPW<Tthu_ZYh%huD^Xhu5]CSW<ZKEUB~ Uz U9U1~SjjugEx~QjjPPUUU UBWZuEEe[^_]US5.$~ hjSX;$輠$I$4D$$H$,g$X $X$$8$1$#$;CDCHǃPC4ǃ`ǃdCTCXCLǃǃtǃhǃlǃpǃxǃTǃ|ǃǃǃXC@ǃ\$؋]ÐUS]S$CTCX]UWVS EE  PUr4tvFtPu6u u5ZuGXuB_u:^ue[uXYu7ZuBXu _u^u/[uN"Yu9Ep4`$Zu%U PxEǀvFtH1ۋP9}'vFt P4PC9|ރ vFPt FP ^SX$hX$`W$Pt P赱Oy6B Ur4UB8t P~E@8 uVUUe[^_]Qe[^_]UWVS ]/ۉt;uWhVh/\ SsNjuS֐19}G4v4C薫;F4| WNTu V8e[^_]ÍvUuZPTt P1UWVS uF4Åۋ~FDFHtYFPLJ\PjsV|NTɉCt13RPCPVtFDFHuNT1e[^_]ÍvUWVS Uҋ]}EEuT% ut5;t0 SE1UB4uFE;0|?t} W÷E1dEUZ<F9};hٳ4O5u Evhݳ4,5uFPuWuU9|UBVuu RpUƋBMt uUt ue[^_]ÍvUWVS }1҅u txOAuVh@Wh k VuP1vCt9|AP 1C9} W*!ƒuuGT ve[^_]ÉUVSu] hkS3uF hzS3u F(vhS3u F0vhS3u F@tvhSz3u F8TvhcSZ3u Fl4vhS:3u FtvhS3u F|vhS2u h%S2u FdvhS2u hS2utngh+Sn2uEe[^]vh/SB2uPh h 2 ²e[^]UWVS EX4ۋu }t+vVs1ut0l0 u1e[^_]UWVS E}E_4ۋu t(Vs1uRSEPW,u uظ²e[^_]ÍvUVS ]hlǪƃ sFF FFFdž`"dž\jjhh,he[^]ÍvUWVS }wFFt(v؉PWXv菪ۉ^u݃ h׫Ft/1;^}F 4UC;^| vA_4FFF t(Tt P ǃTuڍe[^_]ÉUVSu^ hPڪ$ΩFe[^]U1]ÐUEU +]ÐUEU )]ÐUEU @+B]ÍvUMU +uA+B]ÐUWVS uۋU }t" R9: WSV$& QWRVƃe[^_]UWVS UBxtiG1ۅtEtK3Rss,uC7t(Su4Eu
66 G0vE0]u?ue[^_]ÐUWVS}u GEE 8E܊`EE܋w4@ EEEGTGPW W W5GGTvGTGP]t uآQ^Su W+EuGT6vEVE܅ǀ\eEvhzjWDEPuVW}EGT t$]* u2GTv jvLSjWDhjW1l04hjWCYD;t0|QhBjW@DXZVWOu hjW'DE EuGPIShjWDEtphjWCEEuQhBjWCEPu$@$L$$E蝥CCC Ut!EEEPVujjWC WBuZ…tu6EuGTut u芠 W4t WBuWu_PtGT0vu)Mu"GTv uGTe[^_]ÍvUWVS ]1 3h- W赞Y^sW訞XZhW虞ۉu1C8(uTPWr۾t2C<(uF<)uNsWCttuЅuDPWǃh$ vsWǃ ue[^_]UWVS }1u1PC8(t> P t.t*F<=t!<(t s舣$脲Cދue[^_]UWVS v]11E s- t~h- VE!YXhVƋ<)uOsVƃt.S<(uG݅uԃRVҜXZh$VÜƃusV謜ƃU u誝}u!t=vhs$u sN$JCuƍe[^_]UWVS uE 11ۅEu
67 1vFU8u.th$S1hh- SSvt(~hSÃvS谛G% P$tPvS舛Ã6i u膜؍e[^_]UWVShju>p0vE \tshju>uNyRhBju>e[^_]ÍvUWVSUEE1]EUUQupuEuUp uD
68 tAURuuSjusuWuU1$ uu t u
69 UƋE1H!EU<(URuuSju uuPWu
70 ;vuRPWuD &ujPWuuVPWu ǃU]1Nv<),U 0MEuPÃuuh oUҋE[tB8(uUE
71 vE uuuSu u uuPWu :uQPWu8 &ujPWuuRPWuǃUtU1D uuuSEpuVWuLu 0t UU1aMt ue[^_]ÉUWVS]u} 1Eu, Wuu(Pu u$Pu uu+ Wuu(uuRPu u
72 u' Wuu(uu"u(Pu Zu+ Wuu(uu jPu ui ,vu) Wuu(uuPu uwƃ uۜe[^_]ÐUS ]j Ch^@X]ÐUU MJ0uAtQ]UWVE 1U9S}}&Ív"t)tFKu[^_]UWVStj*u DžDžDž!tYE 9t x\t81} ыE L9uǹ1ыE D vDžEpuYiu4EpPu uBiTvE 8*uE@T 1vv EpPPu ui u#EpuFiE@T 1 ƚ EpuhC$ BÃt= C;]};u;]Dž7F=~ P PIF uu u0VuujU x4Xss,C4Ps su8C 9t p+; GtF EpPu u9f t ^tuEpufe[^_]ÐUHzVSut/1ۃHzVu
73 vHzu1e[^]ÉUVSEp] Spt&vSutvSbu1e[^]ÍvUWVu^18_]ÉUEp u
74 ƒ1UWVS]޿8tH޿8t0޿8t޿ 8u
75 v1[^_]ÐUWVu^18_]ÉUWVS]޿8u
76 ޿8u_޿8u?޿8u ޿18[^_]UVSEsu VousVTƒ1e[^]ÍvUM EU QEEEUP
77 UWVS U ҋuEtuRu[_Vu1DMEۉE$vC‹M+Q{uPs,C4Ps su4C }Wu%ww,4Ps wu~4G ‹EC UBȉיƋEu u)EWus,UBCPjVsuXKExs44U{Jxփ44 E~ EEt MEe[^_]UWVSE UEu
78 vEuEvMQЋM+AyEEEE~UU1vMyu$Rq,4Pq qu3UB Myu&qq,4Pq qu2UB MYEX4SUBh SjPEMUABB MUABMAA UMBAUBA,B,Atu ׃44MAt Uz uE|44EEEE]u uEuuMt U`]u3].E]u uEuuu΋Ee[^_]ÍvUWVSjE@} uh貑És4$4e[^_]ÐUVS u ]Vp4t9puu1e[^]ÐUE'@Jy]ÉUE'@Jy]ÉUWVS\U 11ۅt cVRsVu uE9JScP u.u u&ǃPuujjhSW^ C9~ cP3<$e[^_]ÍvUWVS,M ɋUEtu
80 MUDCE AE9|EUԃE9UQU{u!ss,C4Ps su.C MAu&qq,4Ps quw.UB S‰4Eu u)EWus,ujVsu_MExu4u踍EE~ EEt MEe[^_]UWVS$EEEEEEEEUE44} EE V@hލ VjS{{ ECUS ECUS,E] Ee[^_]RUWVS }G\EEtȉәEE'GPuPh`Wh 誃1v2uJB ɉE,yB qq,A4Pq qW,UB ֋F ɉEtDyu$qq,A4Pq qWc,UB ыY$uQWUB$G@t|C …҉Ethzu"rr,B4Pr rW,UB J$uRW蟾UB$EtEPEPcyEEދuV ҉Ut F v1Ʌt<]Yغh )Q~ A AMȍe[^_]UEu1P=uJ1]ÉUWVS u V1ҋ}tPW(؃uFF Fe[^_]ÉUWVS u }tK F P葚G t/F$t(19}"F$ 45CG ;|e[^_]ÉUWVS uu11tGuto Pr1Ƀ҉t AuhhjWS11Ƀ9}uA9| VS聉e[^_]ÍvUWVS E UEu
81 1v0BF+Cy0Mɉ6u uREWup v6t3u-U҉6u uEWu,uыEe[^_]ÉUWVS,EE}EEEEEE@E؉ǀdHEs9u#EEEEEE9uru1EMUBUB9EdEUdshjuQ%EEtE VPi,u=(t)u)uM܅UB8(E 3JusutJMt#EputKEBsuu+E"E sP+EUԅuu StEuԅta9u? vUӃ vx4$p}u(9u?
82 vU sJ$BvMtEE]UuE܅t UBT"uuU؋d1-UBTe[^_]UWVS,U E҉EEt
83 u 1>MAE'My2Et] Ev)UJNjD1ۃEtV;P~]Et;Pt3vtUuuEMAU܋DEE1EtEEutMԋU9J3]ԅ1;}t vs;]u4SUBhF ESjP EԋMAA G,AA qA,;]Et_vCu!ss,C4Ps su$C UBCt E؍|4s4SЉE؋;]uMu uEuu6hhjMq4P Ut E@Eԋ}Et UUE܁}'hMMe[^_]Ve[^_]UVS ujÉ^(C$҂e[^]ÐUVSu^( 3$F(e[^]ÐUESU] t1vB1Ƀv=t *t9uȋ$UWVS U }9t/5DF tv؍Pxt @DF u119vE;u!U@PE 0U 9\uFu AJuRuuPuE 1CE :u*C8tDP `tU 1e[^_]ÉUWVS E 9}t1U uAu yu߉19teUtI^E;uU@P7E M Bzut)7uIY[7uI1:1e[^_]ÉUWVS$EEp(]E SP]UUv] 1D
84 1׹I;MvUBT1:tU BtT$6uyEEvFPVi8*PuyE 6j8PuyE]S6RU:u' RjXua[_6u]yEE xttE8tPRquuuJvh- uyZYuPEyY_hjPEx_ZuPExZYh$PExE u~_s~PhRtFPVuu Ee[^_]ÐUWVS Mu 9}u.tGFG9MvtFB8Åt9uu hstt ;W v}ue[^_]}UVSuh0ɋ] tSVyFXZSVF;u1] ue[^]{#ve[^]ÐUWVSEu EE^1AQ|FZYSP$Q}_Xh(&v[Ur6}UU9PupUUe[^_] }US h
85 &]Su=hjSu h&Sƒ1H%]ÍvUWVSM Eɋp(PEEt9uUBT1v`UE@pEM}16uCvE9uzu M1E u]SFPVW7 uEEEu/xUrhuh
86 rZuvPEuE M1t1uvu`t v貇E܃uM܋Q1uIWu]SP?t0M܋Q9uzu u1EE܋Ev Ur6] Mqu܋Ɖѿ8 st5ƿ8u$U܋QjRE܍EPnU܋bM܋ZuvuctE=uUruuhMQTu܋WPVEP]܋]܅5EEt@vE܋t*S*uBuu܍EP%U܃ۉ]uƋEe[^_]ÍvUVSj2URuVM ]QESEEEŘV芉e[^]ÐUS]jxC0]ÐUVSEp0t;v pyZp
87 yXp x$x؃uȍe[^]ÐUS]SYs0xC0]ÍvUWVS ]{07tvu vt6utu hSho1= jwZu [CXuOC^uC7C 3e[^_]ÐUVS]sE0u umƃtQVuSԓÉ4$趇؍e[^]ÐUWVS UB֋U(EE9E v0tfE\t]U Puuu uK uE(E$yK])vC]tlUE Suuu u uE Ufy,u~Q CPuuu u y2EH/E@) h@SnE U9UEU 1e[^_]ÉUWVS]EKɋ}uuEE9 EPjEPSsVWu uf0EuEx
88 EES uFE9v EPjEPSs VWu uƒ0uExEEu'u#E9Eu19}D@9|1Gvu E9E}HE19}+MU9|9DE vD@9|ۋEe[^_]UEU @+B]ÍvUEU +]ÐUWVSE Pt~Uz,LʋDDA9|hjVSYuVSu uFǃ t!StDt StIhjVS辻$#tUB 1҃9}DB9| Sgte[^_]ÐUWVS Ep@ E<)uV=)uF؅u@E @ EPj}1IQuu U B v>)uV=)uF؅u= EPj}1IQuu hU BB v ]Sj1IQVu .U BSj1}IQuRU B R tuuVE 0h'WPU rR~#uVE 0huhi1U r1uZ te[^_]UWVS u}E vPZÃu vhvC tvh@Whwi1]vS uDPVSWu OTt-ًS,uPSu WtQSu Wt6ce[^_]ÉUWVS }w0EEu =17_4t%PE6SWu
89 OTuEu܋U19Ue[^_]ÐUWVS 1U PpЃP苙ÃCu s S tML1{Esuu up sVSxC tRPVSʌ~E V蟀Mt GE ;P41e[^_]ÉUEP01]UVS jupÉ$
90 &lC$j]C$&NC Ce[^]ÐUVSu spYspZs pX6pe[^]UWVSEE p>hqWEuVjju ܆hWu+E 8uFCFCF C nvWhNhWuCE 8u'vuCu*ssWh
91 WhveEEe[^_]ÉUWVSHh]n$Esn$Edn$EUn$EFnƋEUME$vE$n$En$EmEUMEEE1ۋ19}J@EȉMċUȋ+t-u"M@UԉAMM@U؉AMM܉GC;]|EЋUME̋Ut{19}CvM9tQhhVgXZVu E4uC9|1;]}+U4hhV"ZYVuC;]|1;]}DvM9tPhhVY_VuE4uC{;]|1;]}AU:tRhhV_XVuHM4uC3;]|E8tSPhudU:tFM9t RhQhV< vQuhV%VuvE8tHU:t PhRhV uhhVVu& ukZukXuk4$k_u uEe[^_]ÉUS]j;kC@ @@]UWVS ExGt Pekw t*v 6NkXvEk^4$:kރuًEG pkE@e[^_]ÉUWVSE@E] {7h0VEu9;u RwCpEp UB VhD`EEe[^_]ÉU1]ÐUVS] utk<<t$<<<%t V<\t<NjSjV6vREPEPSqXu*jYu!jSj!ÃCue[^]ÉUWVS$E@EEUJAE1JH!QuM+vEF UEVEPtVpuuvUZt21у LIaQh$SShaW  ht;xǃVWuui Vuu
92 ^XhBuc<$h uy]~M uƃt Me[^_]ÐUWVS u ]}5v<<t$<<<%t j<\tPbWSVuIvPEPEPS<$uuVuu:hYu1h)SV2ÃvtVP7Cie[^_]ÐUSRU :\]u'EPRYstSPE]ÉUWVSu>%} FB1ۃOwe$0fK^\VN3F>n6{.@&t!Wj%UvRhj]t:QShStuSWu,SuTFe[^_]ÉUWVSE ]USqÃ;< CSqÊt,<>t(DB uvCt<>t
93 DB t) FPe U VW2U ;> S,q jhSuPCCt
94 8u{\t) FP[e UVW2VUCt<>u<>uC؍e[^_]ÉUWVSEEE EEEEE]juSuyEu$}1UE Ue[^_]@} 8uXUB8uM Rdjh3Suy Et* pMs$s^ËEpdUZUHk$puu ]dQEpVuLuuU<PUrVu$uuEX;tDP t C;u}SUrVuuu%uFlu FduFuMREpVuv hCcËE PPVhSN tEtSu Shc:uu}t(UrrVuSuh5EEe[^_]xve[^_]UWVSju] blj$qXuqGGuF x~ e[^_]ÐUVSE@X ۋu "vCv3Vt[u1e[^]ÉUE@9E ~1REPu5ÉUWVSu}u ]phhVWE ۸ u²PhVWUBP8YuPh&h.VW]uh5h.VWFEp|pxhAhKVW)UrHhbh.VWUBX8upPhh.VWUB`8uPhh.VWUBh8uPhh.VWhhh.VWU1ztPhhVWfU1ztPhhVWEEptZ$hh.VW#UhhVWEph,h.VWUrlh>hVWEpphNhVWUr h^h.VWEphqh.VWUr$hh.VWjEphh.VWPuVWe[^_]ÍvUWVSL] 119ڋu} B 9|t11tBv~aS$[$J}fE% fEmm]E }ԋEE mԉE]mԋ]`zàUEPEHPRu+E
95 '~=~q=PlP$X$Uȃ}fE% fEjj]E }ԋuE mԉu]mԋU ߍ ȉ֙ϻQӉ)Íe[^_]UWVS,] 119ڋu}} B 9|]11t Eڀ]BvS$[$]ЋufEPEHPWu)E  E
97 P$X$@1ɉMȉ]EEu}]EM }UE mU]mEe[^_]ÐUSPM1ۀ9tA)؀9u؉1Ћ]ÐUSRM1ۀ9tA)؀9u'؉1Ћ]ÐUEљ]UE'љ]USQM1ۀ9tA)؀9u؉1Ћ]ÐUVSu V]SujX0;T0u=P0d҉T0u Pg[PP0[P0 VjX0P0BX0e[^]ÍvUWVSu V}WBu1 j ZÉ4$cjC4$d O e[^_]ÉUVS u ]V4 t$VsDu 
98 u1e[^]ÐUWVS} WuVu@ h0j KZÉ<$iC$fYs`0N e[^_]ÍvUWVS }l0Evt&ƃ vKZ4$CZރuMy̍e[^_]UVS u ]V$l0t$Vs4u 
99 u1e[^]ÐUWVS }nj Evt&ƃ vY4$YރuMy̍e[^_]UVSu1;X0} P04WYC;X0|㋆P0t P8YdžP0džT0džX0e[^]UWVSu V}WBu1 j }XÉ4$gC4$0@Oe[^_]ÉUVS u ]V4@t$Vsu 
100 u1e[^]ÐUWVSU1ۅҋ} u WjU3MؐЃ CuKxu؃W3t PUKye[^_]ÐUS]مɋE u1ʃ9وtʀHu$ÉUVSU1Ʌҋ] uC/u萈Ѓ1AuIxuC1t Iy؃[^]ÉUWVS }u 1ۍv W։ txe[^_]ÐUVSu1ۋ
103 uu9}"E@B9}E9tEQW
104 Ut&t t  v @ v `AU
105 e[^_]ÍvUWVS EU 8!]K~:E4ʋF) ʉ~U "K΃WuPTNjE 0te1;]}Gtȋu8uȋ8CA;]|E 0Q2;]}&WUPC;]|E 0`u1;]}UCG;]|u>e[^_]UWVS UzUB @B#;H~$HPDSDMDUEPqEu4$EEp pEP]SS VUr uSu+D;H~ hIVO)T VDSe[^_]ÐUWVS }uEU Ex
106   ]SUu SEe[^_]ÉUWVS ] Uۋ}EEEx v؃`t, E`Et@E t E@UE uV1tW1;]}<MtCB;]|BU!;]} VC;]|}~]WKBKu1;]}(uu E@UE EC;]|ڋEUe[^_]ÉUWVSuVBǍEPEPEPVEPPËECUC{S PREPVNe[^_]UWVS uFE;F t6v;QSu u;^uFUtUE;^ uЋFF e[^_]ÉUWVSEEEEEEExE PW@)1hS@_u% j8`Ph#hMuD PxO4u4ujuhO ;EtEe[^_]mFe[^_]UWVSE UzƁ@E_uU苔:(Yt PjxOY4tOu _u=E`hPE48.u(U4:h'FvPjj4E (E]u1VOOujVSpOBUZ lujjEPpOU;Uu<VO}OËEujFPCPpOUB ZvQjFPulO|Ouƃ?e[^_]ÍvUWVSE EEpt vE6u} kE P1MEÃE ;}p}5EE FuEE)C3G;}6|hhj uu1;}]}(v3u E pvE0G;}u| uMe[^_]ÉUuUu*U1]ÐUWVS4j/}WÃۋu t{uCuuZujhjuujhjuE PEEXujEPjuu~P1QvPjudu1QSjuDEEEuEM_uEAYuj]SjuE
107  ^ u1QSjuSLZu~X1QvXjuu~`1Qv`j uu~h1Qvhj
108 upjEEXujEPjuHFtPEY_ujE؍EPju"PE0[ujEԍEPjuu~1Qvj uFlPEYujEЍEPj uFpPEZujE̍EPj uu~ 1Qv jugu~1QvjuDu~$1Qv$ju!u~1QvjuuhPjuF u Pju# uVju ul0Pju u uuju uue[^_]ÍvUWVS]s}WsƋE VPWE pe[^_]ÍvUWVS,UEEBLu EEuWvLNɉuủ EԍAủE1U܋MJ9ˉEE}$uuЉM C EJ;]|uU܋M29MEEt uFL)EPSEH+LC
109 P9|1D
110 PUPBLHMQL<uWVuENjU[B^}䋀LWj)EuN+LU؍DP9|4u؍DVPUPBL|GMQL<QuuW5}MGxuFL)EPS{F+LOF4EPF}L*VE쉂Te[^_]ÉUEpUBTBLM qRÐUWVS}wuV] wEPSVE u*wVEEFT 1# wuuPVwVEe[^_]ÉUWVS윜EPET;P~/PPUBLEMQLT=}v PEcEPvcTSPcLc]UcUBcLcc$cc:lj4$0ZYc8Pى $cc$Yc|ccZc+Ecpcsxcccj;cc~cP[MQ^tcLP)tcjcc9ccDžlcccc`cdchcv;|c`cdchccPcclc=~ PCƃ vcVccPcQc9t VCc+E;EVDžc]pcQ)RSc+c)cctB cP^cc|ccc+Epc`cdchccRc=c~ PBƃ vcVccPcQ4$+lccScPcS, VccSc9t VtBc+cxcS)RQcc+cxc)c+cc1;cH!G cP9cc+E|cV)RQStc+U|c)cE|cc+E;EDžc cR>cXc|ccc+Epcc+cxcV)RQSc+cxc)ccxcc+c1;ct- cQXc9xccUBLtctcыQc+LPctcccMQtcL)tcZYPcjLc+E|c )RcQScc+U|c)cE|cc+E;EDžct1 cPucXc|ccUBLtctcыQc+LPcvcWmY[PcjIc+cxc )RcQScc+cxc)ccxcc+c1;ct- cPkZc xcc=9ct cq>MQc+LTe[^_]ÉUWVSEEE EEEEEEEM苑O9U})OE4>1уEM9U|ރ Euk=E[^PUOE1ɋE;OU苂OM4>1эySW W6S ZY<Wv_XSv}ZYSF$@Pn_XSF( P]EUM;Os u+]Suuu E܉E e[^_]<UWVS 1EEvEUt#v{1UэT
111 UFuE}~ą Eu <_ZPVEEMEt9v{1эyVW` WsVuE}~ u+uVuu uu;e[^1_]ÉUWVS}DPZ;Y[VW1 MR@PC9| u)RVu uLV;e[^1_]ÐUWVS$uuu U_uEPEEP}WuEv$pSVuvcAF$AZYPvCcPFPuv 0AF $AY[Pv B0vRFPuv@F$uA[XPvBvQF Puv$@F$$AAXZ Pv$lBvSFPuv@F$ AZYPv8Bv uFt~ uqg uYFlR uEFp>PF4Puv0 @F0%SFLPuvP?FP QFTPuvX?FXRF\Puv`?F`PFdPuvh?FhSFDPuvH?FH uËE$F|^xQuhPnuV_uVOuV?u6F| PS8 uv|P6 hE. u8XuuuWuE ,uue[^_]ÉUWVS(E uE`E$EE쐃 uÍC$7 SuV虽]E3$EE$ÍE$HEE$EruSVuxf\Ã uPuVh-E C${(V}7MQe[^_]ÐUWVSE EEPE~Tǃ uÍC$6 SuV轼]3[XVuZYVut4$6Oue[^_]ÉUWVSE EEPE~Iǃ uqÍC$@6 SuV=]3ZYVu4$6Oue[^_]ÐUWVSEu} VE1 VHUC9|e[^_]UWVS<M u ²E M PEU؉Mԋ
112 EpuU MMЈUEZpURMQuuEUĉME u(EpuUBT ²=v}1щM̉΁Nȃ @MP4 NVuS_u;59E tEԋU؉vM̃ MEpU1эqMȃ;E܉M~ E܍E@PS4ÃUM<QVRWGXu49E sE@ EUruuuuu `MEUP؍e[^_]ÉUVS] ҋut9|@ Nɉu P3PQ3‹Ee[^]ÍvUE UM]UEPu PRÍvU EPuu PRUE@u P UE@u PUE@u PUE@uuuu PÍvUE@u PUE@u P UE@uuuu P$ÍvUE@u P(UE@u P,UE@u P0U E@uuu P4ÉU E@uuu P8ÉUE@uuuu P<ÍvUE@u P@UE@u PDU E@uuu PHÉUE@uuuu PLÍvUE@uuuu PPÍvUE@uuuu PTÍvUE@u PXUE@u P\UE@uuuu P`ÍvUE@u PdUE@u PhUE@uuuu PlÍvUE@u PpUE@u PtUE@uuuu PxÍvUE@u P|UE@u ÐUE@uuuu UE@uuuu UE@u ÐU E@u$u uuuuu ÍvU E@uuu ÍvU E@uuu ÍvUE@u uuuuu ÉUE@u ÐUVS ]h/$%}>F$FLF FFF<F F F$F( F,(F0F4F8\F<pF@\FDFH$FLFPpFTlFXF\4F`FdFhFlFpFtFxF|dždždždždžXdž\dždždžse[^]ÉUS]C0 .Xs.C]ÍvU1]ÐUSj]j gXZh0 =aAt hsh$Xh0 Q ZYh0 99 t! hshm$]UWVSu} h ,ÉsCǃP9 ǃ ǃL9 ǃ`9 ǃ\9 ǃT9 ǃX9 ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ <$W; e[^_]ÍvUWVSu udž $蠰 } 1у" $+XZu SY_h,SVdž $$ uShE" S: h@haA  h@ XZu S胲Y_h2SưXZh,S蹰dž $ $ uSh@! S: h@ a$* 0vKyKyH9 Ky ƭ Wh@j Ky 蕭FQh@j Kye[^_]ÐUWVS ]u EtE,tEVuE쉘 4$UU uVhrh $v V8}쉇 1у $)XZVS蘰^_h2Sۮ$UU uShrhn } WGHT E HU։1ۃ h0} C ~ۃ G4h0E >KyߋEe[^_]UWVS ] ɋu u6h 3t6h8EtV 67É1D _XS6袩tQS6h@E S' 6'e[^_]ÐUWVS} E P P P umSj7u1ۃw vQh@4u C ~Rjwu譫4vPh@6u KyS P P Pt t P&}e[^_]&US] [Z 蟪X &]]&USS](tQjP  袩(1]ÉUE jZ1ÉUWVSE hSu} u hSVSjVWŬe[^1_]ÍvU Ej( <1UWVSE h]Wƃ3t9hWƍF$%U E0Wj02, vU e[^1_]ÐU1]ÐUS] s$1]ÉUEU +]ÐUWVS(} P% ;L9 t ho ;\9 t hQhLj `9 k Dž1Ƀ; Dž`9 +$XpQjR YX jP S
113 Vl
114 ; b `9 # LJ`9 LJ\9 LJL9 jj Z , j$ jj tDv jh jS )u˃ = jj c^X je[^1_]ÉUVSu uhhT  $P Íe[^]UWVS Uu V uE 1}򮋞 P SyWSjWu  jS jS e[^1_]ÉUWVS u\9 ɋ u0Rjj $X l jP ' u1d9 t`9
115 [t @M9 uu h@ W蟤R `9 B\9 hWuWjuu Wj>e[^1_]UWVS uL9 ux' vJySj Phj ! jj jP  @$ `9  uVEU썇0 uM L9 @`9 M  Dj Xu ‹L9 M`9 
116 L9 C7
117 tt Ph‹E시`9 t0`9 @79tM[t@1}9uu h @`9 U P} Me[^1_]ÉU1]ÐU1]ÐUWVS] Eu4uU vPjWut^_hueÍC$luSjV蚢3h0ujY[h0uYEXZVuנÉ4$tEwE U1e[^_]ÐUWVS EE }1IMEE uAU E VSUP9 EWjPVZY[hVMÍC$TۉvVSjWv;XZh0VIY[h0V< uWuE薢_shVÃX W?C$ǃzUu WE U :EU1e[^_]ÐUWVS EE싘P9 ۋ uU E}1WjISMVY[hVÍC$VSjWE;uWu股t WRU11ǂP9 1vh0VXZh0V4$gU쉂P9 E 8U1e[^_]ÍvUWVSE juVWXZhVJÉ$TVjSW脟E 8Ee[^1_]U1]ÐU1]ÐU1]ÐU1]ÐU1]ÐUS] 賞 X9 1]UWVSu jX9 W]譟<$u h@jEW hWS hWuWjuu ġW+ËT9 X9 t*QjPW< h@uW3 jSWET9 e[^1_]ÐUSE h@jSXZSj葟1]ÉU1]ÐUWVSE j S}譞^Xh0SZYhS;Eu-hS{$U Sj72谝9t$PjVSNZYh0SuYXhS럐E 1e[^_]ÍvUE MU1]ÍvU1]ÐUVS u ]uBSjE jE P֍e[^]ÐUujjEPU ZuoÐUS] g01]ÉUWVS E pEd0U`0ۋ} E u hu# S= U BSjV E ΛC@uVuU 2hQhE @P uju ;Et PuuE 0h@ Ue[^_]ÐUWVS EEU zEd0u' Sc U BSjW;~<Rh@3E " h@sU Nuȃ WoE @e[^_]ÐUWVS EEEd0 S NjU zSjW蕝U  E0jS l@uPU 2Shy ~;h0E jY_h0U SCNuǍe[^_]ÍvUWVS UE MX`04d0ɋ}~EuRWu uE Xu h tۋEu1{PjV 聚@uQE 0Vh@ h THU$ZE SjP脙 9tRE 0Vh@ Ee[^_]ÉUVS] Ew$ ƍEP P P4$ uVh  e[^]UWVSu }j jVWHCs CC$jCXZVspSe[^_]ÐUS]CPYs$1]ÐUS ]CPs7CXZs sSKBS]ÐUE]ÉUWVS E} EEu}N 1)9Ew:tFMPSuR蔙 ])VU^ 1E9vƅtFMQWuRZ>;FvFEe[^_]UEVSu] t tFvFF9v9svVj9^rve[1^]ÐUWVS EE EEuE>N9r1~U:9v)M^ 1);]Es2F PSUQURw])]G1Ƀ;~^ t$;]rЋF SuUUQRE]]Ee[^_]ÉUujjEP6EUU REjEjEPUWVS E 8]teu CPuO1} эA;|5;-1EEE118uE}d~1EE f PtG<EEFvUPtE}<1EuE}<1EFU `e[^_]ÍvUWVS u u gFbv1}ыELMv^t41{IE);ErPstu͋6u1e[^_]ÐUE Utv9Ptu1]ÐUWS]1ъIt<\u/Bu~ z/uЉIHB~x/t[_]ÐUElPujtt1U1@ÉUElPuj<t1U1ÉUElPuj脔t1U1ÉUElPuj̓t EÍvUhMuÍvUhPuÍvUhuѕÍvUVS ]SƃuShue[^]铔vUu u PÉUWVS ]Mt;]~]CPUBO5uSjVLE31I ;Mu h 1;E<0u0
118 @;ErvhMUBOƿLE>MPUBO ÍGPVSiށLELuhLUj2Pq=Lu Ut;}~]ËEt;]~]3e[^_]ÐUVS]Cv3PjV )SC9})=~3hjVue[^]UWj8 E}1E}ÍvUWVS] su9S(҉Cu$pssC(u lC(h1tPsPt{,sVC4_Xxs(C0e[^_]ÍvUWVSxu}] !Ɖ<$'F؅YuPF <$
119  FEPv j>u EFEȉF$Vue[^_]ÐUS]s Zs Xs ]] UWVS UBE=1]хۍQt}эt
120 q hÃu5 h認Ãu h蔍Ãu E\t 1;H!Åt1э4 FPf
121 ǃt"SW<<$$^XhmW'hW]tuW5W$?<$hƉ$ތuWh`u VÃuWhMt0 W@uWh W E8e[^_]ÐUE ]ÍvU ]ÐUVShu5  ] SV5 XZhn5 ȋ$蜏UVShu5 衋 ] SV5 融f^0> Ph5 jY[hn5 X$,UEU MBTEPQhXR׋ÐUWVS_0] ˋƋECTEPu1Ѹ)PXS荋VSe[^_]ÍvUVSh u5 譊 ] SV5 誌XZhB5 舊e[^]ÐUVSh u5 e ] SV5 b*^0 Ph5 .Y[hB5 e[^]ÐUEu
122 v@T]ÍvUEtPTUUEX]ÐUSRM1һ1v; u "vB vPQhh` ` ]UESu 'v!XT1ɸ1;tA v$ÉUSQ]STyJ ST8t SC PPSZYPh SY[PhE ]vUWVS }11ۃWĚyu
123 Fv׃Wh`1e[^_]ÍvUM11;uĚBv#]UWVSj }] vƉ$FuG0we[^_]ÉUWVS u1Et=v j XvCuvE]6uƍe[^_]UWVS}] hDT hDTjV襋$%FF$4$(uG0we[^_]ÉUVuSt v4$ރue[^]ÍvUVuSt v4$ރue[^]ÍvUS]C(C CCCh CShsk
124 C$
125 YXPs C@$ C CPhs ,
126 C $
127 XZPs C@$T CCPhs C$f
128 ZYPs C@$ CCPh²s C$'
129 YXPsR C @$ C$C Ph²s$o C$$ XZ Ps$ C(@$C,CdC\CTCLC4CD$[CPCT@$ICXC\@$7C`Cd@$%ChC4@$C0CD@$CHǃClCp(ZYPh²@
130 h²h²PC@]ÍvUSR]t sKt s St sC t s$Kt sSLt sPCdt sh}K\t s`hSTt sXSCDt sH>K4t s0)S(t s,\0t P`0t PtE]v]ÍvUWVS }+F>t j 5Ë4$Cu w=ƃue[^_]UVS uVÃuVh e[^]UVSu Vu蔅ÃuVh`ee[^]ÐUdU]ÍvUVS ]jnƉ$dF F^^e[^]ÐUWVSj} ]2Ɖ$FǃuEF ~Fe[^_]ÐUWVS }u GtC9sG 9sP5ÃC)CCSe[^_]ÍvUWVS }t?0t v 4$ރu pX7e[^_]ÍvUWVS }t47Gt!v v u4$kރue[^_]UU1tt Bu]ÐUWVSU 
131 EE1щMuIMщKt\9]WEEz=wE ;Mu#}t&RuWFP9u FKt9]~1e[^_]ÐUWVSESƅÊ 1ɍuE hG "t'udCYu$:t~uСDP td1F)C=~Qhh' t-\uut
132 Cމ
133 t vCt\FE P e[^_]ÉUWVS} WuV&Ã91э\  CDA u"t hE1҉tT"tO
134 tJ tEEv;}uu?VEƃ7ECGt <"t<
135 t< uŃ 7S
136 Ɖ$1e[^_]ÉUWVS(}1эL @MPE܋}1IM} IU]܃MUEj+uU2EE9E~+EUP+]u܉UEÃPVuS` uuSO}]}u uEǃu1}UэT
137 E9‰U~ЃP+]uEÃuSr[u9E܍e[^_]ÉUWVS ] ۋuu N1эLMv1{IE)9rPstu1e[^_]UWVS } 1uэy9׋]u)҉t S| @PÃRWu S~e[^_]ÍvUEU )]ÐUWVS u1hyjWV(@9}V1:BtCBA9|3e[^_]ÍvUWVS1}эq} ICSMU1$'EtRVuW~EtSuu >P~MthjuWj?U;]}UB9:BtCBA;M|E W
138 Ee[^_]ÍvUS] UvIy:tvB:u$ÍvUEPPhÐUWVS Eu1j
139 PYyÃt j$E1F+;}u?EPvFFGU PÃt;u S>;}uPvFFe[^_]ÐUSQ]t<tH S4u s]]t]ÍvUWVS Uu})9Nj]~%>ۉtPS PÃVWu P{e[^_]ÉUUSt
140 u1+vDCtB
141 t
142 DCu1$ÍvUSP]t@;t;ؐj
143 Pwt @u؅tj Piwt @]ÍvUUSt:t41ۍv<<t<>t  1uBAu$ÉUWVS }1ۅu t$t FP VWSze[^_]ÐUU:t! DA tB:t
144 DA u]UWS]1I
145 vItTDP u[_]ÉUSRM€\] A<n
146 tx<n'<atn<a ta<0t=^v<btW<f tQM<t tG<t
147 <r t=9<v t3<xu-jjEAjjEPQz‹EHEI…tA‹]ÉUS];tA9u؋$ÐUE]UMS9tB:uȋ$ÍvUWVShEƋ] ElUB<1эyUD9E}EHPVMƃ;] t E0 @EMUB1QW4RCsx}E;|U2e[^_]ÐUM S9]tvB:uȋ$ÍvUWVS EKyu E Ɖѿ8u+1ې PUC~߸d]t[M t8ut<vE MuE AME tuMuu Ҹt1e[^_]UuEUS j/]S:wtPЋ]ÍvUWVSj/}Wwu! hCD?/°/(Ј%) CP SWVw3e[^_]ÉUWS]t,1߹ QitSPw1e[_]ÍvUWVS u1IU 9r9s
148 B GPÃPWVSve[^_]USRE] t P@]]9UEtÉUWVS }1;7}!1ۃ tFD;7| We[^_]USP]Ct PCCt PC]ÍvUVSUBu t6FPBtA jËF$E胘 EEPdqPhjSrVvt3 jËF$E= PhESuv2hm$²e[^]ÉUWVS ] C,uE}tx!EWPu1@ h6t$ s1EE$jjEPvh6t sEE$jjEPmh6at sÖEE$jjEP9h6-t. EPjC,x1IQC,p6\ jWC Puu e[^_]ÍvUVSU EtuEPRuƃu h²8VuÉ4$؍e[^]ÐUWVS ] ۋ}EuGT ²s,FuPEu uhWh!vjEPSWÃ۸²Sulj$??u W^²cvVu0P PP FRjPrVMADt PMVA|e[^_]UWVS u }]uGT cSF,PuShWhv@uSh(Wh vjSVWX$g؍e[^_]ÐUVSEu Et#PF,PEu 1 jC EuPVu7ƃ uC²E@t'C F6PC4$}^vt v֓C֍vt v踓C븐 V3;u SR1ۃ؍e[^]USQ]t(;uS t s!]]]ÍvUWVS E@EUB,TEUB} E9EQUE4uuCUƋB@t RPh
149 hEWkt;<
150 u hC<"u hH PPhOWkCuƋUBXuh_Wk VEEU;B>e[^_]ÉUWVS EuEUDB tEMDB uUr];f u‰E1уIt)TIUt]TDP uE@ jjj
151 ÍEPunEu!uhXuU:t$WuPh@z[u P觐EM1҃
152 B~C}  uXtCU< w;Uvz t BAuUE 1эA h1e[^_]ÐUWVS Uҋu} ]u Ft9~ËEu1uWEPVÃu1LFt Ft9~Ë} CP^ SWFPZlMɉu We[^_]UWVSUREPEP] uEEEkƃ}DB u D DB u E EPtE9r tj W\<}t 9| ׉)+uGPSËEt D QVuP]kE;t P؍e[^_]ÍvUWVS }1O9}OOCt;Kt4 juuSu . uRu3hOF9|e[^_]ÐUWVS }ۋu u7F  PËF@1҃9‰}PDB9|@F9; PSËF9‰DB9~F@F|t3FtuutVVDG h1;v EPuuuVƒ u ]1 FTe[^_]UWVS U ҋ}u ut tuE@t
153 r9(ˆLtA29v@tGWQPR!jGWQPRhu)މ1e[^_]ÉUHMU ;E}Lu1/ŨE~9}ƒ EPjRAPEPUWVS u }u h@LG8t;w<v1t P_<L9s SQG8_<e[^_]UWVS ] cuwEUCyvȺQ
154 PVELXv@3sVEPWg t hRU9rUEEUe[^_]ÉUWVS ]} u E8PuuWSVGc t hK1ve[^_]ÉUWVSEp4VUE @E䋂d0Eu&vuۯ_uE苀d0E]Muvu Vu}1;}}TU苂\0E;}:Tt2 EPEPuSRH vuuPSu Vu薰 G;}|vu Vu誰ZuU Be[^_]ÍvUWVSLu ^d0}u Sd0~\`0UyRhOtRuuwzPv]SEPuWVuGƃ u1SSuVu}U~9U}UE EEPjRQEPEÃV؍e[^_]ÍvUWVS\U EUEEE؋d0EEu REd01u19}XU \0jPEEPu uà t$ j3CPEPEPSF9|Et PEe[^_]USPEXC 9C|4tC Psx C j/C u SKBS]UWVS ExGUZ4tJ*G4hE@T{G PTuG19}Q G4*UZ4t0G4CP{T@ۉuF;w|1e[^_]ÐUWVS } Wu?tStDtN1ۅt PSw7hmb u'Ee[^_]b hbcVW$Eb11ۃt33PhOvbC,1I9rσ hJbue[^_]UWVS EE} GuEe[^_] b1;0}<Tt&VEPWPtGF;0|ƍe[^_]ÉUWVS }11ېjWFve[^_]UWVS ] 1ۋ}t;u h % SÉ$uuWSu_ƃ = Se[^_]ÍvUWS]j0E}1 $^UEe[_]ÍvUWVSEOOu ËECEuGCu j1PVƃEGOOe[^_]ÐUMS1;O}O@B;O|$UWVS ud0\0t h`O P\0O$1;O`0}sOEvUCt8S$u1 u,Kd0`0d0C\0d0UP`0G;O|d0u
155 džd0e[^_]ÐUWVS U1ۋO9}1O@tu 0n_u C9|1e[^_]ÐUWVS E1ۋO9}EO@t/u 0_uP$tRu
156 vC9|1e[^_]ÐUVSM1ҋO9‹u }O@t;ptB9|1[^]ÍvUWVS U1ۋO9}1O@tu 0v^u C9|1e[^_]ÐUWVS E1ۋO9}EO@t/u 0"^uP$tRu
157 vC9|1e[^_]ÐUVSM1ҋO9‹u }O@t;ptB9|1[^]ÍvUu E0]ƒ1ÍvUWVS }O19O 39C,t P&C t PCt PC t PCt P SF;Or OLJOLJOe[^_]UVS]tjS*uBuR Vc@ u YƉ4${ƃsVT\tu V1e[^]ÐUVS huÉ^ C$$m ǃǃ ǃǃCjjhe[^]ÉUWVS }w t?1;}$ v 4QC;| 7t P!_4dždždždž t)v Tt Pǃ Tuڃ e[^_]UVSu ^ VCt P P{$oF e[^]ÐUWVS$E@ E} _3hVEEMZuzHU?SPjWEXt sCZYPUB4Push u.vhVY ?CECEC E}1tVh 1}tVh` U=t>tE vEvVh RE8tn]uܿEEL8EL8GUu܀|:uvVh EEe[^_]ÉUVS]s 9to P[4ۉt' P T Tuً P.v dž jd $M u Ee[^]ÐUWVS UB uoVjhREX4$hCPƃu h
158 u j TVۉuvUZ4t1UB  Pb Tu׋UB 1;v 4EX4tWUB 4CP5ƃuUB 4h@
159  TFۉuUGB ;x1e[^_]ÉUWVS EEU EUB0@p 19}@vPPUB$4UB$4!
160 ƒt C9|1e[^_]ÐUWVSQEA0@U @ E19}(y([(+ t] B9|1Z[^_]ÍvUWVSu vuqZvEPEPEpuoE uvu藞1ovEE苆 P1fU;B,}#} WkwMQ,C;| u[_vu*UB,e[^_]UWVSE @,EE@ E싀PU1E;*vU T4ЃPBÃC hSYt6U Bu[rr,4Pr runU B 3vhSu8hStU BfvhSt EC,uQSuuu16 EpPU BHPs,u蜜 FE;e[^_]ÍvUWVS E @,E}W u1DPf1RU T4u W6CG ;|؉e[^_]ÉUWVSEE@ EEEEUB@UE@@ UB1t0Ut?EBEEtSuC(uEUt]܅t1ELBEtSuC$EuME Plj1Ƀt AuujuW1E1;]p}0B;\~\u A;M|ҋUBZ WUBt B EEEEEe[^_]ÐU EU 8tt5 ÉUVSE@ ҋu t)@ÅusVLtu1e[^]ÉUWVS(E S}E$E8ۉEu#] S SjP8P1U;u }Tv81H !^WMj2qWu u8DGE4ރ ;u|hGjuu1;uE};}]vtSWtEMU F;u|у u:MtA1;u}8t PF;u| 588Ee[^_]UWVSDE EU ẺUEEEE pu蠗Uȋd0E pu賗9EE8Uȋ\0UċPEE PrÃuPuuh
161 耾3uhC ExLt3hzM^5~J jEPSu u^ŨEԍP1Fǃ;ủ}5SE4oá8Dt PJF;u|̓ U r)SWuuqWPYuGEEċEċU;d0E puSUЃtB1;u} 8t PF;u| 588UBLtG}ЅuhCh
162 )v}uhCh vVhCuh@ Le[^_]ÉUWVS}1ɋv=wA~߀=<t/<51ɐD @ < u[^_]ÉUWVuSvIy=<t(<@1ɐD  < u[^_]UVS] uM Au1C9t+[^]ÐUVS] uM Au1C9t+[^]ÐUWVS<E EȋUJÍBE1H!Ẻ9U|Rhb sJ$KvA~ E9؉E~]ȃE ph =JUȃ9UU E؃EĉUv]C ]5EE GXZSh I^_uu $BI$ I Su utY[uĉEu pZu;$BIEd0E$` 1yI;}U؉UvU \0jSuu uƃ SuYXSV E pEPEPsuu u薓à tCUԅt0R$EZP<$ DX$PRh h H S% VG;}8 hBHZu"E̋Uȃ9UXE h ^HX5bEe[^_]ÉUWVSjE puU ӉBPSuDžtEDzAt jE pSju` Dz`tRju u=DzU ruEHUEELPHvUUC E pLPSu輏E tFuh0G_u^U rLPHu薏M uE}xE pu諏DzFU Džlrh FU 1ۋP9}"P@;l~lC9|狕l P1_;lppC;l~U ruaEHUEELPUHU@ U rLPPu>U U;EETEXE\E`EdEhvRh jEXU rTXuuE\E`hEE$\Lh|t uhtEDžx`dh\kEU$xľVuEPE‰\R lDz D|h ~D[_h3UB4PÃtGU1E EԋxQEEsRu5XZSh"D$芾 h  Duh
163 C$ Jvt|p7|h C[_xh% CZYuh) C1ۋU9}hDzDttPPPh/ 4W"t6tQPPh6 vRPPh7 7CUC9| V蓽Dzt h 
164 CE+E;Et\;t URDžxf|t uftEDžtDztE1;l;ptSh= mBpC;l~̡Dzu hB;B u蝼_u蔼^E pLPHu蓊] tU;ErE}U ru虊Yp-DzHtcE ph 1AU ;t0}+vU l04hCnAE ;t0|؃ hBSADzPtu uU rue[^_]UWVS] us}V轊YsEPEPwVE t uGEe[^_]ÐUWVSEEEu Evh @1APss3hA @Cts(hY d@C t ht J@Ctk h 2@Ct@_&u Rh /vt h vt h  h ?Ut"PSVut h ?C$t;CtPFP9vPFPSp0h l? hB\?G;PEBe[^_]9?U}VSUE M$ӉvNvΉӉNCA[^]ÐUWVS] S}WuUy&VSUx;VWUx,(VSUVWUxڍe[^_]UWVSEuEu1}E
165 vE} EwxEEM EME9ERË}*vMu vuuVW+};}vW+uVUEE9]rE EE} EE HE}} (Ev\] ]4uPPWNjEuPu)]ul uEEu)P)uuOEuuuW:EUuMMMEvuuuuE HEEuuÉuE<u4EEuMuuVuaEEu9wPuVUƒ~;u4}EuMuuuS E)E+]9wuSUƒy9w6Mu uuSVEu+]]U܅u}E EE MEME 9MÉ}*vEu vuuVW[+};}vW+uVUMM9]rE EME+E+U9‰M~…~uR)PuU+U})+U9v~uER)PV+U;Uvu1uuPuq;UvE)ЉE1uE Ye[^_]UjEP:t H}EÉU7PH<$XUShg$U9E EP6PhhSb8؋]ÍvUWVS(EEE EEEESE؉$1E1҃]9T t}؈>D }]܈GF}B|ӋE]8tSPhPhkuuQ u}܉}e[^_]ӳvUWS]j,RE}1 EC e[_]ÉUVSu ^ SC$C$C $C$C$C$C$C $C$$}$F e[^]ÍvUWVSE} p GhxS
166 9uQVvhS8uRFPWS;/hS8uPjjWF(1e[^_]ÉUWVSE EEuhvU rhvZ8EM9M*EE1h&u8Ӄ{u EH9E CP`U ËMB8^tf^B4S"7
167 PS8E pU<$thS6M qE uYE EU rEM9M!GvhsD7uE(hs(7tuh=1}^ʉ߹ҍ
168 PYXZuV7Y_hCV+6XZSV"6hS6 uuU B PuhS6uuM A PEvhSZ6uuU B PEVhES.6uuM A PE*h
169 S6uuU B PE PVWSVh?51v V蟯e[^_]ÉUWVSEPu j3uuhXS$6$RTE@PT tMu}S11 u1E9Cu)ExL~Qhu h}4Tv[ uPjOkËEUESCT EP C 1e[^_]ÍvUWVS4EEE EEEE1IMԋE@ EuuUЋJ(u uLE8tUrPfEЋP u @  u3Eu)UzLEE Ee[^_]v uy4Et8UЉr S(Ep StE u 3 Eh蹬^u3Eu(UJLEE Ee[^_]ɤ}SU1:/HE<vEȃ Ẻ1Uрz .q}G;E~EPS?ÃUԅtPuuS1U/QVDuP1DEЋP(u Sb SޛtSuEpSu`u^EuEEЃPSRu.UTu英t%uS$uSuE܃ up2E Si_u01[^uuE؋UE Ue[^_]$ u0e[^_]ÐUWVS u~ G(] u S:usSVaubGPS]t] ue[^_]TS艰t&WS$u] ue[^_]wve[^_]UVS] 3uVt Ku SPEPEPVE8t$sPt u[*vE8t0sPht uYu٩ uũZu輩1e[^]ÍvUWVSj/}W\/[^j/WP/tt 9svtt uƅu1u h²YU F WAU  W,Ue[^_]ÍvUVS] ۋuti~L~>j/S.u Sv@Phe. 5d+QVSSxXZSV}U]e[^]؜e[^]ÐUE 0U2*ÉUWVS ] ۋ}tI1;3}&vC4W9XC4AF;3|݃ s.]e[^_]e[^_]UWVS ] ۋ}t}1;3}WvGL~C4h H~C4hZ-C4W4ZC4謧F;3| s虧]e[^_]釧ve[^_]UVS]ۋu u9 j C$C4$ES>B;CuCPsڦC V KBe[^]UVS ] uSH$蘖t)~L~ShE,] ue[^] S藖t(~L~Sh1 ,] ue[^]D] EIe[^]3vUVS hX]ϥƉs$$踥 FVh$vQF'TJyFFF <e[^]UVSu^$Ct P蹥 S譥F$e[^]ÍvUWVSE xUZ$7h'VE+u4U :ujj
170 jw6*Cv h0vhLVJ+u3E 8ujj
171 jw)C u hRSvhkV+U :1уAQswCU ^B_ps+YsZsOushȚS1u :/hms) h vh{V:*uU :~c j蕣ƋCFsUE ;}Q j fU XB4ɲCFGE ;8^| h` EEe[^_]ÉUWVS]{$uuVSu{LWhtvGt9E|{LShSht*PVt{LQhVh$VS
172 t{L~qRhVh\([vVSZuG j =É4$觱ECE Cu] U v‹BuZE e[^_]ÐUWVS$E}@$Wu EvPEEUtvu V$tDPvu utUWv!Y[ÍEWu YZSP$u'ExL~Rhu h?'=6v j$Xu 荰FU U41e[^_]US h]S%ƒu1 E )ډ؋]ÉUWVSEP}Wu u12}j/_S"u1I)؉؍e[^_]ÉUWS] Suƒu1v1I Ѝe[_]USQ]"t, EP'Et,RPSh誖u SC%ZYShږ]ÐUWVS8UDžZ${1уQu荟 sh W&$j$+;C } jV$+S )‰$w$ j:$EE܋EEXZEPW}E<$~[^hu$ZYh`u&ƃuuhPVhS#jj
173 jS#Ã=tQ)ƒu)WVhu #} 1ыE Du*SVhSR#jj
174 jS#U VB$e[^_]ÐUWVSu} 1׉˹эL QuVu S %SUƉ$,e[^_]ÉUW=|S]u 5蔝|QS55|"u
175 1v|1р|
177 tgP5|j SQR|DP%"t&|%1р|
179 u v|Ѝe[_]ÐUu
180 3UWVS(E@E苸\1Eу:Q茜EPU\h5u#1}UэL
181  ҉Mu h0u h u ju ju EEE܍vuFEUzL~Wv6hH![56uZUY6uPu5u Wj
182 hu_! j h_5 uShuurZYP)j/6@!t Wh@P vSh65蝡Qjhi5^ u+Ruu6ËEC$_XSuG$JExL~S5u h Qj h_5U.linfBksBh`u[!Ã01D
183 u F@PRuuE SCƒu S [vȺQ)ƒuC8t u vPuuE UzL~RQu h PE\hoh0SPU\hh05 ePE\hh0EF u{e[^_]ÍvUWVSE @ɋ] Eu hΘu h襘EPSƃtEPSǃu 1!PU2SuiE@Euك j/EEE$ UuVPEUff
184 D
185  UEuWPUEEf@/ BBB jh2$ E1у; |3߹уQ5xSU2hX5bE\1у: $E"PU\h5u#5Eu܃PEP5u =E\1у=; |/߹с AQ5蟖PU\h5ZYh`5NX5ƍF$WVjSDuPSS$[ uMPE\hoh0 PU\hh0PE\hh0p Ee[^_]ÉUWVSu Vu[Ã۸tNEPVƃu1[ t(;1WIQ3Vtы[u1e[^_]ÍvUVSu] A9wt<
186 t< t9v1$Ȋ A9wt
188 t uA[^]ÐUWVSUE HEEUEE@UUj#Wtj#W<#Sj hW!}v}MEUEPEPhWv] EVj hҜPuEUBt PEp t ^VރuUEB @P\ UBuurQEPE-vKu'U܀:*u jEUBf*Qj hȜWuk}Et^REPhȜWtE܋EtA j轒UƋB FEr @$裒 uuPEuuǃe[^_]ÍvUWS1} эQU DA ]tvBDA u1I D DA tHDDA u[_]ÐUWVS$UB$E؍EPu [^EEPu ZYE܍EPu_XEPu]ۉM܅t}tyE;Eu5];]u-RPVuVuVSWuDu @E؋Xt2su .tsuuu1e[^_]ÉUWVS4E]PS} EXZEPSuEuztsEEЍEEԃuwY[uԉwEt:t6E;Eu.];]u&RPVuJuPSuu6t?u1e[^_]ÍvUS]jC,]ÐUVSu^,t PR SFF,e[^]UWVSEu x,FheS6u+>~PWjVvSh@B1e[^_]ÍvUWVSlUu yB,8u v1} хۍQt{1хۍ
189 uB P[^u W<$~ EPWjtWhDžE@tWh djW~tWh荅UB,t$hCWJZYsW?uރh`W8ÃuWh`5 W腎؍e[^_]ÍvUWVS} ]jw7wSw LG $PhhS衂 SwjV;Gtw h謄]e[^_]UWVS4EEE EEEEEEPuE$4EE\UEǂ\n u荘j
190 S$1 t(9v!B= 9vBDG Ju10M܅tUu hY uËUS$C XuߛC}̃tẺC(SuUE܉CU؉S$MԃtC,S4tSuFUBL~uhvH~uhSu9t% s 4ts h@ SMEEEEPjhSnu;j:S ƃuSh jj
191 jFVEWj
192 hSu;j:S\ ƃuSh轁jj
193 jFV5E<Vj hSu E!vQj hSusj:S ƃuShM FVƃ>uSh@(1 QJE_ZVPVj hS&uoj:Sd ǃuShŀ GW|ǃ?uSh蠀 W蔤Eu$QSWh}vRuSh`詁Puhuv uEЋU\_u @uEe[^_]陁e[^_]U1]ÐUWVSUҍDžu!hu AÃu
194 vӃvt=tCCt
195 t"tDž "9uR9u"Ѓ @Pv hVWqv@PW胈ǃ8@Ctt < t<"y9uDPW3ǃ 8W臔E8[^]WSuoUu2t.?t)JLtRuWh  jjWS 2vuPuWh`<~9t W·1e[^_]ÐUWVS$u,EPuuuu Eƃ t FE
196 vE] j"SL Ã1j"{WM* Åt{\uCj"P vtWug$EBEutgt6ELuE(Pu(EPjuuuumS Et6EuE(E uPFƃt@ j1}IQuE$VP' uWu,6h}t"Ee[^_]ÍvUWVSj}Gu O詆Ãt jj VhEW. u؍e[^_]ÐUE@ pu -ƒ1ÍvUWVS uE1>] t"DP t ϊEA9uރhV| u hV^ u vhV> u vhEV u pvhV
197 u PvhV
198 u 0v>/u;V=w
199 ЃhuVDPt =w ЃhuVDPt hVB
200 tihV-
201 tThfV
202 tohV
203 tZhV thV u.h V thV u@tEe[^_]UWVSE E}huÃtv]hSY1^QUBO蝃_ZSPE
204 ^u[ucZYuucE1I]EEEEZj<S]ƃ<9t
205 ~\.Fvj>W1ǃt \uGvUG<!hxV߃hVƃuh V豃hV蘃tEhV胃Ãbu SgH}E9h V>%ENEuG&v<!hxVhVÃhVȂƃu S謂9j=VÃtnCDB t CDB u;"u4C]_;]v"t K;]v;"uU9Ӊ]uGE vW]UEEG#1ۅt UW1ۅt ;MtMUtFEt?E9Ev7])ÃCPUBO蓀 SuPE{E}u"u t jjuu uE ]huYÃtv]hS7ƃtj>V71QUBOZYVPEOEt' uB_u草[^uu_EMt&Ut1}I;M~
207 UEu]ENMT}<h]CO2~Ǿ<EEE 9u6PUBO} ƍCPWVM ;C}>u;uWUȃ]M܊1҄tv<
208 u] BM܊
209 u] 1DA u <"uvB]DA u<"t1Ʉt]܈BAuE1уxC]DP u#vEIxDP uU܊t<"t؋]܊1ɄtЍv<"uE'AU܊u1H#EuWUȃtcEZ}uR}+};}u;?CPMAO\| ƍGPuV@]u܉}E]@EUE
210 UUE؅M9M1e[^_]ÍvU uEPUjRE u@PuGUWVSDEEԋE@4E̋]E@SuEY^Pu[XZVu1u
211 @U B0tup B0pSDǃjWVuu u/j@EMAO{EEEEE>}}j<V ǃ@9t
212 \2VuZMGuERuuuu؋UXPuFE j>SÃt {\uCvC<!hxWP{hW7{uh W"{hM؀W{CM qEPjuWuh ED}9}u:E܃PUBOyMNjuEEEUЋBM܋}E2
213 uEEuEPGމEj<VDÃtVu,YƉ4$z$1IQVEuЃP uPU rM1hoW<Ovh Wyt}܅tMu }v<!t|hxWlytehWWyƃtNhW@yt9U ruuPVu؋MXWuuEރ0v<!u2Ett%uju؋UXWPE`vuWHE؉ރJDVuWM܃uERuuuu؋MXPuXCE1 t >WEe[^_]UWVS u F01ۅ}t @ tPu襅É$臀jSh²WVu* t S'vPEPEPjj7uuEEBe[^_]UWVShj M ƋEX4y0jDjEPFM EMԋMSEЅỦuȉEEMt,hKRRƒ҉UtBEG BGEjjjuu u) uE ph k]SV hhV( ZYhV/ MtthV1 jE puV= u5 Vu$PV PM qh`8l V
214 $8Et PytUtEPEe[^_]ÉUWVS]C8C u R S1IvWVC<phkVW<$Y^W<uC(WC Ws4mt@pu;RLtPC<pWhjjWs4b@uVUB<pPh`|iVEp4Ԛt@{GtPVuG e[^_]UWVSU 1IuvVRC<ph7jRW<$~C t"WPC SZYWC8覛uC(Ws4ƒt BtHBPv4ƙƒt BtHB{WtRPuO e[^_]ÉUUB uÉUVuS]t9SK9|!NCP3<qSQVu Rse[^]ÐUSQ]SҋK8tiRC(Pjjjs,3Q=C$C<ps3C@Ps4nC t js3sC@P軋 C]US]C(K8C(Pjjjs,U RQa=C$C(]ÉUVSE|ۋu "vCvsVtu1e[^]ÉUWVSh}Ãu 1 Pǃ0CC(C,C0C4C8C<C@CDCHCLCPCTCXC\C`CdChCl[pCtCC CCCCǃǃǃ ǃǃǃ$ǃǃǃǃǃǃǃǃǃǃǃǃ<$ǃ4$C ǃǃǃǃǃǃǃƃ!ǃI$ItWV)K1 $PǃBttC ttu S1%C$PjCxPC|PO؍e[^_]ÍvUVS uu Ãt0PjCxPC|Phǃh S>u Sr1؍e[^]ÍvUSRE ]u ǃ%PPIu1v]ÉUWVS\E$EM@(EE@,EE@0EE@4EE@8E܋E@<E؋E@@EԋE@DEЋE@PUE̋E@TEȋE@XEċE@\EE@`EE@dEE@hEE@lEE@tEMA1EEۋyptPRS RWÅۉ]u1MK(EC,MK0EC4M܉K8E؉C<MԉK@EЉCDM̉KPEȉCTMĉKXEC\MK`ECdMKhEClMKt3;uus[;}t{pEEu$P4@tu S<u SM1 ǃx؍e[^_]UVuSt ^v4$ރue[^]ÉUVSuAdžË sYs $Ãu͋u _ZS$aF$SF$$>XU[IYv@Zv 7X+t Ѓue[^]UE@]ÐUU9BM u
215 J
216 ]USSE ]t%PdPyFu1
218 e[^_]ÉUVSE ]uCC1HS K !‰RCCPQSu)uSxPs sxR0ǃ1e[^]ÐUWVS u^V)9E ׋N )ϋU +F9$SWv vFV+F V Fo)uv9| SUǃudž1AV ;҉FtFQ)PRW!ZvV F)Ѝ8F~~ ‰Ѝe[^_]ÐUE]ÉUMt Q)‹A)]ÐUUtt)1]USR]t+CxRsxP0@]ÍvUSS]t+CxRsxP0]UUBDt0tp0rxR-ÉUUBw
219 1]Uuuu EpxjPÐUWVSE ]E}uS:u#ǃȯEu}E ]e[^_] e[^_]UWVS }EWxPu] SwxuRtt#=u7]2u4vt1'vLJ\VuSW e[^_]ÍvUWVS uEVxPu] Svx}Rt-t7Q uKuSjVgu_]3vuFvt19*vdždžWuSvxjV)e[^_]ÐUuuu EpxjPÐUWVSlUE;PxMEMv] M19BEU1 EM1 z n b V E]1E EU2 ]M  EEEEUMĉMuuEPuEċ]SUċM
220 $Pui]EUZ0tQjEPrE
221 R0MADtuuuQ)} 5U ]19H T
222 u] EċM&
223 Mu
224 vUm vP]E+C@PEC@PSS,EtLEP0tWjEPMq҃ v]sD uuuS({ vUE+B@PEB@PERdP< QjPE$P7ËMtۉpu/xu
225 |t  ]{D_v{vswKEPDtuuuuP)CUEE؉jCEECPsR]CEM ҉HQEpltR CP,C ss sPUrpRl M]KD?vEP(u jjuuP UtË8v j$vÃA j _C) CMUEB@C CCPRRƋEstJCKV)9~%VQƒ҉SCWssQCCMq(EE}5C+C4Vs[ƒ҉SSMɉCtSCS4EEtSUCEEC C HPuVWuUR8 9uuE C PC Puuu/ QMs qQ(E$97C ]SD4UB(u0 jjuuR tvMA(]C(uE@,(U]Z@SRERPSEuP8E M EPEPuuQ3  ]C(tWusЃEH,t"p(t
226 U]uȋEpуE P5EteMQd҉t0q҃EUHMCCBȅuMYDtuuuQs#]+uuuS'vU E9EUM]ES@PSuURE;Hup98tUM]K,tAEP t7@tы]K‰BAuEH,Ur ]sEPDtuuuP["UB tMMQd҉t0qҋUB @MA UCCBA uMuuuQ!uu]S(>Uz0]SPk PSMqQ0]bEH0tRjEPUrE
227 R0*MADuuuQv]C<t
228 sExDtuuuP! uuuuuu
229 Uă Uǂ|uQ]K0tWExDu6C s$EEPuEPuUR8E+C Ps sS02UES)PR]svEPDtuuuPO } M U91]K0t~ExDu]u]U MA q$SuVEuEP8EUME+A Pq qQ0EUă9uUEV)PR]sуlEXDtbuuuPvuuuuu8AuuuuސUJDtuuuR{vUċMUe[^_]UWVS,UҋuEEEEPjE]04Sb.EufUE2dP1MWj}7S$.EEtuPiE@ EUVu M Q$E܋}E싟9~BP9]~PuVu U R$EUE9UEvMv]4u } WMP4WQ ƃ}xt&E;xxuU@M}AME| ~t01;M})EP;2u ZvA;M}I;4u\EUPtMtSu Q% Ut#]}UZvMFvEt<ttEu P\0]}CUNtJUtC~ t- uM]4Vvu MEE؋@EE}9}EUE䉂MQtQxtIE]9]}G}9uEǀ1EM9M}%]}9uE Uǂ1;]1MQ
230 xuiztbyt<y t* ur2qu u8v@Ev@}MG}BG}C ;]x]}u؅E1E9E%UMx@SjE4DP)@x1EU;w}LM;u$ȃ Pw.EGUF;w|C<:uM;u$ȃ P#.}ECuUM]Mu@E}9}E9E}UM@]9ډU|U
231 }tC @[uUBtXM1F<:uv]}Ë7EpUCBEEE<0uCMM;K~e QMUǃEԉCPssW5MtC9B uz u s{CCWuVPC]1e[^_]ÍvUWVS E18t FU<uMtFEt8;s~"VRUs[CtGMKGU@ jbÃt ~WMCu S
232 1v{sWVusMtsFE U EC BCM9uE9uEǀU ZMCEP`t"VM Y1H!Eu1Ep҃e[^_]ÍvUWVSuV}WE P]sxS'U tǃXVWRSe[^_]ÉUWVS]UM ;KxEu8UM-EUEM1EE܋EUMEE؉uuuu U RUM܃,G$C@t svKDtuuu SEU1S0tPjEPsE
233 S0{Duuu S^K0tuE xDuT}uM C s$WuVEu E P8EU܉E+C Ps sS0UE9ujvUEV)PRsуOvKD[EMAUi.EavEUExe[^_]US]CxPC|Pt1S=]UWVS(EPEPEP]EPP}Wusxu VEEE0u
234 u}u
235 ǃ|CDtWusxSUt$Cx@@9B@tE艃wSxovUteCxRsxPUPRsxPV'u2PS2ƒu E艃v1e[^_]ÉUVS]KtEvJyRVu EEESttlt$LuEt uЃMuuVJƒtE艃ESx1Et uЃe[^]ÉUWVSE ]E}uSu#ǃEu}E ]e[^_] e[^_]UWVS ]ESxuPVu sx} WuPVu sxS e[^_]ÐUWVS u} ;~xuTEUPEM 1 1}o vb V EE쐋UM
236 UEUjE t]u} }}-}tMuEME]E WuuuP@ 2T$`uujV{~x+vVHuuWS&$PvVH$"uuuWW4 E+G@PEG@PWdP#Ã S Xptpxt8t.|džxuFht vЃFL# vЃvdžXu uuV:uuWdP"ÃPjS4P`ƒ҉9ttpvptRVjuuWVqƆ Ɔ!CvƆ 4Ɔ!(x j!P P dPE+G@PEG@P PWVA xpɋtt Rj P7 kvE+G@PEG@PWVS
237 ɉtptAp+ttV\҉AtUPj 0$P; u3MU
238 p p 0vV\ tp |uFht vЃdž ~E+G@PEG@PWdP  B jBpt5 &uuWdP/  B^PpۉtEMr p p p 0vVP  NXMU
239 p p p 0vVX YRuuWW,tdž 7vuuWdP=Ã/xt)Qj S$P 9tp덍vVTdždžuuWP|uuuWW4@VE+G@PEG@PWPWÃI SE vtTNTtME+G@PEG@PWPMU
240 PvVT Pvt/FTt(UE jvVT P^} 
241 9rTtPv dž j u#v<|,<,f||uFht vЃDFDdžxtNuuWVN9} t
242 } t*uuWVuuWVFDt"} | }~}tuuWVEEEPuuWEe[^_]UWVS u] Edž}EFxuuSvxU$0FDtEPSvxVMttEmvNDtyuSvxV(gvuSvxVuSvxV{u@IE8u -t1" ]e[^_]UE]ÉUVS]SuuuVu uS uCuC ;Ctx u HC C ;Cu Su C C 1e[^]ÉUWVSEu}EvuuVu U R +$1E M;AxuEM U;JxuVu U R(Ãx;Mu uG ;GNx DURSU ÃuE M;Axu19W ;Wu Wwt0W MFG 9|uVu WE p@uUuW ;Wz W ;Wu WtW  G bPU E+B@PB@PRR,Ãt*W ;Wu WjW G M E+A@PA@PEQP-2SjPE$PËUۉu(xM ;Jxu {tU E;Pxu vStE M;AxuaCuM U;JxuACCWPsuEP Ct wvue[^_]UWVS]EudEuuVu U R -$`M!1uVu SE p@uS 9Su StӋS 
243 C Vu U R(ǃxURWUǃuE M;Axu}19}nS 9Su S_XS MFC 9|;vU E;PxuE M;Axu Evue[^_]UUBt*< uэv< u
244 BA<
245 u BBAu]ÐUWVS EH4ɋu ]}uPDWSVP,F@CSVVPSU´VREU Et5UF@)WWuVV PVuÃu1' S SEupP4[ue[^_]ÐUWVS uF8M ]Uu~DtWRSQV\IvA@@)RA@PQWCÃu1! SXZSvV8<$*e[^_]ÐUWVSE xD]uux;CxuUGEUEUE C s$uVuEu U R8EUE+C Ps sSDE9uuER)VPsSDe[^_]ÍvUWVS Mɋ]} uUt61ɋS 9}֋C;8A 9|Etsu  u{S ;SuEu Cj`蠸CPsTCKu15vKvS RUPUPMɉ8uGC e[^_]ÉUWVS E 8u<:E 9t<vp;lu dPtfpCp9uNjp;lu dPNt-ppSjtTPW ƒu16t9uptpE PG-e[^_]UWVS up;lu dPppuuu dP0ÃQj CSDP EE9ttpyp҉t_xu{{muu{luo{nui{sucCt<:uXuUBPjCPTP UBE@ 1ptvEv<:1;}}<p;lu dP_tppG;}|ŋp;lu dP$]ppWjtTP) UBt9*pEU7Ee[^_]UWVSu1;u P=xtO19}G;u P/`@C9|TPEPEB UMYt3;u u E5;u usCuŋ;u u8i=UBxtO19}D;u u MA@C9| u! E$Pu
246 E{tzt3;u u]  4v;u u# tXCuɿ ue
247 Ãh;u P u1e[^_]ÍvUWVS ] ;u-E< tun;u uY Qj$P^t@?tG<=d;uE;u u JRjTPEU9u&PdPc
248 UŠG< _tMtIv;u u1 AC< tu;u u
249 tl PjuV> t;tC9;u u
250 u1 Ge[^_]UUSӉt1v< t< <
251 t< u9tz t  BAu9tz uJ$ÍvUS]C@Pu$ C$C $C0$CTCXC\C`]ÉUVSuFP]SPt p蒱 Suۃ V*F$F $F0$ F@$.e[^]ÍvUWVS$E 0PEPEL:v0E@P0QjPE0P uuE  PuUBL;BHuЃ @PsUBLE@LE6@P8Rj @PE P`ÃFC~t5F C E \V9u E\CVjE20PC uBƃ9E Pu (vE7@PSjPEPÃG t@ P蹬CGtQj0E PgCG C CGtRj0E0P@CE1;S }u1PjG00E PS2GD0D2GD0t"PE@PSD2u1hCD0EE ;C | uǃQEu @Pu,tU BTUBTU BXUBXe[^_]UWVS$uEP} EEE[v3WRj Pu
252 ƃC tFPWtjF CtH;Eu
253 EF;PWE{t=FEPssWt!FCFCtPW>u1#vF uÃ-e[^_]UMU u AB:t1]UM1Ҁ9tvA9u]ÐUWVS }WuMEpjj@責W G@G u ËGH!Ã u mE_K!Ë4t,0u $u_K uԋUG 9GGjPEEƃ1ۋW9sHt9 0‹EH!‹tvuUJ uWC9r 7軫7EGEG ]K#]tu_K uuj\ƒ҉u1 E GЍe[^_]ÉUVS]1K9s#t P(KF9rtUe[^]e[^]ÐUE@@ @]ÐUE @MA]UM;Qtvu;Qu1]UE@@@ @]ÉUS]Ku
254 CvtK
255 S…uCC C$ÍvUVSut P؃uFtv Pݩ؃uFF FFe[^]ÐUWVS ]K ɋ} uu S^u18vEE S?t sC PVuWW8 9uu֋Ce[^_]ÍvUVSu] V ;Vu Vu1V V BV Cuϋ^؉Ve[^]UWVS ]S ҋu }u Su1>vS ~,;Su S~t܋S C O@FC ՋsSe[^_]ÐUSSuuu ]StC ;Cu S!u1C C C]ÍvUWVS uNtq^u&FQAFVV
256 V);y}>FVRWSPF +FDF BFB^Vt@9u9)ڍCP6膦ƒ҉tIF +FDF BF؉Zw)߁ GPnɉMu1LV ^9ډytAQ)RSP;^V M)ڍD
257 F ȃFDFe[^_]ÉUWVS]jCL@LHui1 GvE0EU싂P؃  jU pmOUye[^_]ÉUVS ]s1C t XP؃u Fv΍e[^]ÍvUWVSEu XFh%0kuPjjVT61e[^_]UE@ɋU t UUVSut6v<&tBC#EPR't
258 =CUue[^]ÐUWVSL}?&tU tGU ;EE#u@Xtxt jj
259 EP jjEPGWE]>vM1EMF!CU Pu€;uٍUEtqG  ۉMEtKEȋ3P6u)FuEtCUBMCEE ][uEąu GU8;u@Eċ] tEċM Ee[^_]ÐUUfP`1f@]ÍvUWVSDuVxS}$Wu VSAShe[^_]UWVSDuVxS}$Wu VSh@ Dž<HDY^h@ @8CDXZh( C$He[^_]ÉUWVSju} Wu(Pt8 t XtD((6QPVSXZjSM8t@t9G~
260 DžDE\hVWuj(S$pe[^_]ÍvUWVSuFXF\\hSPu1wtjrPSVW۝ rPSVW補ǃ 'tjPSWp jPSWu0\hSut#ujjPW W:!ujjPW蓝 WtIz,t<^Hu5Qz1IQrVF(_XjVNujV6 V.xFHe[^_]ÉUWVS ]{uuC tK;K|
261 1LvKt C)ȉ;U|Uu
262 ~t
263 9~
264 GC)3Rju Ce[^_]ÍvUVSQjp]ju S膟C8C<CDCdCHCPX ~C\~ CX~CTe[^]ÍvUWVSUE r0X4h}jWUE W\UGXGPE_TGLW`t>hKwT?ƒ҉Wt"BGF BFGt P@$_ CCV~UC B,tC_4 CCVQC Ep,tCjjjuuu e[^_]ÍvUVSut Pmt P[t PE^ v Su^4 SuF,t PF@t PVtFPe[^]ÉUWVS]DžU DžDž1IvQRC\ph&RV萝4$")%8uEtuS WjPSHƒau uh%CXuS7iu mu
265 gu u8CXtuS3CXh%uSBv%8u%h%juSP/$PWVVS uNUtGCX1҅t WuVSƒ uCXtRuVSO
266 e[^_]UWVS]1U 1IvQRC\ph&kvRWZ<$V t/%8t"PjS+ƃWVS|e[^_]UWVS ]]PDҋ} uK(t S<C='~jS PVWSDz tWS8t7E19}(=U萋MDG u.F;u|UE ]e[^_] vQVS XZjS< UL` )ǃPEPS e[^_]ÐUEE C UWVSMu }D1ES9щM|!'9}DCP3ECEE1҉E䐋C)ЉECuVuPZU~Stsu\GX~Pj h&C CujV7ƃt(E)@E~SuQPh '趕e[^_]ÉUWVS ]uۋ~Xuu :uFLu W' tDjV
267 $ujuF PjujuF4P}u vT7ÃuzMusu7WLtPF\pu h`'0jju vT4Ã4vu,jBV $ujuF P8 t/jV $uSuF P  F]u=uQF\pu h'TDzth(jVu _u vT7Ãt%jV. $uSuF4P ^Ct/Pu ʑuC ujVC @C e[^_]ÍvUWVSu} WF PVvtRWF4PV]EuWFXy8uFL^Ct.PWuC ujVIC HC e[^_]ÍvUWVS U1DEEu 8‹]uBj
268 SE}ClC\p,jS u E8MuKCX@ p3|0tjSf C\P,tjSG C\@,tK(j S,t }1Bt u1MB1ɋBCLUShu 8uj SMKpCLE 8hu,PDPtj S}USxvM eu AmuAtHE EbuU Bt/u 8tEiuU Bu3jSEtC|{t ǃK|M bu AruAt%U iuBmu BguBuV$ u !u
269 Ex
270 uQjhCSEe[^_]ÉUWVS$1} IE@Xu SuDž’.1ۅ~v41|򮋅)=vu h@([ W9ZYt$YXjuuu Wur tPVWun<t LAe[^_]ÍvUVSEۋu "vCvsV脐tu1e[^]ÉUWVS4} 1IE@Xu S!.@U1&zE4DžDžE1򮋅)=vSu U4h(vRqE\;tr RWZYju_XjPPPRu1уIQSu jRugE t Te[^_]ÐUWVSUEEB\H,EE]EM t{QttÐ޿8uUM DtE*޿%8uUM DtEEUM Åt|uu]h%uōu6h%uZ tUBXt~jRn u_Xjou[^jEPEPuuu1}уIQuuH juuZYjpupe[^_]ÐUVuS]tKS C9|#'9}AC@P3SPVu RDSSe[^]ÍvUWVS(uFXEVE~E?LU ujMTE}DP uS~ CF~ËUDMDA tFEu'~}؋U؊
271 U}؋E
272 t!DC tB
273 t
274 DC uthF(uSFLPjjuvPRuHFH F\pv6F`PvTN t jv6vF`P& t/V9~(M RV)PRP+~~Fe[^_]ÐUWVSuuFX] VE$É$E;h&St9u C PEh&S褊u bhS膊utBH9Uu2E싀tt%FLEQLPjjWvPSuFHFLe[^_]ÍvUVSE|ۋu "vCvsVtu1e[^]ÉUVSEPu h]V讆YXV`e[^]ÐUVSEPu h]VrZYV蔇e[^]ÐUWVS uFXh&jU RVEEEÃtsFXuR1IQSVLjVM_XjEPEPuuVS1уIQSV juV=e[^_]ÐUWVS}u WEEGXEtI1ۅt:Nt3u4膄u DtEtDu΋Mu1}vUtpE苀t$uG\@PuÃ1VGLPEPjuwPuEPuhGH t SEe[^_]ÉUUE @8@<@D]UVSEһt"1ɾPdvt A~[^]ÐUWVS Dzute1;} h=C芆;|] ۸&u²MP*&tUPVҸ%u?&Pu hH&= 1} у Q#UÃStBECtFu C P苇U@HuMF9|7Pvu h(FFY_Pv F F B)uu h)BF BZe[^_]ÍvUSP] tC D uPt1ju$ ]ÐUWVS }u
275 1vPG 4uFtH^tODztR1;} h=C覄;|NɸZ&u²PWҸ%u?&PF Phf&m 6uve[^_]UVS]1O19}OӉBtBA9|[^]ÍvUWVSEEU BX@4}uP~Ã h=ӃKuuu}²umE Et&e[^_]頃UWVSUBX@4P:Dž9ƅ}Éh=V>Ku1;]yPh);]DžDž5U DB C;]M  DB uvu <3
276 u-;]}8B t:C;]}:u 3DA u1U 
277 v
278 M  DB@uCPhOB1ыL
279 C<vM  DP u1ыL
280 Nv hBDž;]u hB譁e[^_]ÉU1]ÐUS] @/ȃKЈƒ#@)$ÍvUM SYЈ@/؃IЈƒ#@)$ÉUS] @.ȃKЈƒ#@)$ÍvUM SYЈ@.؃IЈƒ#@)$ÉUM <uAƒ%v<u1ҀyuAB<w v1҉]ÉUU 1:u B0t]ÉUWVS ] }9u;-vE1D0H$@0)H~ɃSV`uG{)؃~SVduY)؃~SVhu9U1=vC9t0;-uC9t&;>SCU C9Ge[^_]ÉUVSU M9ʋ]uDH t/uvBuME ][^]vB!bDH w@$0B9t>BDHt#
281  | t 1 B9u[^]ÉUU E)S1ɋ] uJ<Xt<xt>B<Mt<mt ,B<Lt<lt t1v $UWVS ] }9u]/D0H$1v)H~ESVTz)؃~/SVXv)؃~SV\vD0H$1C)H~ɃSVHcv)؃~SVL59)؃sSVP EPSuVJD0H$1)HSV`uSw)؃SVdM)؃SVhu)U1hvC9t[;>uCUEIC9G9EPSuVntC9t;>tËE1v9Le[^_]ÍvUU E)V1ɃSu0218uAB~[^]ÍvUWVS ] }9uD0H
282 $@2C9;]vC9;>tKbCU(aC9Q|0H
283 uCE7CU%)H~JSV`uYv)؃~$SVduA)؃ SVhE1U1D0H
284 ww$p2)H~rSV`u`S)؃~SVd`U8)؃~(SVhu UC9sEe[^_]ÐUWVS ] }9unD0HA$2)H~ISVT)؃~/SVXv)؃~SV\vU1D0H$3C)H~SVHtv)؃~SVLtmt)؃sSVPiLC9tOVD@ t 
285 |!vuC9u$CUE1v9e[^_]ÍvUU MV9Su]tDDHDHt||B
286 1 B9uǸ[^]ÉUVSU M9ʋ]utL:xuBE [^]t|@vD@t t1B
288 B9u׸[^]ÉUWVS ] }E9EuD0HS$3)HSVT+/v)؃~cSVXt] )؃~?SV\UCU}E ue[^_]U1D0H$3C)H~SVHtf)؃~SVLt=D)؃wSVPmCU E1v9Pe[^_]ÍvUWVS U ;U}D8H$`4BE E)HRWHE 3E)ЃRWLE)ЃRWPE Ov 
289 ~ B;UE D@uƍO |
291 ~t E1B;UE t@FwB$4E)HSW`t
292 E E vE)؃SWdxE vE)؃SWhtE E PM1E PuCPWCƒ(uE MvE1CE U ;UӸOD@9B;UE ӸgD@ w$5U1CB;UE Ѹ+D8H$@5AE E)H~jQWTu
293 E E vE)ȃ~8QWXuE M1E vE)ȃ
294 QW\uE *E VBMXB;EE tGz>t U1=BM,E1"vM1vE ;U:e[^_]ÐUWVS ] }E9EuD0H$5)HSVTv)؃SVXi)؃SV\9=C9;D0Ht)@EEC}E ue[^_]UCU}E ue[^_]EEC}E ue[^_]2UCU}E ue[^_]D0Hl$ 6Cj)H~ɃSVHtwGv)؃~SVL)؃wSVPt%D0H$6U1Co)H%SVTH)؃SVXt")؃SV\tQuWSVcZC9OICU>C9t3;>ECUE1v9le[^_]ÍvUWVS ] }E9Eu"D0H
295 $7vUCU}E ue[^_]EEC}E ue[^_]C9|0H
296 uCUCUC9};]bC9k;>KJ)H~JSV`uY(v)؃~$SVduA)؃ SVhU1E1D0H
297 $07)H~SV`XU)؃~|SVduj])؃~SVhu=UCC9t%{]u S9t{>tE1vUC9;Ee[^_]ÐUWVS ] }9ujD0H$`7)H~}SVTv)؃~SSVX)؃~+SV\tAED0H$7U1C)H~SVHt[b)؃~SVLt@)؃wSVPtCUE1v9He[^_]ÍvUWVS ] }9uD0H$@8)H~=SVTj)؃~'SVXv)؃~SV\~D0Hwx$8Cy)H~уSVHtSZ)؃~SVLt18)؃~SVPtEE1v9de[^_]ÍvUWVS ]}9u D0H $09)H~FSV`uSv)؃~ SVdu-i)؃fSVhuBE1EvC;Eu/9t3ED0H w$p9C93e[^_]ÉUWVS E] 9ËuE}u }D0H"P$9 WuCPVj G WuCPVj /C;] D0H$`:EEC}E ue[^_]BEEC}E ue[^_]nCC;Eu C;]t8VvD@
298 t
300 t vt C;EtC;]uΉUEEC}E ue[^_]C&$CC;];]u,C;Eu {>uC"vCC;]D0H }$:C$|C#lC%\OC@C0EEC}E ue[^_]>E)HSVTtEvSVHEvE)؃SVXtEySVLZESvE)؃~fSV\tE%SVPEvECvEvD0H$@;E)H~ЃSVHE)؃~SVLtlovE)؃~SVPtHKvP}t6C A}t"C-}tC1;]#]Ee[^_]ÐUWVS U u9}]uIvSVBPWXvBB'|D8Hw`$;TvLvDv9t?1>9t/9u)B9t|8H
301 uBv9tB9ue[^_]UWVS U u9}]uIvSVBPWpvSVBPW`vB|uD8HwX$<LvDv<v9t79t/9t'9u!B9t|8H
302 uBvB9ue[^_]UU MBIV9Su]t>DH w$<: uy<$t
303 <@t1
304 B9uø[^]ÉUWVS M }uE1EAUTHЃw$<Uu9}  D EAEu9}  D E뚋Uu9}  D EsEg9}  D EJ}t&9} QTEE !v} 2}t&9} QTEE v} 9E} LC}tT}9| ;LtL9 uGy tAAUTHE9v(}uE`}T9LD =v}0 [^_]USQM 1<xuMA9;tcvPЃ6w($`=0 \
305 v\1A9;u<;t\BЁA9;u]]l]]ÉUE U)ƒt8 tt;}xtuv<gt <lul<g>_8auW@8muQxpuK&Fat!qu8@8uu2@8ou,xtu&"!v@8pu@8ouxsu
306 'v1]UVSuM ]D0Hw<$@>CA8uJCA8u@CA8u6CAAC8t 8tD0Hw$>v1[^]ÍvUUSM ]t9t8t1BAu19$UU SMDHw$$ ?vۍvӍvB͐)ډЋ$ÍvUMU D@ |
307 ~uB]UVSU ]9ڋuMtcvD0HwH$?<v4v,vAB9t |0H
308 uBABA9u[^]UWVSE M}0Uȋ))9~) 29v"A%<uvI9v A%<t9t BC9uE [^_]ÉUWVSU }
309 E9uvUDHt@ ttWfЊA?f fvŠA?f ŠA?f fovC9thЊA?  ŠA? ŠA? 
310  ffS ffA9t9 E U[^_]ÉUWVSu ;U]}tZ
311 y,I ?BɀJv 9t";Ety‰)H[^_]ÍvUWVSE }9u]t&9t ffAM 9t9u[^_]ÐUWVSM }9]ut9tB9t9u[^_]ÉUE-'U w0$E&==|1v]ÐUWVSVE U9Ћ}Ev]Sƒ3 }Btt=m=|fx";Eu]U G"vE)H# Ѓ?΀BZE)ȃ~L A ƒʀQ?΀BZE)؃UE vщ AC ƒʀSAE]C ƈ ƃ΀A?AʀQEU9UwE] [[^_]ÐUWVSE EuE)؉)ʃ9‰~F%<u9t6;}t1vfAf fESAM 9t;]u[^_]ÐUWVSPE U9Ћ}Ev]ƒs }Btt=m=|fx";Eu]U G"vE)H# Ѓ?΀BZE)ȃ~L A ƒʀQ?΀BZE)؃UE vщ AC ƒʀSAE]S ƈ ƃ΀A?AʀQEU9UwE] _[^_]ÐUWVSQE }Eu)؉)ʃ9‰]~F%<؍Vu9t39}t.ffQ fESAM 9t9uZ[^_]ÐUWVS ] u9}{;-CU {u
312 D8HPCPww$PF)H~gv)؃~Y)؃~IE1Kv9t<{u);-u$9t*{u ;>WU19Ue[^_]UWVS ] uE9E}3{u D8HvPCP
313 t1Cvu2UCUuE }e[^_]dCU!E1{u
314 D8HPCP{ w`$FC9th{u CD8HCPCP>t&
315  |tEvU1v9]e[^_]UU E)S1ɋ] uzzuXt xt `zuMt mt <zuLt lt t1v $UWVS ] u9}]"{uUDHvPCP$ GC @.z)N)ރ)ރ{uUDHPCPZ$GC @/Ѓ@)))N{)ރi)ރYEPSuu{uUDHPCPwc$H)HOv)؃=)؃)9tl{u;>uCEWv9eBvEPSuuPt9t!{u;>t19ae[^_]UU E)V1Ƀ Su@H%zu8t1A~[^]UWVS ] u9})ةtu v4{uUDHPCPO
316 O$PH9F{1;](9({u;>uC(9{uU|H
317 tvPCP
318 uC)Hv)؃~})؃hv1p{uUDHPCP/
319 w3$H)H~,#v)؃~)؃~9ue[^_]ÉUWVS ] u9}{uUDHPCP<$HC @.z)N.)ރ)ރ{uUDHPCP$ IC @/Ѓ@))N{y)ރmkv)ރ][v{uUDHPCP t 
320 |!vu9u!C19e[^_]UWVS ] u9}{u D8HHPCP0{u
321 D8HPCPt||CU
322 E1v9ue[^_]UWVS ] uE9E}Cu;xuCE e[^_]uUDHHvPCP/{uUDHPCPt t1C
323 9ue[^_]UWVS ] uE9E}S{u UDHPCPo$IC @.)N)ރ)ރCE E}uEe[^_]{uUDHPCPwl$JC @/Ѓ@)uA7v)N~-)ރyv)ރivC 19Qe[^_]UWVS }] 9n{uUDHPCP] $pJC @/o)O )߃v 
324 ~ C9E {uUDHPCPK] u [
325 ~ MC9E b{uUtHPCPƋ] Fwuwo$J)Hav)؃~CQ)؃ C6vE PWCPuƒuE MvCE ] 9{uUDHvPCP'] 9AC9E V{uMDH PCP ] $KC9E {uUDHPCP] $PKC @.Ѓ@)teCE u)߃~zU1qvCU_C9E tM{u;>uCM8U1-vM1!vE1vE 9e[^_]ÉUWVS ] uE9E}{u UDHPCP[g$KC @.O)NV8)ރ)ރ90{uUDHPCPt'CE E}uEe[^_]PUC}uE Ue[^_]CE E}uEe[^_]UC}uE Ue[^_]nrCa{uUDHPCP$0LC @/Ѓ@))Nk)ރY)ރI{uUDHPCPgww$LC @.Ѓ@)tDWVSuM9u>vC49t({u ;>1v9e[^_]UWVS ] uE9E}-)ةtu 4{uUDHPCP[
326 $MCE E}uEe[^_]UC}uE Ue[^_]R9{uU|H
327 tvPCP
328 uFC79&{ ;]9{u;>tCv)H v)؃~v)؃|1v1v{uUDHPCP
329 wc$@M)H~`Sv)؃~RE)؃~B5C9t4{u{]uS9t!{u
330 {>j9ee[^_]ÉUWVS ] u9}A{uUDHPCP#$pMC @.)N)ރ)ރ{uUDHPCPwl$MC @/Ѓ@)uA7v)N~-)ރyv)ރivC19Qe[^_]UWVS ] u9}1{uUDHPCP$PNC @.v)N)ރ)ރ{uUDHPCP?wl$NC @/Ѓ@)uA7v)N~-)ރyv)ރivv19Qe[^_]UWVS ]u9} {u
331 D8HPCPk $@O)Hv)؃~})؃xfvE1gv;EuO9tSE{u D8HPCP w$O9)e[^_]UWVS] uE9E})ةt 4{uUDHPCPG"H$O WVCPuj uA WVCPuj ])9{uUDHPCP$pPCE E}uEe[^_]JUC}uE Ue[^_]*CC9uX|v{uUDHPCP+
332 t
334 t vt
335 C9t9uCE E}uEe[^_]jC&C9{u2;]u-C9u
336 {u{>uC"Cv9e{uUDHPCP $PC$C#
337 C%CCCE E}uEe[^_])N)ރ)ރElE`SU @.EeEЋE@)tEU@/U‹U@)E{uUDHPCP$PQC @/Ѓ@)uukv)N~a)ރuSv)ރeCvR}t6C C}t"C/}tC19]Ee[^_]ÍvUWVS ] ;]}uBWuCPuvCC'{uUDHPCPO$Q9t~1}9xj9ud;]t^{uU|H
338 tPCP
339 u"v9,;],e[^_]ÐUWVS ] ;]}uJWuCPuvWuCPuvC{uUDHPCP $ R~vvv9lr9xf9t^9uX;]tR{uU|H
340 tPCP
341 uv;]8e[^_]ÐUWVS ] u9}{u
342 D8HPCP w,$R{uB; u=0vSut)vSҸu$t@t E19ye[^_]UWVS ] }E1E{uUDHvPCP[w$SMu;u} D EC렐Uu;u} D EwEl;u} D ENv}t&;u} STEE !} 2}t&;u} STEE } ;uE} \Fv}};u| ;\t|{uv; uqCu{ tduCUDH;EtO^vCPCP;E='}uE)};uD }e[^_]UVSM A1un9xuiAu 9;uSЃ6w'$pSC t3
343 vt3MAu9;u.#utBЁAuۀ9;u։u[^]30v[^]ÍvUM U)ʉtj tv yytyugtl<>y9ay9my9p&yuat9qucyuZ9uuUyuL9ouGyu>9tu9"4vyu&9pu!yu9ouyu
344 9s't1]ÐUWVS }] u{u
345 D8HPCP'wH$PTFC8ujFC8u`FC8uVFCCF8uBCF8t6~u
346 D8HPFPw $T1e[^_]ÍvUMSU ]t9t
347 zu8t1Au19$ÉUWVS ] uߍv{u
348 D0HPCPw $0UǍv뿍v뷍v)؍e[^_]UVSu] {u
349 D0HPCP |
350 ~uȉ؍e[^]ÍvUWVS ] }9u{uUDHPCPOwl$UbvZvFI9t3{uU|H
351 tPCP
352 uFvF9Ve[^_]ÉUWVS ] u9};{-CU ;u CD8HCPPKww$X)H~gv)؃~Y)؃~IE1Kv9t<;u*{-u$9t*;u
353 {>WU19Ue[^_]UWVS ] uE9E}3;uCD8HvCPPk
354 t1Cvu2UCUuE }e[^_]dCU!E1;u CD8HCPP w`$ YC9th{u CD8HCPCPt&
355  |tEvU1v9]e[^_]UU E)S1ɋ] uz:uBXt xt `:uBMt mt <:uBLt lt t1v $UWVS ] u9}]";uCUDHvCPPk$YK@.z)N)ރ)ރ;uCUDHCPPZ$YK@/Ѓ@)))N{)ރi)ރYEPSuu;uCUDHCPP/wc$`Z)HOv)؃=)؃)9tl;u{>uCEWv9eBvEPSuuPt9t!;u{>t19ae[^_]UU E)V1Ƀ SuZ%:u8Bt1A~[^]UWVS ] u9})ةtu v4;uCUDHCPP
356 O$Z9F;2{](9(;u{>uC(9;uCU|H
357 tvCPP
358 uC)Hv)؃~})؃hv1p;uCUDHCPP
359 w3$Z)H~,#v)؃~)؃~9ue[^_]ÉUWVS ] u9};uCUDHCPP<$[K@.z)N.)ރ)ރ;uCUDHCPP$[K@/Ѓ@))N{y)ރmkv)ރ][v;uCUDHCPP t 
360 |!vu9u!C19e[^_]UWVS ] u9};u CD8HHCPPW0;u CD8HCPP/t||CU
361 E1v9ue[^_]UWVS ] uE9E}u{xuCE e[^_]uCUDHGCPP/;uCUDHCPPSt t1C
362 9ue[^_]UWVS ] uE9E}S;uCUDHCPP$[K@.)N)ރ)ރCE E}uEe[^_];uCUDHCPP7wl$`\K@/Ѓ@)uA7v)N~-)ރyv)ރivC 19Qe[^_]UWVS }] 9n;uCUDHCPP_] $\K@/o)O )߃v 
363 ~ C9E ;uCUDHCPP] u [
364 ~ MC9E b;uCUtHCPPSƋ] Fwuwo$@])Hav)؃~CQ)؃ C6vE PWCPuƒuE MvCE ] 9;uCUDHvCPP] 9AC9E V;uCMDH CPPC ] $p]C9E ;uCUDHCPP] $]K@.Ѓ@)teCE u)߃~zU1qvCU_C9E tM;u{>uCM8U1-vM1!vE1vE 9e[^_]ÉUWVS ] uE9E};uCUDHCPPg$ ^K@.O)NV8)ރ)ރ90;uCUDHCPP?t'CE E}uEe[^_]PUC}uE Ue[^_]CE E}uEe[^_]UC}uE Ue[^_]nrCa;uCUDHCPPo$^K@/Ѓ@))Nk)ރY)ރI;uCUDHCPPww$_K@.Ѓ@)tDWVSuM9u>vC49t(;u
365 {>1v9e[^_]UWVS ] uE9E}-)ةtu 4;uCUDHCPP
366 $p_CE E}uEe[^_]UC}uE Ue[^_]R9;uCU|H
367 tvCPP7
368 uFC79&;{]9;u{>tCv)H v)؃~v)؃|1v1v;uCUDHCPPW
369 wc$_)H~`Sv)؃~RE)؃~B5C9t4{u{]uS9t!{u
370 {>j9ee[^_]ÉUWVS ] u9}A;uCUDHCPP苾$_K@.)N)ރ)ރ;uCUDHCPPwl$@`K@/Ѓ@)uA7v)N~-)ރyv)ރivC19Qe[^_]UWVS ] u9}1;uCUDHCPP#$`K@.v)N)ރ)ރ;uCUDHCPP觼wl$ aK@/Ѓ@)uA7v)N~-)ރyv)ރivv19Qe[^_]UWVS ]u9} ;u CD8HCPPӻ $a)Hv)؃~})؃xfvE1gv;EuO9tSE;u CD8HCPPC w$a9)e[^_]UWVS] uE9E})ةt 4;uCUDHCPP诺"H$@b WVCPuj uA WVCPuj ])9;uCUDHCPP3$bCE E}uEe[^_]JUC}uE Ue[^_]*CC9uX|v;uCUDHCPP蓹
371 t
373 t vt
374 C9t9uCE E}uEe[^_]jC&C9;u3{]u-C9u
375 {u{>uC"Cv9e;uCUDHCPP $@cC$C#
376 C%CCCE E}uEe[^_])N)ރ)ރElE`UK@.EeEЋE@)tEU@/U‹U@)E;uCUDHCPP$cK@/Ѓ@)uukv)N~a)ރuSv)ރeCvR}t6C C}t"C/}tC19]Ee[^_]ÍvUWVS ] ;]}uBWuCPuvCC';uCUDHCPP践$0d9t~1}9xj9ud;]t^;uCU|H
377 tCPP7
378 u"v9,;],e[^_]ÐUWVS ] ;]}uJWuCPuvWuCPuvC;uCUDHCPPs$d~vvv9lr9xf9t^9uX;]tR;uCU|H
379 tCPP
380 uv;]8e[^_]ÐUWVS ] u9};u CD8HCPP w,$d;uC{ u=0vuCt)vҸuC$t@t E19ye[^_]UWVS ] }E1E;uCUDHvCPPòw$`eEu;u} D EC렐Mu;u} D EwUl;u} D ENv}t&;u} STEE !} 2}t&;u} STEE } ;uE} \Fv}};u| ;\t|;uw{ uqCu{ tduCUDH;EtO^vCPCP6;E='}uE)};uD }e[^_]UVSM 1uoyxuiu y;uYSЃ6w&$eC t3
381 vt3Muy;u/#uQtBЁuۀy;uՉu[^][^]ÍvUM U)ʉtj tv yyt9uAgtl<>9ya9ym9yp&9uAat9quc9u[yuuU9uMyouG9u?ytu9"4v9u'ypu!9uyou9u ys't1]ÐUWVS }] u;u CD8HCPP菮wH$fFC8ujFC8u`FC8uVFCCF8uBCF8t6>u FD8HFPPw $ g1e[^_]ÍvUMSU ]t9t
382 :u8Bt1Au19$ÉUWVS ] uߍv;u CD0HCPPw $gǍv뿍v뷍v)؍e[^_]UVSu] ;u CD0HCPP |
383 ~uȉ؍e[^]ÍvUWVS ] }9u;uCUDHCPP跬wl$hbvZvFI9t3;uCU|H
384 tCPPW
385 uFvF9Ve[^_]ÉUVSu] AFC<w B<w 8t1 uظ[^]ÍvUE?ѨUVSuPEPURE PM]Q]Q8 9]tEe[^]ÐUE t 
386  | u1]UWVS u ;u}uEiuVWcPvw@uVW<Psu;uuEE0H SGt4E0vw@uVWSuރ=t'`vw@RuVWÃtE=uE0E;0t4w@Pw@SuVWÃ Su݃"t't E 01bw@Eډ0҉U,CvCvCЃ v.t
387 -t_uw@QuVWÃ;]uE w@0e[^_]UWVS ]C@u)ƍEPEEPEEP}WUVRSEEEUE tEu Eh kuPSSuM uYEU tEU PuuuWVuS u EoMuU fEThkuuSSPVuSBvBv
388 EM$tEU$U(tPE+C@PuSUU(QuuuWVuS u EvUhkuuSStE tEh(kE+C@PuSSt},tEE,:h,kE+C@PuSStM,tU,E-vC@EVuSPu݋E9t
389 U1e[^_]ÍvUU==}t(=tvCu v]ÐUUҋM Ѓ?ȀAv, ?ȀAЃ?ȀAD8 ?ȀA?ȀAЃ?ȀA1]UUҋM xG f7,
390 -(f%-$fA1]Ut]ÉUu Eplt1)v@/Ѓ#@)Uu Eplt1)v@.Ѓ#@)US u Epl1ۃu Py؋]ÍvUWVS } u7vETHTE+9gBCIu;UtMMtɍuuÃREpl[Z]SPfE+9xe[^_]UWVS ] ;Uu}tZE9tSfFtfu(RplD0HTBf;Ut;Eue[^_]ÐUWVSEEEBM
391 ]AkM~EBMD
392 @<tt ] 9 1E}~܋EHEEEEpUM Q u&]EfDƄPƄP[y,U(؈M]ƄKfD *[C<t t ;]CUEMƄpqt UfMf S/y(]EUfDƄBƄB~1%Ӊ@.<@)t
393 M$@/…<@)t EUMU
394 uPSMU숄Jf\
395 EEEE}S]MEۉpltZǁH,ǁL,ǁP,ǁTǁXǁ\ǁ`ԘǁdԘǁhԘE@8@<Ee[^_]UVuS1ۅu)v"48VuC~e[^]ÍvUWVS u;uM }F;EYHuuQE =t6=<[v=M=B1F <t@vtt<vyEu UFUBqAE<yEu UFUB=uAEt~tyttF;Euy~uZUBcv>uuyEt0UB~u*t%UBuuV3'v1 AEUuuV3e[^_]U@A]ÉU@W]ÉUuuu juhPUuuu juhPUVS u]u ^u1#CEDCdC0XsHe[^]UWVSEPdP]SE PuhVdV8 9] u=dhIkWt~@t# hPu1Pe[^_]ÐUu(u$u uuuuu uhПÍvUWVS } G]uMUwT$0lSvhkQB@FPRRt1&v} ]e[^_]e[^_]UWVS } G]uMUw<$lhkQB@FPRRt1&v} ]e[^_]e[^_]UE Ut 
396 t#vtt1vE UDÉUE Ut
397 t v)t10vE UÉUWVS Eu EE}E]t!tetuZ1dWvhluuSSt
398 Ήh luuSSt
399 뮉u }e[^_]Ne[^_]UE Ut t
400 (1 ÍvUE Ut t
401 1 @ÍvUE Ut
402 t#vu1vE U ÉUE Ut t
403 x 1 ÍvUWVS E EEEE }u]$lhkVC@UBPSSt 1hkVC@UBPSSt \֐hkVC@UBPSSt 벐hkVC@UBPSSt뎐0%zEE }e[^_]s ve[^_]UE Ut
404 t#vu 1<vE U ÉUE Ut t
405 1 ÍvUWVS Eu EE}E]tt'YtCQhluuSSt
406 1Dh luuSStމ vu }e[^_]N e[^_]UE Ut t
407 ( 1  ÍvUE Ut t
409 1 @
410 ÍvUVS] uMUEt
411 t57vt-13vhkRQPPt
412 1] ue[^]w
413 ve[^]ÐUE Ut t
414 P
415 1  ÍvUWVS Eu EE}E]tt'YtCQhluuSSt
416 1Dh luuSStމ vu }e[^_] e[^_]UE Ut t
417 | 1  ÍvUE Ut t
418 L 1 
419 ÍvUE Ut t
420  1  ÍvUWVS Eu EE}E]t!u@hluuSSt
421 Ш14h luuSSt
422 މu }e[^_]e[^_]UE Ut t
423 h1 ÍvUE Ut t
424 81 ÍvUE Ut+
425 t /vt%1,vvE UÉUE Ut
426 t v)t1vE UÉUE Ut
427 t+vt)t1vE U(ÉUWVS EEE E}EE}ut} }tJ[v}tFP1ۉ4lWuVVuNC~hkWuVVtEP13vEEE EEe[^_]|ECe[^_]UE U}t v)t1vE U ÉUE Ut
428 tvu1E UÉUE Uttx1ÉUE Ut t
429 1 ÍvUE Ut
430 tvu1xE U8ÉUWVS EEE Eu}]t!}tzhkWC@PSStEuhlWC@PSStEMhkWs@VSStEج1*EEE EEe[^_]Te[^_]UE Ut t
431 01  ÍvUE Ut
432 t v)t1T!vE UÉUWVS Eu EE}E]tt itOa1phkuuSSt#MhkuuSSt"")G%u }e[^_]&e[^_]UWVS } G]MuU$ m1hlVJ@QRRtcЮ$jC%T<,Gv<.7v<-'v</v} ]e[^_]^e[^_]UE Ut'
433 t#'vt$u'$1E UÉUE Ut
434 t v)t1p,vE UÉUE Ut#
436 swish -V
437 fshttpindex.swish-eSWISH-E %s
438 help %20s => %s
439 INDEX_%s%s%sUnknown -S option "%s"Specify tag fields (HBtheca).dqswish-searchIndexing Data Source: "%s"
440 Indexing "%s"
441 After indexingascdesc# SWISH format: 2.2rc1# Search words: %s
442 #
443 # Number of hits: %d
444 # Search time: %0.3f seconds
445 # Run time: %0.3f seconds
446 err: no results
447 .
448 %s, no words removed.
449 Writing main index...
450 No unique words indexed!Sorting words ...
451 Writing header ...
452 Writing index entries ...
453 %d unique word%s indexed.
454 no files indexed.
455 Elapsed time: CPU time: Indexing done!
456 Show meta tags as they are foundDebug regular expression processingDisplay properties associted with each file as they are indexedDisplay words as they are parsed from sourceDisplay words as they are indexedDump data ALL above data from index file
458 -- indexing --
459 List metaname table stored in indexList file data stored in indexList stopwords stored in indexList words stored in index (more verbose)List only words and associated metaID separated by a tabList only words, one per line, stored in indexShow the headers from the index swish [-e] [-i dir file ... ] [-S system] [-c file] [-f file] [-l] [-v (num)]
460 swish -w word1 word2 ... [-f file1 file2 ...] \
461 [-P phrase_delimiter] [-p prop1 ...] [-s sortprop1 [asc|desc] ...] \
462 [-m num] [-t str] [-d delim] [-H (num)] [-x output_format]
463 swish -k (char|*) [-f file1 file2 ...]
464 swish -M index1 index2 ... outputfile
465 swish -N /path/to/compare/file
466 options: defaults are in brackets
467 -S : specify which indexing system to use.
468 Valid options are:
469 "fs" - index local files in your File System
470 "http" - index web site files using a web crawler
471 "prog" - index files supplied by an external program
472 The default value is: "%s"
473 -i : create an index from the specified files
474 -w : search for words "word1 word2 ..."
475 -t : tags to search in - specify as a string
476 "HBthec" - in Head|Body|title|header|emphasized|comments
477 -f : index file to create or file(s) to search from [%s]
478 -c : configuration file(s) to use for indexing
479 -v : indexing verbosity level (0 to 3) [-v %d]
480 -T : Trace options ('-T help' for info
481 -l : follow symbolic links when indexing
482 -b : begin results at this number
483 -m : the maximum number of results to return [defaults to all results]
484 -M : merges index files
485 -N : index only files with a modification date newer than path supplied
486 -p : include these document properties in the output "prop1 prop2 ..."
487 -s : sort by these document properties in the output "prop1 prop2 ..."
488 -d : next param is delimiter.
489 -P : next param is Phrase delimiter.
490 -V : prints the current version
491 -e : "Economic Mode": The index proccess uses less RAM.
492 -x : "Extended Output Format": Specify the output format.
493 -H : "Result Header Output": verbosity (0 to 9) [1].
494 -k : Print words starting with a given char.
495 -E : Append errors to file specified, or stderr if file not specified.
496 version: %s docs: http://swish-e.org
498 Available debugging options for swish-e:
499 '-%c' requires a positive integer.Failed to convert '-%c %s' to a number: Invalid char '%c' found in argument to '-%c %s'Missing parameter. Use -h for options.Missing switch character at '%s'. Use -h for options. '-i' requires a list of index files. '-w' requires list of search words. '-k' requires a character (or '*'). '-S' requires a valid data source. '-s' requires list of sort properties. '-p' requires list of properties.-L requires three parameters <propname> <lorange> <highrange> '-f' requires list of index files. '-c' requires one or more configuration files.-N requires a path to a local fileBad path '%s' specified with -N: -t must only include HBthec. Found '%c' '-M' requires an output file name.Invalid debugging option '%s'. Use '-T help' for help.Failed to open Error file '%s' for appending: '-P' requires a phrase delimiter.'-d' requires an output delimiter.Unknown escape sequence '\%c'. Must be one of \f \n \r \t \\'-x' requires an output format string.Unknown switch '-%c'. Use -h for options.Sorry, this program is in readonly modeSpecify directories or files to index.Invalid operation mode '%d': Update mode only supported with USE_BTREE featureRemoving very common words...
500 Failed to list any input files for mergingFailed to provide merge output fileMerge output file '%s' already exists. Won't overwrite.
501 %d words removed by IgnoreLimit:
502 %d file%s indexed. %lu total bytes. %lu total words.
503 ئ̦(DDDDDDDDDDDDDDDDDDDD?%s:Per Doc Temporal ZoneCurrent Chunk LocatorsAll Locatorsstruct ENTRYtmpdir%s: %s is not a directoryTMPDIRTMPTEMP%s: requires one valueIgnoreLimit%s: requires two valuesFailed to open: '%s': TXTHTMLXMLXML2HTML2TXT2WMLDEFAULT (HTML) - Using %s parser - (%d words)
504 (no words indexed)
505 (not opened)
507 swishdocpathswishtitleswishdescriptionswishlastmodifiedswishdocsizeswishstartpos Writing word text: ... Writing word text: %3d%% Writing word hash: ... Writing word hash: %3d%% Writing word data: ... Writing word data: %3d%%swishdefaultWhite-space found word '%s'
508 Invalid FuzzyMode '%d'Configuration setting for TmpDir '%s' will be overridden by environment setting '%s'Internal error in remove_last_file_from_listSkipping %s: last_mod date is too old
509 Failed to open filter for file '%s' (Skipped due to 'FileRules title' setting)
510 (Skipped due to Robots Excluion Rule in meta tag)
511 Adding:[%d:%s(%d)] '%s' Pos:%d Stuct:0x%0X ( Getting IgnoreLimit stopwords: ... Getting IgnoreLimit stopwords: %25s Getting IgnoreLimit stopwords: Complete
512 Sorting %d words alphabetically
513 Writing word text: Complete
514 Writing word hash: Complete
515 Writing word data: Complete
516 Buffer too short in coalesce_word_locations. Increase COALESCE_BUFFER_MAX_SIZE in config.h and rebuild.X\l||Input index '%s' has %d files and %d words
517 Processing words in index '%s': %6d words Processing words in index '%s': %6d words
518 Header %s in index %s doesn't match length in length with output headerHeader %s in index %s doesn't match output headerFuzzyIndexingMode in index %s of '%s' doesn't match '%s'ignoreTotalWordCountWhenRanking Rules doesn't match for index %sTranslateChars header doesn't match for index %smeta name %s in index %s is different type than in output indexFailed to lookup alias for %s in index %sFailed to lookup alias for %s in output indexIn index %s metaname '%s' is an alias for '%s'(%d). But another index already mapped '%s' to ID# '%d'Can't merge index %s. It doesn't contain the property %sfailed to load or create sorted properties for index %sReplaced file '%s %s' with '%s %s'
519 Getting words in index '%s': %3d words Getting words in index '%s': %6d words
520 fnumwbrbfailed to reopen '%s' :WordCharactersBeginCharactersEndCharactersIgnoreLastCharIgnoreFirstCharBumpPositionChars(default)sseseeeedxxwwttppnnmmggddbbizblbilitiivitialitiousnessfulfulnesivenessalismatorizationousouslielientlialliabliizeranceancienciationalicalicitializeicatesionantibleaeiouyaeiouwxyaeiou0000FilterDirFileFilterFileFilterMatch'%p' '%P'_NULL_%s: requires "extension" "filter" "[options]"%s requires at least three parameters: 'filterprog' 'options' 'regexp' ['regexp'...]
521 Parsing config file '%s'
522 IndexDirIncludeConfigFileNoContentsIndexFileIndexReportParserWarnLevelobeyRobotsNoIndexAbsoluteLinksMinWordLimitMaxWordLimitIndexCommentsIgnoreNumberCharsReplaceRulesIndexName%s: requires a valueIndexDescriptionIndexPointerIndexAdminUseStemmingUseSoundexTranslateCharactersExtractPathExtractPathDefaultMetaNamesMetaNameAlias%s - name '%s' not a MetaNameMetaNamesRankHTMLLinksMetaNameIndexAltTagMetaNameas-textImageLinksMetaNamePropCompressionLevelPropertyNamesPropertyNamesIgnoreCasePropertyNamesCompareCasePropertyNamesNumericPropertyNamesDatePropertyNameAliasPropertyNamesMaxLengthIgnoreWordsSwishDefaultFile:BuzzWordsBuzzWords File: requires pathUseWordsUseWords File: requires pathIndexVerboseIndexOnlyIndexContentsStoreDescriptionDefaultContentsBumpPositionCounterCharactersUndefinedMetaTagsUndefinedXMLAttributesIgnoreMetaTagsXMLClassAttributesDontBumpPositionOnStartTagsDontBumpPositionOnEndTagsTruncateDocSize%s has too many paramteryesnooff0append$prepend^removereplaceregex%s: missing %d. parameterdisableautoCouldn't open the configuration file '%s': %s: requires at least one value%s: requires one value (a set of characters)%s: requires at least two valuesIgnoreTotalWordCountWhenRanking%s: requires two values (same length) or one translation rule%s: requires at least three values: metaname expression type and a expression/strings%s: requires two values: metaname default_value%s already defined for meta '%s' as '%s'%s - name '%s' is already a MetaName%s - name '%s' must not be an alias%s - name '%s' is already a MetaName or MetaNameAlias%s: requires only two or more values, a rank (integer) and a list of property namesCan't assign a rank to metaname '%s': it is an aliasWhy are you redefining the rank of metaname '%s'?%s - name '%s' is already a PropertyName%s - name '%s' is not a STRING type of Property%s - name '%s' not a PropertyName%s - name '%s' is already a PropertyName or PropertyNameAlias%s: requires only two or more values, a length and a list of property namesCan't assign a length to property '%s': it is an aliasWhy are you redefining the max length of property '%s'?SwishDefault is obsolete. See the CHANGES file.IgnoreWords File: requires path%s: second parameter must be <fieldname> or a number%s: third parameter must be empty or a number%s: requires two or three values%s: possible values are error, ignore, index or auto%s: requires size parameter in bytesBad directive on line #%d of file %s: %s
523 Too many errors. Can not continue.'%s' requires an integer between %d and %d.'%s': Failed to convert '%s' to a number: Invalid char '%c' found in argument to '%s %s''%s' value of '%d' is not an integer between %d and %d.%s requires parameter #%d of yes|on|1 or no|off|0%s: unknown argument '%s'. Must be prepend|append|remove|replace|regex.%s: Unknown document type "%s"Couldn't open the stopword file '%s': Couldn't open the buzzword file '%s': Couldn't open the useword file '%s': notmatchednopematch %s %c~ m[%s] : %s
525 Original String: '%s'
526 Result String: '%s'
527 No MatchMatchedreplace %s =~ m[%s][%s]: %s
528 %s regex: failed to find search pattern delimiter '%c' in pattern '%s'%s regexp %s: unknown flag '%c'%s regex: failed to find replace pattern delimiter '%c' in pattern '%s'Failed to complie regular expression '%s', pattern. Error: %dNewMetaStringdouble_metaphone.cs != ((void *)0)s->str != ((void *)0)IncreaseBufferWWITZ PSWRPNKNGNACHMACHERBACHERCAESARCHIACHAEHARISHARACHEMHYMHORCHOREVON VAN SCHORCHIDARCHITORCHESVFMCWICZCIACCHUUCCESUCCEEKSCQCGCKCYCECICIECIO G Q CDGJTKDDDTEYLIKLEIINILIBELEBEPMANGERRANGERDANGEROGYRGYOGGIAGGIETIER JOSESAN ALLEILLAILLOOSASUMBMAYSLISLSUGARSHHOLZHOLMHOEKHEIMSIASIOSIANSCEDUYENOOSKOIAITIONTCHTIATTHAMOMWHOWSKYOWSKIEWSKYEWSKIFXEAUIAUZAZIZONo index file suppliedIndexedOnFileCountAttempted to SwishSeek before searchingresultSearch Zone#
529 # Index File: %s
530 # StopWords:# Search Words: %s
531 # Parsed Words: <andnot><__not__><not><precd># BuzzWords:<or><and># Removed stopword: %s
532 Unknown metaname '%s' -- swish_words failed to find.Attempted to read results before searching`xԒԒFatal Error: Failed to find insert point in replace_swlineProperty '%s' is already limitedBinary Sort issue - please report to swish-e listFailed to set range for property '%s' values '%s' and '%s'Property '%s' value '%s' must be <= '%s'Specified limit name '%s' is not a PropertyNameCannot limit by swish result property '%s'<=>=EnableAltSearchSyntaxSwishSearchOperatorsSwishSearchDefaultRule%s: requires "%s" or "%s"%s: requires 1 parameter %s %s %s %s %s (%s)%s: requires 3 parameters (and-, or-, not-word)ResultExtFormatName%s: requires "name" "fmtstr"%%r%s%%p%s%%t%s%%l%r %p "%t" %lswishreccountswishdbfileswishrank<%s>fmt=(NULL)%lu%Y-%m-%d %H:%M:%S %Z%ferr:(unknown datatype <%s>)
533 # Swish-e format: 2.2rc1MERGED INDEX# %s
534 (no name)# Name:%s %s
535 # Saved as:# Counts:%s %d words, %d files
536 # Indexed on:(no description)# Description:(no pointer)# Pointer:(no maintainer)# Maintained by:Enabled# DocumentProperties:# Stemming Applied:%s %d
537 # Soundex Applied:# Fuzzy Indexing Mode:# WordCharacters:# MinWordLimit:# MaxWordLimit:# BeginCharacters:# EndCharacters:# IgnoreFirstChar:# IgnoreLastChar:Formatstring: unknown abbrev '%%%c'# IgnoreTotalWordCountWhenRanking:,@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @$ X@$@Y@Internal error in compress_location routineCannot write location to swap filelocCould not open temp file %s: Severe index error in header4`td4H@Xhxfailed to add new meta entry '%s:%d'native.temp.propFailed to close file '%s': RAM Disk: write wordsWriteWordHashFile "%s" has an unknown format.Index file '%s' and property file '%s' are not related.Couldn't create the index file "%s": Couldn't create the property file "%s": Could not open the index file '%s': Couldn't open the property file "%s": Called close on non-opened file '%s'Failed to rename '%s' to '%s' : Internal DB_native error - DB->num_words != DB->wordhash_counter: Internal DB_native error - DB->num_words != DB->worddata_counter: Internal db_native.c error in DB_WriteWordData_Native: Internal db_native.c error in DB_WriteWordHash_Native: Property database file not opened
538 O/S failed to tell me where I am - file number %d metaID %d : Failed to write file number %d metaID %d to property file. Tried to write %d, wrote %Zu : Failed to seek to property index located at %ld for file number %d : Failed to call DB_ReadProperty_Native with seek positionsFailed to seek to properties located at %ld for file number %d : Failed to read properties located at %ld for file number %d : rb+XXXXXXswtmpCouldn't write the file "%s": Substituted possible embedded null character(s) in file '%s'
539 Couldn't open temporary file '%s': Couldn't create temporary file '%s' file descriptor: Couldn't unlink temporary file '%s' :err:
540 Warning: Invalid swish handleIndex file errorIndex file(s) is emptyUnknown index file formatCould not open index fileNo more resultsWord not foundUnknown metanameInvalid property typeNo search words specifiedInvalid error number '%d'%s: %sDoubleMetaphoneStemNoneUnknown FuzzyIndexingModeFailed to setup limit by propertySyntax error in query (missing end quote or unbalanced parenthesis?)Search word exceeded maxwordlimit settingSingle wildcard not allowed as wordUnknown property name to sort byUnknown property name in display propertiesAll search words too common to be usefulSwish aborted with non-negative lasterrorInvalid FuzzyIndexingMode '%s' in configuation file0123456789abcdefghijklmnopqrstuvwxyzRan out of memory (could not allocate %lu more bytes)!Ran out of memory (could not reallocate %lu more bytes)! !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvqxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !cloy|"c " -r 23'u . 1 " ?aaaaaaeceeeeiiiidnooooo ouuuuy saaaaaaeceeeeiiiidnooooo ouuuuy yParsed word '%s' exceeded max length of %daeiouAEIOU:ascii7:%Y-%m-%d %H:%M:%S%.013luswishfilenumInvalid property name '%s'(null)Property '%s' is not numeric "&quot;%cProperty Compression Error %20s:%2d (%3d) %c: propEntry=NULL
541 (No Properties)
542 Invalid property type for property '%s'
543 EncodeProperty - Attempted to convert '%s' to a numberEncodeProperty - Invalid char '%c' found in string '%s'EncodeProperty called but doesn't know the property type :(Failed to add property '%s' in file '%s'Warning: Attempt to add duplicate property.Asked for too small of a buffer size!Failed to uncompress Property
544 Mapped propID %d to invalid property indexUnknown Display property name "%s"internal error - called addMetaEntry without a nameCalled init_property_list with non-null header->propIDX_to_metaIDresultSort ZonePreSortedIndexResultSortOrderSorting property: %-40.40s %s: parameter is not a property%s: parameter 1 must be one char length%s: parameter 2 must be one char length%s: parameter 1 must be = or >%s: requires 3 parameters (Eg: [=|>] a )Rank is not defined as an auto propertyUnknown Sort property name "%s" in one of the index filesFailed to lookup propIDX %d (metaID %d)No properties sorted. %-40s
545 One property sorted. %-40s
546 %d properties sorted. %-40s
547 Hey, there are only %d files
548 ReadAllDocProperties:
549 **Compressed** %20s: %d -> %d (%4.2f%%)
551 Number of File Entries: %d
553 %s
554 Meta:%d Failed to lookup meta entry Freq:%d Pos/Struct: [%d %d %d (,%d/%x %d/%x %d%20s : id=%2d type=%2d META_INDEX Rank Bias=%3d META_INTERNAL META_PROP:compareSTRING(case:%s)DATENUMBERunknown! *presorted* [Alias for %s (%d)]
556 -----> FILES in index %s <-----
557 Dumping File Properties for File Number: %d
558 ReadSingleDocPropertiesFromDisk:
560 -----> WORD INFO in index %s <-----
563 -----> STOP WORDS in %s <-----
566 -----> METANAMES for %s <-----
567 B.A# TranslateCharacterTable:%s %s -> %s
568 FileRulesFileMatchFollowSymLinksiscontainspathnamefilenamedirname%lx/%lxAlready indexed.Skipping %s: %s
569 Failed to open dir '%s' : %s
570 In dir "%s":
572 Checking dir "%s"...
574 Checking file "%s"...
575 Invalid path '%s': File-Systemerr: Wrong number of parameters in %s
576 err: %s must be followed by [is|contains|regex]
577 err: '%s' - invalid parameter '%s'
578 ./maxdepthMaxDepth requires one valuedelayDelay requires one valuespiderdirectoryequivalentserverWrong method or server.Too deep.Wrong suffix.Skipping %s: %s
579 URL disallowed by robots.txt.://Failed to fork '%s'. Error: %sswishspiderFailed to open file '%s': %s/swishspider@%ldretrieving %s (%d)...
580 text/htmltext/%s/swishspider@%ld.response%s/swishspider@%ld.contents%s/swishspider@%ld.linksHTTP-CrawlerSpiderDirectory. %s is not a directorySpiderDirectory requires one valueEquivalentServers requires at least one value%s exited with non-zero status (%d)Skipping %s: Wrong content type: %s.
581 URL '%s' returned redirect code %d without a Location.
582 %srobots.txtSwishProgParametersstdinExternal program '%s': Cannot execute '%s': fltrProcessing %s...
583 Content-LengthLast-MtimeNo-Contents:Path-NameDocument-TypeprogExternal-ProgramExternal program '%s' is a directory.Failed to spawn external program '%s': Failed to write temporary filter file '%s': External program failed to return required headers Path-Name: & Content-Length:Error removing temporary file '%s': Failed to parse Content-Length header '%s'Failed to parse Last-Mtime header '%s'Failed to parse Path-Name header '%s'Failed to find path name in Path-Name header '%s'Failed to parse Document-Type '%s'Failed to documnet type in Document-Type header '%s'documnet type '%s' not a valid Swish-e document type in Document-Type header '%s'Unknown header line: '%s' from program %sFailed to properly close external program: NAME/head/title/body/em/strong/b/i</title><bodySTARTENDCONTENT</%s>Adding automatic MetaName '%s' found in file '%s'
584 UndefinedMetaNames=error. Found meta name '%s' in file '%s', not listed as a MetaNames in configproperty '%s' not added for document '%s'
585 Failed to create XML parser object for '%s'XML parse error in file '%s' line %d. Error: %sWarning: Tag found in %s is too long: '%s'!!!Adding automatic MetaName '%s' found in file '%s'
586 xml=http://www.w3.org/XML/1998/namespacep̲X<dDp,hxp$ tPPd,44444444D  HH44444444t4444l`P$4dllHuudxpdocument is not standaloneunclosed CDATA sectionunknown encodingreference to binary entityasynchronous entityrecursive entity referenceundefined entityjunk after document elementduplicate attributemismatched tagunclosed tokennot well-formedno element foundsyntax errorout of memoryerror in processing external entity referenceencoding specified in XML declaration is incorrectxml processing instruction not at start of external entityreference to external entity in attributereference to invalid character numberillegal parameter entity referencediamsheartsclubsspadeslozranglangrfloorlfloorrceillceilsdotperpotimesoplussupesubensubsupequivasympcongsimthere4intcupcapinfinradiclowastminussumprodninotinisinnablaexistpartforallhArrdArrrArruArrlArrcrarrharrdarruarrlarralefsymtraderealweierpimageeurofraslolinersaquolsaquoPrimeprimepermilhellipbullDaggerdaggerbdquordquoldquosbquorsquolsquomdashndashrlmlrmzwjzwnjthinspemspensppivupsihthetasymomegapsichiphiupsilontausigmasigmafrhopiomicronxinumulambdakappaiotathetazetaepsilondeltagammabetaalphaOmegaPsiChiPhiUpsilonTauSigmaRhoPiOmicronXiNuMuLambdaKappaIotaThetaEtaZetaEpsilonDeltaGammaBetaAlphafnofYumlscaronScaronoeligOEligyumlthornyacuteuumlucircuacuteugraveoslashdivideoumlotildeocircoacuteograventildeethiumlicirciacuteigraveeumlecirceacuteegraveccedilaeligaringaumlatildeacircaacuteagraveszligTHORNYacuteUumlUcircUacuteUgraveOslashOumlOtildeOcircOacuteOgraveNtildeETHIumlIcircIacuteIgraveEumlEcircEacuteEgraveCcedilAEligAringAumlAtildeAcircAacuteAgraveiquestfrac34frac12frac14raquoordmsup1middotparamicrosup3sup2plusmndegmacrregshylaquoordfcopysectbrvbaryencurrenpoundcentiexclnbspgtaposampquotConvertHTMLEntitiesmetahrefimgsrcbasebrcontentROBOTSNOINDEXSwishCommandnoindexalt *Start Ignore*no meta name definedproperty<%s> (%s [%s]%s)
587 end ignore</%s> (%s)%s
588 <%s%s> %s
589 Warning: Tag found in %s is too long: '%s'
590 Failed to convert internal UTF-8 to Latin-1.
591 Replacing non ISO-8859-1 char with char '%c'
592 Error '%d' converting internal UTF-8 to Latin-1.
593 **Adding automatic MetaName '%s' found in file '%s'
594 Found meta name '%s' in file '%s', not listed as a MetaNames in config(undefined meta name - no action)ClassAttribute on tag '%s' too long
595 Attribute '%s' on tag '%s' too long to build metaname
596 swish parser adding more stack space for tag %s. from %d to %dTried to append tag %s to stack, but stack is empty1@T?|/`#m^##=ǿ@ ?%l ?PP1b,@ɀ?????_@L?`?T{?|=?ӟ9mӇ9^;9=ǿ==`=`@=%l;_??>fw
597  !"#$%&'Hh||||||||||||||||||||(P|||||||X|||||||||$$LLL$LLLLLL0CDATA[ `<\8< < < < < < < < < < < < < < < < < < < < < , < < < < < < < < < < < < p!!!"""""""""""!""<""<""""""D"d""""""""""""""""<""<"<"<"<""" #L#l#&##&&&#&&&&&&##&####&#$$ %$%<$p$$$%%\&t%t%t%t%t%l&t%t%t%%%%(&&%%\&&&&&&l&&&&%%&%&&&&& '8'd')))))))''())))\()\())))(d((())))))))))))))\()\(\(\(\())),)P))))))))))))))))))))))(P+P+$*D****+P+d**,,,,+t+++,,,p,,,-,,----------,(--(------,0-P-p---------------(--(-(-(-(---..0...............l..l......p.................l..l.l.l.l........../////4/X/x/////////////////////////////l04122<3400\2<0T044444l2x1034333344H11144h1L20004444444004444404044440@2@2@2444 244444@24444444444@2202@2@233 44D4D4D4444p44444D4D434333344D44D4\4H4D4D4@585x5 5(505x5P5H5x5x5x5x5x5x5x5x5x5x5p5 6X6666X68606X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6(666666666666666666666666666686 707T76|8|88776668666(8|76|76666|78888888888999999999999999999999999999999999999999999999@:6:,:`:`:`:`:`:`:`:`:`:`:`:`:`:`:T:`:T:T:T:T:`:T:::::::::::::::::::::::::::::;;;;;;;;;;;;;;;;;;;;;;l;t;|;;;;/)45:::;68\9<;l6; <
598    !"# $XP<PP/)45:::;68\9<;l6; <
599    !"# $XP<PP/)45:::;68\9<;l6H==
600    !"# $/)45:::;68\9<;l6>=
601    !"# $\>\>\>\>d>d>d>d>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>l>CCCCClCxCCCCCCCCCCCCCCCCCCCCCC!E!E0E0E0E0E0E0E0E0E0E0E!E<E0E<E0E0E0E0E0EDdFxFF"H"H"H"H"H"H"H"H"H"H"H"H"H"H(H"H(H"H"H"H"HTFGG$G"H4G4G"H"H"H"HG"H"H"H"H"H4G(H"H(H(H(H(H"HF"H"HGGGGGG"HGGGGGGGCDATA[IILJLJIIIIITIISJSJLJLJSJ J,J<JSJSJSJJJJKKKKKKKKKKKKKKKKKKKKKJpK|KKKKKKKKKKKKKKKKKKKKKKK<KMNNNNNNNNNNNNN NNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNxO ROtROOtRtRtRPtRtRtRtRtRtRORtRRRRRtRdOhRhRtRPPtPPPhRQQ$RtRtRtRtRtR4RtRtRtRQxO ROhRQQ$RhRhRhRhRhR4RhRhRhRQRhRRhRhRhRhRQS$S,S[U[U[U[U[U[U[US4SS[U[U[U[UdU[UdU[U[U[U[URTTT[U(U(U4U[U[U[U[U[U@U[U[U[U(UdU[UdUdUdUdU[UPTTTT[U(U(U4U[U[U[U[U[U@U[U[U[U(UU[UU[U[U[U[UTWWUVVVVWW8VVWWWWW`WlW|WWWWHX\XdX YlXlX Y Y Y Y Y Y Y Y Y YlX(Y Y(Y Y Y Y Y4XlXXXY Y Y Y Y Y Y Y Y Y YY Y Y Y(Y Y(Y(Y(Y(Y YXYYYxZxZxZxZxZxZxZxZxZxZxZxZxZxZZxZZxZxZxZxZYDZLZ\ZxZlZlZlZxZxZxZxZxZxZxZxZxZlZZxZZZZZxZZlZxZlZxZxZxZlZ [ [[[[ZZ[ [[[[,[,[x[x[x[%[%[%[%[%[%[%[%[x[x[%[%[%[%[%[%[%[%[x[@\P`]^^^P`\;]^\(\P`P`P`P`P`^];]^P`^^^^P`^P]]]P`P`p]|^\\\P`P`P`P`P`P`P`\\P`P`P`P`P`\P`\P`P`P`P`\p^p^p^P`P`P`P^P`P`P`P`P`p^P`P`P`P`P`P`P`P`P`P`p^@^`^p^p^__`P````P`P`P`<`P`P`P`P```X`P`X`X`X`X`P`_`P``(````$aaaaaaa8a,aaaaaaaaaaaa\bbbLbTbb|btbbbbbbbbbbbbbbbbbbbbhbcc`c`cccccccc`c<cLc`cccLcc`c`cccccccecDdcdceeepddcccecccdDdcDdccccDdffffffffff7f7f7f7f7f7f7f$f$f$f$f$f$f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f0f0f0f0f0f0f@h6h,hlhlhlhlhlhlhlhlhlhlhlhlhlhlhThlhThThThThlhThhhhhhhhhhhhhhhhhhhhhhhhhhLi<iDiTiTiTiTiTiTiTiTiTiTiTiTiTiTiLiTiLiLiLiLiTiLihjj jhj jj[|UHt`aghh`icefib>D@
602    !"# $[|UHt`aghh`icefib>D@
603    !"# $0k0ktktktkkk k0ktktktktktktktktktktktktktktktktktktk<klllllllllllllllllllllplmnnooooooooooooooooooooomnnnonnoooooooooonooooooohnoo|o|o|o o0oDoo|o|o|o|o|o|oXoCDATA[|q|qqqpLq\qlq|qp<qqqqqqqqqqqqhr|rrsssssssssssssssssssssXrss$ssususssssssssssussssssssruuuvvvvvvvvvvvuvvvvvvvvvuLvTvdvvvvvvvvvvvtvvvvvvvvvvvvwy$w zSwSw z z zw z z z z z zSwy zyyyy zvzz zDxtx xx(xzyyy z z z z zy z z zywy$wzyyyzzzzzyzzzyyzyzzzzpyzzz|||||||P{zp{|||||||||||z|,|<||||||||||||||||||||||{|,|<|||||||||||||||||||||||~~}}0~t~~~~} ~____$~___TDX`4܁ĂĂ؃(Thptӄ$4ӄxx|dddD$ddd؅ԇP,,,ЈĈ,,,,,,,,,, ddd dddddddddddddddddddԊ6S܋SP<SSSPSSS܋S܋SSSS܋ύύύύύύύύύύύύύύύύύύύύύύύύύύύύύύύύύȍȍȍȍȍȍ؏Ώď888<<<<<<<<<<<<<<8<8888<8Ԑܐ0}$p H|L4d0H@pB
604    !"# $0}$p H|L4d0H@pB
606  ` ȱle+f%g++h²ij² k/² lkmn|o pr q"r1st u!v{!`wxyz²){  stnxid_|ZUxOK)EA9|;4.x&(A x(-B.&²/x0B1{B4²5)²x²d²x²_²B²²²²²²²²0²²²A²(²|²)²)² \!p`qssvv@yy123122245512623122vz*'6>EL:QUY]a1dgiNlnpsuvx{z%|}E*܄$a ғe8ИXқ>G7סu?Ӥe!+/,#sVƯ5yKG l̵*AQY[VK:ֽ#pR0yP"g4w?C@~7s(cM1jH!W+_-`)[O>m'U 8dAmDn@i 6^&Mu7]@fCh@c6X{&Hi1Rs6Vv4Sr ,Ji;Yv &C`} )Ea} $@\w5Pk
607 $>Xr 'AZt $=Un2Jc{
608 ":Qi #:Qh5Kbx)?Uk-BWm*?Sh} !5I^r&9Mat$7J^q .ATgy 2DWi{ /ASew&8IZl}(9J[l}$4EUfv )9IYjz(8GWgv 0?N^m|"1@O]l{+:HWet .<JXgu*8FTao} -;HVcq~*7ER_ly!.;GTanz+7DP\iu !-:FR^jv*6AMYeq|  +7BNYep|   & 2 = H S _ j u             
611 &
612 1
613 <
614 G
615 R
616 ]
617 h
618 s
619 ~
631     + 5 @ K U ` k u                 ( 3 = H R ] g q |                 * 4 > I S ] g q {           Nf!G#F%'((*+,- /0 1123p41556F778 99B::Q;;Q<<B=='>>?h??3@@@QAAB^BBC[CCCJDDD-EvEEFIFFFGUGGGHQHHHI?IxIII JWJJJJ+K^KKKK&LVLLLLMAMoMMMM NKNvNNNNOFOnOOOO P3PYPPPPPQ8Q\QQQQQ R.RPRrRRRRRS7SWSwSSSSST1TPTnTTTTTUU:UWUsUUUUUUV4VOVjVVVVVVW W:WSWlWWWWWWXX1XIXaXxXXXXXXYY1YHY^YtYYYYYYYZ#Z8ZNZcZxZZZZZZZ[[1[E[Y[l[[[[[[[[\\.\A\T\g\z\\\\\\\\ ]]0]B]T]e]w]]]]]]]]^^#^4^E^V^f^w^^^^^^^^^
632 __*_:_I_Y_i_x_________``!`0`?`N`]`k`z`````````` aa'a6aDaRa`ana{aaaaaaaaaabbb,b9bGbTbabnb{bbbbbbbbbbb cc"c/c;cHcTcacmcycccccccccccc dd#d/d:dFdRd^diduddddddddddddd
633 ee e+e7eBeMeXeceneyeeeeeeeeeeeeefff%f0f:fDfOfYfdfnfxffffffffffffffggg%g/g9gCgLgVg`gjgtg}ggggggggggggggh hh h)h3h<hEhNhXhahjhsh}hhhhhhhhhhhhhhhi iii(i0i9iBiKiTi\ieiniviiiiiiiiiiiiiiiiijjj j)j1j9jBjJjRjZjcjkjsj{jjjjjjjjjjjjjjjjjk kkk#k+k3k;kCkJkRkZkbkikqkykkkkkkkkkkkkkkkkkkl llll&l.l5l=lDlKlSlZlalhlplwl~lllllllllllllllllllm mmm"m)m0m7m>mEmLmSmYm`mgmnmum|mmmmmmmmmmmmmmmmmmmmn nnnn#n*n1n7n>nDnKnQnXn^nenknrnxnnnnnnnnnnnnnnnnnnnnnno
634 oooo#o)o/o6o<oBoHoNoToZoaogomosoyooooooooooooooooooooooop pppp p&p,p2p7p=pCpIpOpTpZp`pfpkpqpwp}ppppppppppppppppppppppppq
635 qqqq q%q+q0q6q;qAqFqLqQqWq\qaqgqlqrqwq}qqqqqqqqqqqqqqqqqqqqqqqqqrr rrrr!r&r+r0r6r;r@rErJrOrUrZr_rdrirnrsrxr}rrrrrrrrrrrrrrrrrrrrrrrrrrss
636 sssss"s's,s1s6s;s@sEsIsNsSsXs]sbsfskspsuszs~sssssssssssssssssssssssssssstt ttttt#t(t-t1t6t:t?tCtHtMtQtVtZt_tcthtmtqtvtzttttttttttttttttttttttttttttttuu u uuuuu#u'u,u0u @²` 
637   @ nT=, (***&3@Fn
638 \AOUaousaAeEiIoOuUnNaAaAcCeEeEiIiIoOuU]tkT_4uluser-agent:disallow:swishspiderp
639 ` }bN 3"`  %"%&%'<%>%%%%%%%~%$y%t%n%&j%f%a%]%V%Q%L%%F%A%:%$5%0%*%#%%%%%%$$$$$$$$$$$$$$$$$$$$~$ w$p$i$c$^$W$Q$K$D$=$7$0$+$%$$$$
640 $$#####################|#Rv#So#`h#ac#x^#$$X#S#M#G#?#:#6#0#+#%##### #
641 ###""""""""""""2#""""""""""""}"u"q"m"i"c"Z"T"P"K" F" ?" :" 6" 2" ." (" "" " " "
642 " " ! ! !! !" !& !0 !2 !3 !9 !: !> !D ! !!!!!!!"!!5!!!!!y!!!!~!!x!!s!!n!!i!!d!!_!!X!"S!"M!"N"G!"B!"<! "9! "4!"0!"*!"#!"!"3"!"  "
643 &'"j("!)"!*" !+"!4"!<" E" H"`" a"d"!e" " " " " " " " " " #  # 
644 #  # )# *# % `& c& e& f&/k:kCkIkPkYkB@D? h hU?kkkkkkkk$-L  (8h
645 4 ؐ@oHool&6FVfvƔ֔&6FVfvƕ֕&6FVfvƖ֖&6FVfvƗ֗&6FVfvƘ֘&6FVfvdędę:<Is1-W2W cV&[Nd{ !
646 "#5%M&c1z234568 9$;D=Z>p?@ABCDEF&G=HVIkNQR S T;UWVoX[^ehl q r7 uR vo y z } 
647 (
648 B
649 ˔v
650 F
652  #X [ 4w < C F S Z ^ltOyp6
653 Nd8ybKN#5NyH:KiLUZ^Aayb^t5 7#8;9U:o dędd:<Is1-W2W0F^w=F%[F? W!o"#%&1234/5H6b8{9;=>?@A1BKCbD{EFGHINaQzRSTUVX[:^Sejhlqruv y0 zO }i !F-!c!!#!"4#<`#C#F#SN$Z$^$$-$7$%cV%
654 )%b>%X%K%"&#j&5F)%>%&^''H'K'L(UR(Z(^(a(b6))+,,!-5-7-8-9-:-<8.+V.p..2/2A2XB2aj2i2l2P223F343P3Ff3%3F32F3F33334?4`444F% 5""5#95$N5%d5&z5'5(5-515=5B6G6L56QL6Wc6cz6h6m6s6t6z6%7F%7R%77^O7d7z7777778858N8P3h8(F%88G889&669s9%991979JI:Q`:}::::F%:sv;<F<T;
655 ==@3F%P3@_AFtAAA6VFs9%%A;ABCC(C#F%>C!YCCSD%wDD+D,D3DE<EKGdG|GG@3oF%Hb`Hj4HQIIFI6#J-F9J TJ$8JJ+!KX=KKKKOL(lLMEMKHNSNrbPP}QR3RRRS%Zg\D\\N]:^dR^^r^6___R``DaabbBceccc`ddd]eellmm'mFnn=nnnnppGnpFr>Nrrr,Ns5y<y7Cyz# zzzzzKza{{e |d}r}~}X}} }@<Eׄ;BNB&Dp΅*cByS$_k DD DDDDD)D.D1D3D;DLDVDXDbDdDnDpDzD|DDDDDDDDy@@@$$dŇDD D+D5D<D>DMDgDpDqDsD҇@܇@@$$DDDDD)D5DADMDYDe2]DCqDDslDDDDDDDDDDDDDDD D DD D,D8DIDUDcDoD{DDDDDDDDDD D!D" D#D$#D%/D&@D'L@L$L $*8D*D+D,$!5$7\H6V6 D7D; D=$D>(D@8DA<DB@DC\DEtDFDHD@DKDLDNDOe@8$n$bDbDcDfDg'Di.Dc1Dj4c$9$XV~DDDDD"D.D5DA@~$Mň$kDDDy@$߈$DD
659 D
660 D
661 D!
662 D+
663 D0
664 D5
665 DJ
666 DZ
667 DZ
668 Df
669 Du
670 Dx
671 D{
672 D
673 D
674 D
675 D
676 D
677 D
678 D
679 D
680 D
681 D
682 D
683 D
684 D
685 @ȉ@Ӊ@9m@ @-t@C@g/k|7@k@lx
686 P@Z
687 u
689 $
691 D D D DD@@@ϋދ@;$$ /DU b$DD!D +D"6D&AD(JD+RD-\D/`D7`D8mD;wD=D>D=D@DADCDFDHDIDKDNDTDUDWD[+D\5D]ED_SDasDcDdDgDjDkDqDrDsDvDw D|D~DDLD\DiDDDDDDD@s@@@@/`$ddƌd:<Is1-W2W=F^w%[F !F$%cV%
692 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnnm'mFpGnzK~}Xd}Ԍ$544 D5D: D;D=&D?:DAHDB]DDfDFlDGDHDGDHDGDDDKDLDMDLDMDLDOD?(DS; 6!@71@8C$CdϵdеBdе:<Is1-W2W=F^w%[F !F$%cV%
693 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8L dеdе~dе:<Is1-W2W=F^w%[F !F$%cV%
695 BDHD
699 DVDXDVDX"D[-D\9DY<D\CD^ID_SD`VDa\DbhDakDbmDcz7)y @
701 DJ DSDTDODM$DP'DQ<DW<D[@D]LD[OD`XDb\@@7@B@Ce@D\$`$gXff ff£f֣ff DgDk DgDkDlDk6Dl7Dk<DnDDoF@f@fe@hN$N$v4"u.u ;uDvDz D{(D}BD~DD`DgDoDDDDDDDDDDK@ue@w$W$" .;DD DDDDDDMD_DdDlDtDv@D{~D{DDDDDDDDDDDDDDDDDD0D2@e@@n@@62$:$DDD DDDD.D=DDDTD`DmD{DDDDDD@@*@e@$ʤ$  ݤ   £ ֣  D D D D D D "D (D +D .D 7D :D CD ED ND PD eD lD# tD' zD) D* D- D0 D2 D4 D5 D8 D= D@ DA DB DF DH 1DJ LDI ODJ RDS XD[ lDU oD[ uD_ Da Dd Da Dd De Dg Dh De Df Dk Dm Dq Dt Dy D~ )D DD ED HD VD VD XD cD cD hD hD wD D D D D D D D D D D D D !D $D /D 8D <D JD MD oD D D D D D @   
702 !  0 < J [ n@a y h$$$   å  D D D D D D !D ,D 0D @D BD DD HD KD ND QD TD YD aD aD eD mD pD tD xD z@ ץ@ @ @ @  z$$ T s D D
703 D
704 D
705 D
706 $D
707 4D
708 :D
709 ?D
710 ND
711 XD
712 ^D
713 `D
714 bD
715 gD
716 qD!
717 D%
718 D!
719 D"
720 D%
721 D"
722 D%
723 D(
724 D%
725 D(
726 D+
727 D/
728 D1
729 D/
730 D1
731 D2
732 (D1
733 <D5
734 LD7
735 iD9
736 D:
737 D?
738 D=
739 D?
740 D=
741 D>
742 D?
743 D@
744 DA
745 D<
746 DA
747 DB
748 DC
749 DD
750 DE
751 DG
752 DI
753 4DJ
754 8DM
755 NDO
756 \DM
757 dDO
758 fDP
759 pDO
760 DS
761 DU
762 DW
763 D]
764 D[
765 D]
766 D[
767 D\
768 D]
769 D^
770 D_
771 Da
772 D_
773 "Da
774 (DZ
775 0D`
776 2Da
777 4Dc
778 HDd
779 PDf
780 hDh
781 nDk
782 Do
783 Dm
784 Do
785 Dq
786 Dr
787 Dv
788 Dt
789 D
790 Dx
791 D|
792 D~
793 D|
794 !D~
795 #D
796 ,D~
797 @D
798 PD
799 mD
800 D
801 D
802 D
803 D
804 D
805 D
806 D
807 D
808 D
809 ; 7 K@   ]@  m e@
810 7@
811 @
817 @
818 u
819 (
820 @@
821 @
822 ӡ
823 $d7d8d8:<Is1-W2WF^w=F%[F !F$%cV%
824 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnz#npGnFr>h5yzpz~}X;{ezKz$=8/<I< D=DA DIDL"D\,D]2D_8DaQDc\DelDh{DjDlDmDtDuDDDDDDDD%D.DID_DeDlDyDDDDDDDDDDDDD D D;DLDiDlDrDyDDDDDDDDDDDDDD D*D@DFD\D^DcDpDDDDDDDDDD
828 pD uD
829 xD DDDDDDDDDDDDD D!D)D*D.D0D1 D3D1D3D5.D69D7QD9VD:lD;l@8F@S@e@]@i~@0@1lt$t$E$DD DEDF DEDFDM%DI.DM1DPCDQKDIXDSZD^dD_lDWuDUDWD[D\DcDdm@DFǬGHҬ@I$$k0jj IjDkDm DrDuDv0Dx<D|PD{aD|hD~mDxDDDDDDxDDD @j7@lݧmn;op$M$$x Idy $DD DDDD(DB @@@@@ŭ@B$Gխ(@ dkdldl:<Is1-W2W=F^w%[F !F$%cV%
830 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8@3- m'mFg&p&`q &q5&s^&s&v&v֯&@y&y(&yV$%lX$D%D-D) D* D- D/D20D3@D2BD3GD5LD6jD7oD8pD:tD=D>D@DB@$f@&t@'$$X XWDXD[D\D^/43;D/D/;D^/DaL@W$Q$t`XsDtDw Dx$D(D@s@u$$XDDDD D.D2D4@$7Ű$ XDDDD D.D2D4@$7ְ$XX DD DDD"D,D6DIDKDNDQDTDdDzDDDDDDD@@@$*$
831  6 ;  D
832 D 43QD1QD1D!DD"XD!bD*hD,pD.D/D1D*D8D;D8D;D<D#D2D@DBDDDEDF435D5DHDI&DJ(@ E @ g@e@($0dPdPzdP:<Is1-W2W=F^w%[F !F$%cV%
833 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 833@$0PX0D1D6 D1DYD`+DgLDhNDiTDiTDjcDkjDlmDhnDqsDtwDvDtDvD{DyD~DyD~DDDDDD~DDD@0@3@3e@47@4@46ɱ&8y$$@DDDD$
834 dJdLdL:<Is1-W2W3F^w343P3Ff3%[F !F3F=F%$%cV%
835 )%b>%j&5F)%>%-<22332F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 85ym'mFnnn9 $3L#2D3D6
836 D:!D<$@28@4)$)E$FxEDFDG DLDMDQ!DS(DX,DY7DZBD[LD\XD]_D_kDakD_nD`pDarDbxDdDeDhDiDk@E8@G_@Sk@T($x$wvv DwDy DwDxDyD{DyD{ D|,D}4D~CDKD^DiDlDwD|DDDDDDDD
837 D
840 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFp5yzhn:E9zKFr.pem{/(zz#z{Ee~}XJTh+}Ҷ*A4X< Fn%޷\ DZ?@+WFYm$VUU UUUDVDf D\D]Dd(Df<Dg`DisDj|DnDsDnDqDsDwDuDwDxD{D~D(D3D<DQDTDaDsD}DDDDDDDDDDDD D D#D(D1D8DMDZD_DiDvDDDDDDDDDDDDDD-D2DPDYD`DuDDDDDDDDDD DD)D.DJDPDYD`DuD D DDDDDDD DDD1D!6D"[D#cD$D&D(D,D.D0D1D2D3D5D6D9 D;!D=&D>KD?SD@oDBtDD}DHDJDLDMDNDRDUDWDYDZ3D[;D_WDc\DeqDfvDhDjDnDpDrDsDtDuDwDx D|D~%D(D:D_DgDlDuD|DDDDDDDDDD D D= DE DL DU D\ Dq D D D D D D D D
841 D
842 D6
843 DS
844 DX
845 Dm
846 D
847 D
848 D
849 D
850 D
851 D
852 D
853 D D D D& DJ De Dq D| D D D D D D D D D D D0 D5 D8 DQ DT D
854 s D  D  D D
857 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnnnY$<|2t;; ;;D<DF DMDH DJ'DM.DOCDPJDTMDVTDXjD[pD\uD`xD^{D`~D\D`DaDgDcDgDiDjDkDlDnDgDqDsDt
858 Du Dv@;=0>@?@@AB"$"$3t. ?DDD$D'D.D5D7D9D:D;DJD\D_DbDkDnDDDDDDDDDDDDDDD DDD1R^n@@@@ @1$1$4 DD DD`DiDDDDD@ @$/$5 JDD DDDD(D,D6D@DBDDDFDWD[D_Day@@Z@$ej$5 JDD  D D D
861 @@@@@@@@$d2:d4:d4::<Is1-W2W=F^w%[F !F$%cV%
862 )%b>%j&5F)%>%-<22@3F%P3Ff33oF4F%6%%%P3h8(F%88G6s9%`:IF3F343P3%3-9'nF!m'mF>$;4:\:D;D= D?D;D=D?D@DB<DC@DDCDFTDHWDDZDF]DH`DIfDHkDImDKDLDODNDOm@:~@<=$$T:SDTDUDX DYD[%D\1~@S$9$a;`` DaDb DcDb#Dc%Dd@DeI~@`@`$P$jl;iDjDmDo Do DmDq$~@i$@k&$&.$v;u=u DvDyDvDy D|D}D/D8D:~@u@u@w:$<H$;DDD D DD-DCDJDg~@$l]$<<DDD ~@$ n$H<= DDDD DDD~@@$ {$h<= FDDDDDD~@@$$<y DD DDDDD$D(D,D8DJDODQ~@@@@@Q$Y$< DD DDDD$D1D;D>DIDL~@@
865 D
866 D
867 D'
868 D*
869 D-
870 D 4
871 D X
872 Dh
873 Do
874 Dt
875 D
876 D
877 D
878 D
879 D
880 D
881 D
882 D 
883 D#
884 D%
885 D'
887 DDDDDDDDDD D D# V@bo|@# $# dW]dX]dX]:<Is1-W2W=F^w%[F !F$%cV%
888 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFnppGnFr>5y<y7z#zh:9zK{/z{e~}X@<JzBzTh+4X< Fn%D 7$@X]D@DDDFDI0DJ8DK@DLHDMPDNXDO`DPhDQpDRxDSDTDUDWDXDYDZD[D\D]D^D_D`DaDbDcDdDeDfDg#Dh-Di7DjADmKDpRDt\DudDvf@A$k $}^|D}D
890  D DD D D /D7D?DDDJDL@՞@+@@L$T<$f  FDDDDDDD/D>DDD I@՞@O@I$QO s dgdgdg:<Is1-W2W=F^w%[F !F$%cV%
891 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnpGnFr>5ypz#hznz{ezK{/~}XB$gDDDD DDDD$D*D1D8D?DFDPDZDn@@u$u$gDD DDDD!D,D/D1D8DADFDIDKDYDcDpD{DDDDDDDDDDDD@@@e@?@$$phDDD DD"D)@@0$0 $5h33 D5D:D5D;$'$Ah4@G@ DADB DC R@@]@@$h$Hh}GGG DHDI DJR@G]@G$$Ph}OGO DPDQ DRR@O]@O$$Yh}XGX DYD^ D_ DeDgR@X]@X@Z$$sirr rDsDx DsDxDzD{#Dz'D{)D|0D{3D|5D}:D<DGDJDJDNDP@r@r@r@t@uJ$T$TiDD DDDD!D#D%D,D0D2DHDTD^DhDmDpDsDuDyD{D @@%1@$D$i DD DDDDD)D5D8D;DBDEDLDSDZDaDhDyDDDDDDDDDDDDDDDD D DDD)D0D@DRD!\D"gD#xD+D.D/D/D0D/D0D/D2D6D9D;D=D;D=D>DADC
894 D @@@ $)$nDD DDD D0DAD LD
896 DDDN@^@^j@`@a0b
897 $$uDD
899 lD D D@$$|X DDDDD D(DB@@$I!$"D}">" D"D#D"D&D#D%%D&(D'.@"L@"Z#0$0e$1t}0|0 00D1D8 D1D2D8D:D;*D<5D?<D@CDBJDDdDEgDOuDQuDR{DTDUDWDZD[D]DbDc0DgODfQDhSDgVDhYDj\Dl`DmhDplDBnDt}Du@0@02@34@5$$~| DD DDDDD$D,D1D4D6D8D;DLDRD\DbDgDlDpDvDxDDDDDDDDDDD DDD"D6D=DODUDXD[D_DwDDDDDDDDDDDDDDDDDD#D*D-@@@@@-$51p$4 DD D DDDD$D'D/D4D7@@@@@?$?$
900 t   D
901 DD
902 DDDD D%D,D.D2D4@ @ @ @ 4$;
904 DFDI(@B@F@F!$*$MLL DMDU DXDMDXDVDZD]D\D]!D^(D_*D`1Da8Db?DcF@L @L@N@ON$N$g܇f.f DgDj DgDjDlDnDp6DqDDpOD^@f@fe@hf$f9$DDD DDD'D.D>DGDIDLDODQDRDVDdDpDtD|DDDDDDDD]@e@7@V@@$k$| DD DDDDD$D,D4D7D<D<DADCDEDGDXDdDlDpDrDtD|DDDDDDDDD@@@@@@$$s DDDD D 'D .D 5D ;D =D@D BD LD TD [D ^D `D bD dD rD yD D D D D D D" D, D- D/ D> D? Dl Dm Do Dn Do D( D* D3 "D9 (D< 1DB 6DF ;DD >DF ADG XDI _DP dDW uDY D\ D] D^ D` Da Dc Dj Dq D" Dz D{ D~ D D D !D #D %D ,D 3D 5D @D HD QD UD \D cD nD vD yD {D }D D D D D D D D D D D D D @ @-D ݧ T  f s@ T@ }$$  - D D D D D D D #D ,D <D BD JD XD ZD ]D `D hD nD pD tD vD {D ~D D D D D D D D D D D D D D D D D D D D D
905 D
906 D
907 D
908 D
909 D
911 D
912 !D
914 (D
915 @D
916 ID
917 UD
918 XD
919 _D
920 fD
921 iD
922 lD
923 nD
924 qD
925 D
926 D
927 D
928 D
929 D
930 D
931 D"
932 D$
933 D%
934 D&
935 D(
936 D)
937 D*
938 D+
939 $D,
940 -D.
941 0D0
942 7D =D BD4
943 TD5
944 f5 C@ @ O@  @  @  / @  @
945 f$pddd:<Is1-W2W=F^w%[F !F$%cV%
946 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnpGnFr>5yph- !nzC{/=$98D9D<D9D< D=D@DC,@8\@:3$3j$F,EDFDGDI DJDKDN$@E\@G+$+$XXFWW WDXD[DXD[D\7@W@W$<$e"d.d ;dddDeDi DeDiDlDm0DqLDrNDtPD}dDkDsDDDDDDDDDDDDDDDDDDDDDK@de@f@g$"$" .;DD DDD7DGDI@DNDNDjDtD|DDDDDDDDDDDDD'@e@@&$4$N X]DD D DDDD(D+D.D<DVDxDDDDDDDDD D
948 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFz#zFr.zn~}X{EeB$;Ę:s: ::D;DBD;
949 DB D<DBD;DBD;DBD<D?+DB.DC3DB6DC8DF>DEADFC@:@:@:@:@<==$Goy$ DD
951 DDD @$%B$[ p|DD DD3D7DJDPDZD[D]DhDtD}DDDDD@@@@$$<s DDD DD)D6D>D@@@@)@@$G:$4+s, O-b./0u1 2$3(D4D6 D7D<D5D6D<DB$DD0DF>DIRDKtDLyDO|DRDQDRDQDRDSDWDXDZD[D]D_D`DbDeDfDm DnDtDu!Dv*Dx,Dy8Dz@D{B@.56@7@8@9@:B$J$Лs ODD DDDD D'D.D0DNDSDVD_DbDiDpDsDxD{DDDDDDDDDDDDDDDDDD D%D(@@@7@@!5($0G$Yl DD Dw@@$$l DD D w@@$$$s DD DD D$D &D 4D:D BDGDUD#hD%~D&D+D/D2D3D2D5D7D9@e@@@$$JII IDJDL DMDTDV8DWBDXmDZuD\D]D^DbDcDbDcDf&Dh4DiEDnHDp]Dq{DvDw@I
952 K@L-M@T4@Zx$?$s QDD DDDD3D;D@DFDYD`DgDwD~DDDDDD@@`@$m$hDD DDDD#D,D0D8D9D<DLDSDVD\Dg@@@g$o$ؠs DD DD:D&LD'SD/dD0kD4|D0D4D8D:D<D=D>DDADB7@@/@0d$$KJDKDLDN DO@J@L$dԡdԡdԡ:<Is1-W2W3F^w343P3Ff3%[F !F3F=F%$%cV%
953 )%b>%j&5F)%>%-<22332F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFnzpGn{/$=ԡ#;D=D@D=
956 )%b>%,q#j&F)%>%HK'LXUZ^a7bo*N5789:-<22-9<332F3F333344F%6P3h8(F%88G6s9%`::F%:sv<F<T;@_AFtAAA6CC(C#F%>C!%wD,+C,_3{p<y@3oF4IF6#J-F9J 8 _x(2ExKS?rw}k D^N{drZcRB/5O\I.pm'mFnnz#znpGnzK= zV $nv mDnDq
957 DsDuDxDy"Dz(D}/@m @o4$4 $ܦDD DDD"D%D,D6D?DBDJDLDSDVD]DhDr @ @ @z$z $X  DD DDDD D'D3D8DSDXDiDlDsDv@!@!!@3s$~'!$اI! T!DDDD$b!$}! DD DDDD ,D
958 7D<DMDVD_DdDqDxD"yD$@!@!!$!$6h5D6D7 DADBDC&DJ5DE9DJ<DNADRLDPODRRDPUDRXDZ[D[eD_|Da|DcDdDcDdDeDgDiDjDlDmDnDrDt DuDvDx7!7!@8!9!:"@;"<%"@=7">E"@_|?$?T"$p" }!"DD DDD D(D@DKDPD_DiDkDsD~DDDDDDDD!@!@"@!!$"$p"" DDD DDDD&D6D9"@"@@"9$>"$" ""DDDDDDD$D&D4D9D<DADDDIDLDQDTDYD\DaDdDiDlDqDtDyD|DDDDD D D D DDD"@"@"@#$%#$ "H# ^#D D& D  D&D'D)D*&D,2D2>D1ED2GD4ID8`D9aD4gD6uD:uD;yD<D;D<D=D<D@DBDGDBDGDIDJDLDKDPDSDTDNDPDQDVDWDXDWDXDYDXDYD_D`Da'Db+Dd,De."@n#@!@"y#@#.$6#$sԬr"r #r#r"rDsDz$D|2Dz7D|:D~<DGD`DDDDDDDDDDDDDDDDDD
959 DDD'D2D8DDDPD_DbDhDsD~DDDDDDDDD DD$D(D4D;DHDLD`DcDu5r#r!r!r!@r!@t#u"@v@w#@@u$#$T $$ &$DD D DDD"D+D0D3D:D<D@DFD IDMD O5$@A$@N$@F$S_$$$ DDDDDDDD 2D!5D#9D$;@A$@z$@;$B$$=<$< $<D=DA DBDFDEDFDH+DI0@<$2$$T S$S $S$S%SDTDY DT DYD[DY&D[)D].D^LD_oD`DaDbDcDdDe,DhEDifDjDmDnDoDpDqDr.DsHDtbDx|D|@S%@S!%@S/%U$dd<%d:<Is1-W2W=F^w%[F !F$%cV%
960 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8~}XC%&`zh%&p%%&%$%& &osDD DDDDD D!D#D'D,D0D8D>DGD O4Dh<%BD D DDDDDDD4ӳD<%DEDdDhDoDD$D*D+D*D+,&@@8&@@F&@@e@W&o$c&$.dv&-&- &-o-s--D.D6 D.D6D7D6 D7!D6#D9'D<,D=0D>8D<DD@MDCiDEvDGvDIDJDKDJDKDLDMDQDSDT,&@-@-@-&/&0&@1 @2e@3W&Ev$dsdt&dt:<Is1-W2W=F^w%[F !F$%cV%
961 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnhm'mFpGn&$)tݤ)D*D-D.D-D.D-D.D-!D/#D02@)@+#$7&$6ݤ6D7D:D;D:D;D:D;D:!D<#D=2@6@8#$7&$C&CDDDEDFe@C$&$L&LDMDNDOe@L$&$U ݤUDVDYDZDYDZDYDZDY!D[#D\2@U@W#$7 '$aD '`X` DaDdDaDd Da DdDjDm*Dl0Dm3Dl5Dm;Dn=DqLDsgDtpDu7'@`@`F'@b$X'$|Զl'{X{ D|D D| DDD)D4D<DKDN7'@{@{@}9@~N$V{'$,l'X DDDDDDD"D7D@DBDFDH7'@@@9@H$O'$|l'X DD D DDD D&D/D:DBDKDZD]7'@@@9@]$e'$l'DD DD"D$D'D)D1D9D;DBDHDP/9@@P$X'$<l'X DDDDDDD"D7D@DBDFDH7'@@@9@H$O'$l'DD DD"D$D'D)D1D9D;DBDHDP/9@@P$X'$l'DDDD%D1D;DGDQDe7'@e@l$l'$ Pl' X  D D D  DDD)D4D<DKDN7'@ @ @9@N$V ($!l' X  D!D%D!D%D&D(D*"D+7D,@D-BD.FD/H7'@ @ @"9@#H$Odd(d:<Is1-W2W=F^w%[F !F$%cV%
962 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFnz#zFr.pemh)(5y3($+*E(* P(*D+D- D, D1D+D1D3D4D8 D:$D<-D=2D>8D?Sa(@*l(@,v(@-(.S$[($ETD(D DEDFDI DE DIDKDLDRDSDRDS!DT#DV+DW,DY1DZ1@D(@Dl(@F1$6($`_(_ D`DbDa Df D`DfDhDiDmDo Dq)Dr.Ds4DuIDvK(@_l(@av(@b(cK$R($zE(y)y DzD|DDDD"D)D-D-D0D2a(@y)@y&)@{@|-$70)$C)DDD
963 D DDDDDDD D"D$[)@&)@@j)@ $(u)$@)DDD DDDD"D*D-D4D6)@)6$8)$x)( DDDD DDD D#)@(@$%)$)DDD"$$)$Ļ(DDD$(@$&)$ )
964 *
966 X
967 o
969 v@
970 j)@ *@ @$*e@$;*$Oļ)N_*N XNoNDODP DS DPDSDUDW DY0DZLD[TDWZD_bDbvDdDfDgDiDdDkDlDoDpDoDpDo DpDoDqDtDu!Dv(Du0Dv1Du2Dx7Dz<j)@Pe@Q7@QD$Dm*$}*|s| *|D}D DDD&D)D5DGDJDMDSDUDXDZD]D`DcDgDjDoDxD{DDDDDDDDDDD*@|~@e@*@*ə@$*$)_* *+DD DDDDDDD$D*D0D4D9DJDSDaDf+@*@+@/+@n$nA+ W+ m+ }+ + +$l)+ XoDD DDDDD D'D)D4D<DCDCDFDMDTDVDYD`DbDoD{DDDDDDDD D
971 D DDD DD DDD D'D4D@D!FD"N+@@e@7@@$*+V$V+$(,'s' ,'D(D/ D1D3&D6;D7AD9DD5GD7JD9MD<ZD;]D<_@)@*+,-$d+,$C(,BsB BDCDF DH DI"DJ/DK7DL:DMADNFDOIDFKDQSDRVs@B@DɢDK,@D^$^X,$\,[[ l,[y,[D\D^Dg!DiFDk`DlDnDoDqDs,[,[,[ə@^$,$zT,y,y ,yDzD DzD}DD<D@DLDVDYD`DsDDDDDDDDDDDDDDDDD DD(D9D>DQDYD\D_DdDtDwD*@y,@{,@|ə@},~-$-$, DD D DD-D7D?DADID`DcDfDiDlDqDsD{D~DDDDDDDDDDDDDDDDDDD
972 D D/@@@@ɢ$&- dd=-d:<Is1-W2W=F^w%[F !F$%cV%
973 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnFr.hr}nz~}XB-N--1$-1,D-D/D2$1$:19D:D;D>$1$M1L1L DMDUDMDV$2$b 1aa a a'2a92a%a DbDf Db DfDgDbDgDh&Dj,Dl-Dn;DoPDpgDqDrDsDt
976 D D
977 D DDDDDDD3DMD_DjD!rD"D#D%D(D*D-D/D1D4 D/#D4)D70D5GD7PD5RD7XD8]D9tD:D=D:D=D@DADBDDDEDFDI DKDP#DK&DP,DS3DQMDSVDQXDS^DTcDU}DVDYD\D]D\D]D^D`DaDdDeDhDiI3@u[3v3wc3xc3@y3@y3zc3zczc3{c3@{3||c4|xc2|tc/4|pcF4}lc@})}c}c@}Y4ccc$4$o1n4n NnnDoDDo%D(DDDJDXD[D^DaDfDiDmDxDDDDDDDDDDDDDDDDDDD
978 D D DD-D/D5DMDb4n4n4n4n4@p/q ry#@st4@tb$b4$x15 5DD DD%D,DEDGDHDLDXD`DcDgDoDsDvD}DDDDDDDDDDDDDDDDDDDDey#@.5@ ?5@9@$
979 M5$14 r55DD DDDDDD D&D*D+D,D-D2D7D9D;DPDYD^D`5@e@@@5@;$c5$1N DD
980  DD
981 D D0D8DLD\DdDuD|DDD D"D#D$D%D'D(D)D*D,D-+D.3D/DD=LD>WD?ZDB`DCkDDqDFxDGDHDJDKDLDNDODQDRDTDUDWDXDZD[D]D^+D`0DbKDaNDcQDkXDlmDnpDo|DqDrDtDuDyD{D|D{D|D~DDDDDD DR@452@5@5@"$"5$ N DD DDDD%D4DADLDSDUD^DaDeDpD}DDDDDDDDDDDD5@y#@ 6@"6@/26>6@7@*@$J6$N DD DDD$D1D<D@DBDNDRD]DhDpDv5@y#@.5@e@@~$~n6$xN DD DDD$D1D<D@DBDNDRD]DeDk5@y#@.5@e@@s$s6$r55 DD DDDDDDD D)D0D85@5@@e@@$@6$,1F sDD  D DD D-D0DADRDUD[D^DsDwDDDDD!D"D$D"D$D(D$D!D%D(D)D*D,D-D.DBDCD1 D2$D5'D2*D5-D63D88D9LD;^D<hD;kD<nD=xD>~D?D@DFDGDHDGDHDIDJDKDLDM66@5@A667$&7$P$1OsO C7ON7ODPDQDW DPDWDY.DZ3DY5DZ;D[=D]LD`dDbj_7@O@OR@Qq$qj7$f1ese C7e7eDfDjDf Dk DfDkDm_7@e7@eR@j$7$t1s7s DtDu Dv^2@s$7$y1x7x 7xDyDz D{^2@x$7$~1}} D~D D^2@}$7$1 DD D^2@$ 8$ 1 DD D^2@$%8$ 14 ?8J8DD D^2@$U8$@1 DD D^2@$n8$T1 DD D^2@$8$h18 88DD D^2@$8$1 DD D^2@$8$1 DD D^2@$8$1 DD D^2@$9$1X 9DD D^2@$(9$1X 9DD D^2@$@9$19 6X9DD D^2@$g9$1 DD D^2@$9$01 DD D^2@$9$D1X 9DD D^2@$9$`1X 99DD D^2@$9$1X 99DD D^2@$:$19 1:B:DD D^2@$R:$1 DD D^2@$i:$1 DD D^2@$:$1 ::DD D^2@$:$1 DD D^2@$:$1 DD D^2@$:$
982 01   : ;  D
983 D  D ^2@ $#;$P1 DD D^2@$:;$d1 DD D^2@$Y;$x1t; ;;DD  D!^2@$;$$1## D$D% D&^2@#$;$*1)) D*D+ D,^2@)$;$/1.t;. ;.<..D/D0 D1^2@.$ <$413+<3 8<3E<33D4D5 D6^2@3$ S<$9188 D9D: D;^2@8$p<$?1>s> <>t;>><><> <>$D?D@ DA'^2@>$)<$DH1CsC <C<CDDDE DF^2@C$<$Ih1HsH <H<HDIDJ DK^2@H$=$O1NsN <Nt;N,=N<=N<N DODP DQ$^2@N$&U=$U1TT DUDV DW^2@T$ddy=d:<Is1-W2W6>xF^ws9%[F !F%%%%<=F%$%`V%
984 )%b>%j&F)%>%-<223F343P3Ff3%3F32F3F333344F%6P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mF5ynnnh~}X)(B-!==XB$1tB0D1D4D1D4 D6D8%D9,D:3D;:D=AD>HD?ODAVDB]DCdDEkDFrDGyDJDPDQDSDTDUDVDWDXDZD[D\D^D_D`DbDcDdDfDgDhDiDk&Dl0Dm:DnDDoNDvXDy[B@0B@2b$bB$,tBDD
989 D D !D -D<D@$<D$<DDD!D"!D($D)8D*;D+=C@;$BD$/ <.D/D4 D6D7D@.$D$:<49D9 J89<9D:D= D?D:D?D@&DA5DD?DCDDDFE@9y#@9D@9E@=$IE$H<GDHDK DLDMD@G$ <E$P\EOhEO {EO<ODPDS DUDPDUDW"DV'DW)DY+DZ;D[KD\PD]\DadDcmDdmDcrDdtE@OD@O@QE@Sm$wE$g <fDgDhDgDi$E$r(<qDrDv
995 $E@>K@$+PK$ K`K DDDDqK${K$84<7D8D<
997 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mF)(MNN$=@t<mN< D=D@DAD@DADE'DB*DC0DD7DF>DGMDI]DH`DIb}N@<N@<N@>$gN$ME(LDMDP
999 DY DZ:N@V$?N$^E(]D^DaDba(@]$
1000 N$g  Of Of +OfE(fDgDh DjDgDkDnDo#Dq)Dr-Do/Dr2Dt4Du8DwODyQDxTDvWDyYDz_D{bD|dD}gD~nDrDDDDDD6O@fa(@fAO@h,jOOk`O@kqOkO@l$O$E(O ODDD
1002 D DDDD"@a(@DP$$ddOPd:<Is1-W2W=F^w%[F !F$%cV%
1003 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8ohnnm'mFWP$++X, s-D.D: D.D:D=D@*DA<DDLDENDGUDIeDBlD[lDflDLlDNpDOsDPyDSDVDYDZD\D]D^DaDaDdDeDgDhDiDlDoDpDrDsDuDID D@-e@/gP0rP@4P5P66@7P@8$P$, P DD DDDD8D;D@DUDZDmDoDsDuDyD{P@P@@P{$Q$Q*Q DDDD DDDDD@5Q@$dd@Qd:<Is1-W2WCXF^wn%[F !FGQ]QtQD=F%$%cV%
1004 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%Q"Q#Q$Q%Q&Q' R("R-8R1MR=cRByRGRLRQRWRcRhRsSt/Sz6%%%ESZSpSSSSSSST+TDTP3h8(F%88G6s9%`:^TwTT:F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oFTbTj4$UUIFcV6#J-F9J 8m'mFnn5ynphoFr.9zV$X WDXDYD]DYD]D^ D_$D]'Da.Dd@DeBDcEDeIDfSV@Wy#@Y@ZW$WV$n( mDn:+DY@Q.Dn:1DZ @Q?DqDrDs Dt4Vo4$6V$z` yDz:cDY@QfDz:iDZ @QwD}D~D D4V{4$6V$ D:D`@QD:Da @QDDD D4V4$6V$ D:DY@QD:DZ @QDDD$D'V'$)W$ DDD$"W$ DDD$@W$, DDD$fW$D DDDD DD(D+D9՞@~W@9$9W$W DDD$W$t WWWDD DD D#D=D@DODQDUDnDnD~DDDDDDDDDDDDDDD1D=D=DBDNDQD
1005 UD UD
1006 YD [W@W@XX@&X@6X@CXe@nU$_TX$iXDDDDD" D#+D%0D:DCDYD&YX@XX@`$`X$/X.D/D2D7D2!D8$X0$)X$A@Y@ DADD DADDDLDDDL"DO$DT5DO:DT=DU?D\HDblD\oDbrDd~Df@@X@@$Y$x .Yw@Yw wDxD~ Dx D~DD$D6:^DY>@QaDA:dDYDDZG@QuDUDYD_DeDqDuDwRY@wdY@wX@yVze${vY$YDD
1008 D D DDDDD@Z@2Z@AZ@SZ@fZ@xZ@ZZ@$ddZd:<Is1-W2W=F^w%[F !F$%cV%
1009 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 83-93n_AZ$-Z,D-D.D/ Z@,$ Z$2D2D3D2D3D4 $[$8[7D8D<D8 D<D=D;D=!D>.DA@DBL![@7$L0[$L [KDLDPDL DPDQDODQ!DR.DSRDUdDVp![@K$pB[$[t V[ZZ [ZD[D^D`DaDc%f[@Z@Z![@Z$'v[$h V[gg [gDhDj DhDjDlDn!Do$DpGDrQ@g[@jY$Y[$y [xDyD}Dy D}D~D|D~!D.D@![@x$G[$@
1010 [DDD DDDD!D.DRDd![@$k['\&O\$
1011 DDD
1012 DD@$a\$
1013 DD @$z\$
1014 DDD $ \$
1015 \DDDDD!D-D>DC\@e@\(` C$H\$< DDDD D DDD$D(D!4D"9@e@9$>]$5| 4D5D6D8D9 D;@D>Y@4$i!]Fh]&H]$S ]RDSDV DWDX&DV.D[9D\GD]I]@Re@TI$Q]$d< ]cDdDfDg DhDfDj%Dk*]@ce@e*$,] *dh dh ^dh :<Is1-W2W=F^w%[F !F$%cV%
1016 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8pm'mFznn^$ h '^2^ D D# D D#D$D' D$%D%(D'.D(0D*4D,9D/<D.AD/C?^@J^@W^@!9$Fg^$2 '^1D2D3 D5D3D5D7D8(D;1D86D99D;?D<AD>HD?MD@PDARDBVDCVDB[DC]?^@1@3y^3W^@4V$`^$F ^E2^E DFDIDL+DO6DQADUGDWODXVDZ\D\aD_dD^iD_k^@EJ^@E^@Ga$n^$c ^bDcDfDc Df
1017 Dh DgDhDiDj!Dk#Dl*^@b^@d1$1_$p _oDpDsDp Ds
1018 Du DtDuDvDw!Dx#Dy*@o*_@q1$1;_$}  '|D}D
1020 )%b>%j&5F)%>%-<223oF4F%6%%%P3Ff3h8(F%88G6s9%`:IFmF3F343P3%3332F3F333344:F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@36#J-F9J 8nnnm'm_$6_5D6D9D6D9 D:D<+D=+D<.D=0_@5_@7+$4_$B(_A_A DBDEDBDE DFDH.DI.DH1DI3_@A_@C.$7_$N`_MDNDO_@M$ _$Ul`T`T DUDW$```$t_DDDD DDD"D%D (D#.D"2D#4_@`@$7`$'`&_& `&D'D* D' D*D+D-#D.)D/6D0;D2;D0AD3DD4KD7QD6UD7W a@&_@&a@&(a@(;$[5a$;Ka:_: D;DCDEDADCDLDN%DO7DP9DQ;DR=DUCDVHDWKDZQ(a@:_@:`@<Xa@=ha@>C$Yua$_da^D_Dc DjDkDmDn#Do%Dp-Dq/Ds8DtCDuKDvQa@^a@`a@aQ$Ya$KaDD DDDDD D+D-D5D7D>DD(a@a@a@D$La$ KaDDDD DDDDD(a@a@@$d+d,ad,:<Is1-W2W@3F^w%[F !FP3Ff3=F%$%cV%
1021 )%b>%j&5F)%>%-<223F343P3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFFr.nnna$8,"7b7 D8D; D=D8.D=1D>5D?@DAX@D[DpaDApDCuDE}DFD?DIDJ"@7"@7b@9b:)b;$5b$TEbSDTDW D`DXD^D`Dc&D[(Dc*DZ/Dc5De7Df<DjPDkZDoaDdDhDDDDDDDDDsDqDsDuDvDwD{D}D~DDDDDDUbUfb@V"@WqbX~bYb@Z@[$b$bb DD D DD#D+D;DHDZDbDvDDDDDDDDDDDDDDDDDDDDDb@b@e@#@b c@c@$$c$4cCc TcDD D+D>DKDNDQDTDWDZDaDdDiDrDzDzDDDDDDDDDDDDDDDDDDDDDDDDDDD"D/D7D:ec@rc@ccccc@c@cc"$Bc$4cd DD DDDD D#4D$ID&MD+`D,bD.fD/h d@1d@"@Cdh$pMd$;ad;nd< {d=D>DB D>DBDCDD D>"DD%DF+DG1DF3DG5DH7DICDJQDKTDL_DNcDMfDNhd@;d@=y#@?d@@T$md$RdQdQ DRDS DTd@Qd@Q$e$X("WDXD] D^D]D^"D_&D^+D_0D`@DaHD_LDbQDdU"@We@Y7@Zy#@[]$]e$h)eg4eg DhDq DrDs(Dt,Dr0Ds3Dt6Du;Dt>Du@DvEDuJDvMDwODx]DydDzwD{~D|D}D~D|DDDDe@i7@j?e@kLelXem"@ndeo$me$d"e DD
1023 DD
1024  D DD"D$D'D,D0D2D4D8D ;D BD!E"@g@c@c@E$Jg$%80g$J8$ D%D& D(D%D(D*D+%D*)D++D-2D,5D.9D/9D.<D/>>g@$y#@$f@&9$CLg$E|"DDEDFDGDH,DI."@D$0`g$Q4cPDQDRDTDUDV6tg@Pe@R:$:g$j"igi DjDnDs DjDsDvDDDDz%Dy'Dz)D}<D|>D}@DBDDDFDLDNDPDVDXDZD`DbDd3RD4jD3naYDq3ZD4rD4raZDr3\D4tD3xD4{ajDD3pD4asDDDDDDDD"@ig@i@kgl$g$"DDD
1025 D @DaDDDD$D&"@g@$$+g&h$FDDD$2h$"DDD
1026 D DDDD"D$"@g@"$)Lh$!.f   D!D( D*D,(D-@D.LD/iD1nD2uD4yD*D4D5D*D7D9D8D9e@"6#f@$hh%th@&$h$JhIfI DJDNDJ
1027 DM DNDPDQDRDS"DT$h@If@Ig@K"$)h$ah`h` h`DaDe DfDeDh Dl+DnIDoLDnaDpmDstDw{DxDyD|DzD}e@b$h$ iDD$i$ iDDD D DD *i@$%7i$ iDD D DDDD(D.D0D9D<D@DLDPDRD\D`D`DdDf*i@"@Li@y#@`$jXi$h!hiDDD 43!D*a!D*D8D:ti@c@:$Ai$!"i DD DDD$D&D*D4DEDNDRDUDW"@i@i@i@i@E$\i$")e4e DDD
1028 D DDn#@i@$'d/"d0"id0":<Is1-W2W0F^w=F%[F !F$%cV%
1029 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nn5yhm'mFz#npGnFr>znzzK{e:~}XTh+4X< Fn%Di$E0"jDDEDF DG DHj@D$"j$TH"<jSDTDW DYDWDYDW!DZ$DW,D]3D`<Sj@Se@UD$Djj$m"jlDmDoDqDsDrDu"Dw)Dy2Dx5Dz<j@l$Aj$"jj DD DDDD,D3D?DBDEDHDMDPDSDmDtDyDDDDDDDDDDD@j@P@j$j$#jk kDD DDDDDDD$D=DDDNDdDrDDDDDDDDD4DI&k@6k@@
1030 qKI$QJk$$ikk tkDD  D D DD/D@DNDVDX&k@P@j@~kX$_k$,T%ik+k+ k+D,D2 D,D/D2D4D5!D6+D>,D9/D>2D@HDA[DIhDLDNDPDRDSDXDZD[DZD[DZD[D`DaDcDdDek@+&k@+P@-j@.~k/k@0$ k$zt&ikyky kyDzD DzDDDD$D;DGDLDUDfDpDzD}DDk@y&k@yk@y@{
1032 D DDQl@k@\l@~kj@gl@pl@$yl$(lDDD  D!D#&D$2\l@$9l$3X(ik2l2 Fl2D3D5 D:D<!D3)D<,D?2DADDCYDA\DC^DAiDCkDDmDFxDIDKDLDNDODRDTDUDYDZD\D?D^@2/4l5P@6l@7l8$m${h)jzmz ,mz@mzD{D D{ DDDD,D<DSD^D`DcDqDDDDD3#*D3D4i**D3,*D3D4i;*D3>*D4iA*DDDDDDDDDD!D(D4D7D<DBDHDLDQD\DcDdDiDiDlDpDtDDDDDDDDDDDD@zTm@zqK|hm@}W~xm@me@S7@cm@m@i$m$,+jm mm@mDD DDD$D&D-D -D =D DDHDYD[D^D^DjDnDpDzDDDD D!@n@n@#n@4n-^$@n$/+j.Yn. dn..D/D5 D/ D5D/D5D1D2"D3)D50D77D;DD<eD@rDBDCDEDIDLDNDODTDVDWDYD\DZD\D]D_D`qn@.|n@.@.n@0n1n2
1033 3$n$t,nsns msmsosDtDx DzD|!D}.D~IDx\Dgo@s@ue@vo$o&o$8-<oj mmmDD DDDDD*D.D5D7D9D<DDDLDSDfDpDrDxDDDDDDDDDDDDDDRo@@ho@#n@e@
1034 $ {o$D.jo oDD DDD D,D9DFD dD kD kDwDDDDDD@o@o@@ y#@ k$o$$.o## ]#D$D* D$D*D-D.D2 D9#D1&D6-D9/D:5D=7D>No@#@#*@##n@%p&n@'
1035 (N$Pp$ML/ikL6pL DMDP DMDPDQDT#DW/DX3D[?D_ND`ZDa]Dd`De`k@LHp@LZp@N`$hlp$z/jyt;y ikypypyDzD DzDDDD$D,D8D;DBDDDGDNDiDyDDDDDDDj@yk@yp@p$p$`0ikp <qDD DDDDD D,D1D3D@DMDTDVq@1q@p@V$^Lq$0ikjq DD DDDD+D9DBDQD \DcDrDtD|DDD"D$DD+D-D.D2k@uqqj@qq@qe@I@|$q$F1ikE E jqEE]EDFDO DUDFDUDVDX.D]2D_8D`BDgSDhZDmlDnDpDuDpDrDuDvDzD|DzD|DyD|D~DDk@Ej@En@G
1036 HpIq@JqKqL#n@Mq@No@O$r$2ik  DD DDD#D&D.D5D<D>DSDWD\DdDgDjDsDvDyDDDDDDDD@+r6r@pquqKM@$Hr$3ikor DDD DDDD,D0D3D:DDDGD_k@r@d$dr$3ikDD DDD(D;DPDbDnDtDDDDDDDDDDDk@e@r@@$r$ 4j j  D D D DDDD D(D,D1D3D;D"RD$YD:lD;yD(D*D,D/D7D/D8D=D>D@DAj@ @ r@r@e@$r$I5 HjqH DIDNDPDT,DV4DYCD\SDZVD\YDTcD^nHj@H7@J@Lv$vd.6d06 sd06:<Is1-W2W=F^w%[F !F$%cV%
1037 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFz#nnzz;ns*gs&;s$S06sRDSDV DWDV#DW$DV)DX4e@T4$<s$hl6sgsg sggDhDi DlDhDlDmDp*Dq5Dz=D{DDXD^DgDkDmt@g"6@gt@i&t@j^$q7t$6tDD D"D/D2}N@Qt$9at$7ytt sDD DDD"D(D5D7D:D<DHDJDLDbDeDhDiDoDuDxDzt@t@t@b$t$7ytDDDD"D+o@e@0$0t$7ytDD DD$D4DBDXDhDjDoDxD~DDDDDDDDDo@e@$u$ 8yt X  D D D D=DBDIDKo@ e@K$S)u$09ytX DD! D" D%=D!UD']D(_e@_$gCu$/9yt.\. D/D2D/D2D4 D2.D73D85o@.\@.e@05$9[u$?9yt>X> D?DB DC DD=DBBDFIDGKo@>e@@K$S|u$P(:ytOXO DPDT DU DX=DTUDZ]D[_e@Q_$gu$b:yta\a DbDeDbDeDg De.Dk3Dl5o@a\@ae@c5$9u$u:ttt DuDvDu Dv Dw@t$!u$:ytDD DD$D*D-D0D7DADMDTD`DgDsDzDDDDDDDDDDo@e@u@$$u$;^v DDD D(D1D8DEDODTDgDiDmDvDx^@v@u@@ x$dK<dL<vdL<:<Is1-W2W=F^w%[F !F$%cV%
1038 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFz#pzzpGnn~}Xz{e+vAwv&D8v$ZL<vYDZD^DZ D^D`DcDd%Dn3Dg6Dh@DiJDjTDk^DldDnkDpv@Yv@[$v$y<vxDyDz DDD0D;DGDUDXDbDnDsD}DDDDDDDDDv@xv@ze@{?@|$w$=vDDD DDDD*D9DADHv@v@O$O#w$>vBw DD DDDD D'D.D:DBDKDZDlDzDDDDDDDDDDD DD+D.D@DGDLDSDXDfDiDDDDDDDD D
1039 Vw@aw(@lwwww3w7@^@*@$w$?vw 7DDD D"D%!D&$D%'D&-D(<D&DD(JD)LD(jD*sD+D0D/D0D1D2D5D6D7v@C@@w@$w$@@v?D@DD DGDI'DK8DMKDNRDPbDIrDQtDIwDQ|DI~DTDZD[DZD`DbDeDgDiDjDl7De=Dl?DeBDlDDeGD`IDo\Dp^e@A@B*@K8b*@g7^$fw$xLBxw/xw DxDy DxDzD~D"D%D+D4D\DjDqDs:x@wEx@wyze@{@|Px@}v@~bx@s${vx$Bx/x DD
1041 D D;D@D`DsDue@x@*@xu$} y$&hEv%9% D&D) D&D*D,D-"D/(D2<D3@D2YD5hD6jv@%e@',y@()bx@*j$r:y$=Ev<< D=DG DF DGDHDJ DN'DP<DQFDRMDUSDSYDW[D]dDZfD]mDkxD]{D`DeD`DeDgDhDmDpDxDtDxDzD|DxDDDDD D DDDDD"D%D(D-D0D4D7DBDHDLDNDTDXDZD\D\DbDeDhDkDnDpDvDDDNDD/>7@?My@`y@A @B@C@DuyEyFyGyH@O@4\b$y$Gx/x DD DDD(:x@Ex@@@$*y$Gvt DDD DDDDDD$D7D=D?v@}N@v@^@?$Fy$Gvs x<zDD DDDDD#D&D)D .D9D <D >DPD TDYDaD1aDcD1fDiD1oD7tD=D7D4D7D4D=D>D?D1DDDIDDDIDLDODP DS DIDV#DY.D[8D\@D]LD[XD^^D`lD_oDcyDd|&z@1zCzTze@fzy$nz$p|Ivoso DpDy Dx D{DyD{DyD{"D:DHDXDiDpDDDDDDDDDDDD DD$D'D+D-D4D:D<D@DQDaDmDsDDDDDDDDDDDDDD DDD&D8D>DPDfe@qCzrz@sz@u*@wzxTzy=zz{UL|7sf$nz C{$6Kj{5D6D< D=@LDDD&vLD=&D<,D@5DBLDA]DBaD@dDCm{@5e@7r$r{$H`Lj{GDHDN DODNDR*DS@DRRDU[{@Ge@I`$`{$[L{Z{Z {ZD[D\D]D^D`Da+Db7|@Z|@Z(|@Z$;B|$hL{g{g {gDhDiDjDkDmDn+Do7|@g|@g(|@g$;S|(C d7Md8Ms|d8M:<Is1-W2W=F^w%[F !F$%cV%
1042 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8z#zhnnm'mF~}XFr.pemzKz;z|$)8M(s( D)D+ D-D+D-D/0D17D2ED7TD9[D:^D9`D:cD;eD?hDA{DCDGDIDGDIDCDIDJDMDNDQDRDSDRDSDTDVD_%Da1Dc8Da:Dc?DeTDgWDeZDgcDjDkDjDkDrDtDuDwDxDyD}DcDDD)DA2DDDZDf/*|+=C|@[7@\@]|^|_@eT5@nqoqpn$n|$Os DD DD$D'D/D9D@DEDTDrDwDDDDDDDDDD!DBDLD\DmDtDDDDDDDDDDDDDDDD DD'DLD\DzDDDDDDD DD$D)D/D1DBDFDIDTDqDtDwD}DDDDD
1045 }}4F%[F !F6%%%P3Ff3h8(F%88G6s9%`:IF}-}$HX}H~H I~IDJDKDJDKDLDN8DOO!~@H+~@H@I5~@L>~@LP~@L55~@N[~@Nf~@N8O$Sq~$] Y}]~] ~~]~^D_Db D_ DbD_DbDcjDboDcq!~@]+~@]~@]$t~$gY~f~f ~f~fDgDk Dm3Dl7Dm>Dn@Do`DqhDpDnDtDuDtDuDwDvDwDxDwDxDyDzD{ D| D{&D|)D}@D~CDUDXDDDDDDDDDDDDDDDDDD D.D4D7DNDRDtD{D~DDDDDDDD DD%D(D,DDDXDoDyDDDDD~h~@h~@hh @hh"h,@i5@i>iMi$d8]d8]\d8]:<Is1-W2W6>xF^ws9%[F !F%%%%<=F%$%`V%
1046 )%b>%j&F)%>%-<223F343P3Ff3%3F32F3F333344F%6P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFr}hNF%6s9h8>:x$B8]DBDFDGDIDJ(Ce@D($*$Od]DODPDQ$̀$]|]D]DaDcDe"DgBDhD@^_$Id]d]d]:<Is1-W2W=F^w%[F !F$%cV%
1047 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8nnm'mFzK$7]626 ;6D7D@D7D9 D@'DA0D88DA:DC=DEHDIQDJWDIeDJfDCiDMuDN|DPDQDSDTDV56M6U6^@8n9e@;{<=$d^d^d^:<Is1-W2W=F^w%[F !F$%cV%
1048 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnFr.h5yp@<on,;z0$F^*EDFDI DL"DI(DN+*@EG2$2$V^,UDVD[DW D[D\D]D^*D_5Da@DbKDcVDdaDelDiwDjDm*@U1@W$=${T_,zTz D{D|D}DD)D0DEDTDiDwDD*@ze@z1@|(@}$h$_t.f yDD D DDD(D0DSDSDhDnDqDDDDDDDDDDD43`D`DD43`D`DDDDDD'DIDLDcDhDDDDDDDDDDDDD8DMDdDyDDDDDDD@@/Sy#@@hI$˂$b, D:bDY DZbDD
1050 V@-@F:$F$h Y kDD D DDDDD!#D#+D&1D'3D)BD,LD/ND0RD3hD6kD5nD6qD8|D7~D9D;D<V@x@@@@$$ELi,D D DEDJDE
1051 DJ DLDODP'DR0DSBDTPDWSDY^D[gD]x*@D՞@D@F@G$΄$eidd DeDi De DiDj@d @d$$qi,p*p DqDt DqDtDDD+D7D?DJD\*@p4@pe@rd$d>$Lj,* DD DDDDD$D4D7DMD\DhDpD{D*@4@e@$P$j*  DDD
1052 D DDD"D1D7DDDHDRD[DmDpDDDD4@՞@$d$tk,  DDDDDD#D)D:DLD\DbDsD*@V@$y d ldldl:<Is1-W2WCXF^wn%[F !FD6>xFs9%%%%%-v +ąn4F%6P3Ff3h8(F%88G6s9%`:ۅ$FP,F8 (%%@Gn6%jkl Aiʋ&!B{6nŽ]!Sϓ5*Q7ڔ F%kUs9`+,-ޘB<)BP3[Jpg=F%$%`V%
1053 )%b>%j&F)%>%-223F343P3%3F32F3F333344:F%:sv<F<T;@3F%P3_AFtAAA6CC(C#F%>C!%wD@3kFbÚj4IF)6#J-F9J 8Yi(EKVS͟rl}%<TDoN&d>r߯!<ױ+Dz%HԴCb?ζm'mFnnFrϰU,h5yon<y7{M8X,;%$SlRDSDWDS DWDYD[D\ D_,D\/D]2D_5DaFDbTDaZDd`DggDhnDiu@R@Te@U|$|$llkDlDmDo DpDqDr'Ds.@k@m5$5$vlu!u DvDx DvDwDxDDyD$D03lD.8 mDIDLDTD\DdDy3EmD.VmDDDDDDDDDD DD,D/DLD_DdDlDtDDDDDDDDDDDDDDDDDDD@u@w(@x3ye@{6@|D@}$S$n DD DDD#D-D3D8DDDNDTDXDsD}DDDDDDDDDDDDDDDD
1054 D DDD@ @@@$@$1$p DD! D' D!D'D!D'D(*D)<D+D,D-D(D1D3D4D5D7D8M@5 X!$f$<q;y; D<D?D< D?DADC$DD+DE- @;@;@=-$2$I4qHyH DIDN DI DNDIDNDP DQ$DV$DU'DV*DU,DV/DX<DYMD\PD_TD`V @H@HJ@K@LV$^$dqcyc DdDeDdDe DgDi$Dj&Dk7Dl9 @c@c$@$uqtt DuDvDz D|D}D| D}#D~*D+D:D=DIDV@t,@v9wV$[F$0rQ qDDDDD/D2D7DBDDDJD`DqDyD|DDDDDDDDDDDDD33sDiD.GsD3LsDjRsD"D:DID`DcDk3sD-~D.sD3sD.sDDDDD@@@ @@@@$5$sA\ hwDD D
1055 D D4D8D:DCDLDTDXDZ@@5@$^$@tDDD DDD%D(DBD LDhD~DDDDDD D!@&|&$$(uD(D+D-D/D0&)$$L4uKK DLD\ DeDUDe"Df7DgSDjiDgtDjwDkyDmDnDsDyDsDyD{D|D~DDDDD*43_vD+bvD.43cvD/fvD243vD]D]vD]DpDDDDDDDD DDD D)D@43wD^D^wD^43wDaDjDpwDtDDDDDDDDDD D)D;DYDwDDDM@N&O%&P3@QD&RZ&Sn@TzU@W@X@Z@[\^_$ dxdxdx:<Is1-W2WXF^wn%[F !FD6>xFs9%%%%%-v <=F%$%`V%
1056 )%b>%j&F)%>%-223F343P3Ff3%3F32F3F333344F%6P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnFr,,,,<y7{M5y&6.$CxDBYB DCDN DU DNDUDCDNDUDV>DXgD[}D\DaDbDaDiDmDpDmDpDqDr43zD.D9/zDs?DwBDuJDvQDXDxaDgDwDDDDDDDDDDDDPDPDrDDDDDDDDDDDDDD DDD#DADbDDDe@BqD@EF@GHD&I&J&K&L@MNOR*@@@@P$R$|ikY DD D#D9D@DGDhDoDqe@g@v@@q$y$| DD D DD#D'D,D.D4DIDLDMDO@@@@O$S &F&Ȝj&Ҝ$P} &DD  DD
1058 U b x5@@9$A$lkk kDlDoDl(Do+Dt;DxqDwrDxt@k@k$w$| ik{Y{ {D|D DDD D#D/D1D4D@DADCDPDXDZDsDDDDDDk@{!}~/A@Th@@$$Y DD D DDDDD(D0D3D=DDDLD\DjDoDqDyD~DDDDDe@@!/@
1059  $dсdԁ8dԁ:<Is1-W2WXF^wn%[F !FD=F%$%cV%
1060 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnFr.5ynzBy$0ԁ/D0D3
1063 DeDg#Dh=DiFDjKDlLDnaDoqDpuDrDsDtDvDwDyDzD|D~DDD DD$D85@-9F]u@@@t@FS@Oi@_K@na@$@$ DDDD$ ddd:<Is1-W2W=F^w%[F !F$%cV%
1064 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8m'mFnnFr.z#zz%:@<n$:s8v8 8t89 9D:DFDCDDDF!DH#DI<DLDDMFDPIDYIDRRDSWDV\DW_D]_Dc_D_dDbnDnnDpDrDsDrDsDrDsDuDvDuDvDwDyD{D|DnD|DnD~D)D?DBDHDKDODUDZDpDDDDDDDDD}N@8$@97@;<<@=D>/?h@@$r$s vt $( ,DD DD#D*DCDFDLDaDaDfDiDjDqD{D{DDDDDDDDDDDDDDD DD+D0DKDxDDDD@7@@$$@ DD D DDDD!D&D)D+DEDG@5@@@G$O&$[ DD D D#@1@$%7$v DD! D"D&DD%D&D(D*+D+-D,2D-5D/8D09D7>D8SD9\D:qD<|D=D>D?DADBDCDDDF@DD֍DFDG3DH<@D?DZDHZDIoDKxDMDPDQDRDS&DV)DX-DZ2D[2DZ5D[7K@@W!e@"@#2$<v$qpp ppDqD DvDD#D<D?DDDGDVDdDeDwD{D~DDDDDDDD
1067 D D
1071 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8;m'mFnnoz#zn5yFr.1$ܛG ]DD$ D D$DD$D'D(-D)5D+8D-MD0`D2`D0uD2D3X@p@7X@ `$dldl{dl:<Is1-W2W=F^w%[F !F$%cV%
1072 )%b>%j&5F)%>%-<223F343P3Ff3%3F32F3F333344F%6%%%P3h8(F%88G6s9%`::F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@3oF4IF6#J-F9J 8z#m'mFnnznFr.z3,-M!PYUZ]_1`^qvz!^=rB ,/7K$hlgg ggDhDj DlDjDkDlDu.Dt1Du4Dv7Dl:Dr=Dt@D|CDvEDrGDsJDvMDwPDxWD|ZDvD|DDDDDDDDDD
1073 D"DWD`DhDrD~DDDi(@j@k3@l$D$Wd pDD DDDD D&D*D,D1DID[D`DpDxDDDDDDDDD DDD;DWDZD]DuDxDx@@*@@Zxx$$Wd DDDD!D'D)D+D=DBDTD\DfD {D!D%D)D*D0D1D2D5D6D7D<D=D>D?DA@@@!*@,@<$<$MWLNL [LDMDR DVD[@Li@Lv@L$$hgNg [gDhDjDh Dj DpDqDt8DuEDvH@gv@g$O$ DDD DDDD1DNDXDtDtD{@@{$$WN DD
1074 D DDDD D*D-@i@@2$2$v DDDDDDDD3D5D9D;@K@^@;$Bddd:<Is1-W2W53F^w343P3Ff3%[F !F3F3oF1K4F%6%%%P3h8(F%88G6s9%`:IF<a{,-MPUQZ]_`"qFvrzL'e C V t${~8VU3-7W>C UPZf`jj}u:{8)Uyl+$DDD DDDDD(D2D<DADGDNDUD\DcDjDqDxDDDDDDDDDDDDDDDDDDDDD
1076 DD RD jD mD sD zD DDDDDDDY@n@$}$D DD(D D(D)D*D+,D,6D-AD.ID/LD0aD1jD3pD4r& n@(r$y$7l6D6 D7D8D7
1079 D DDD&D,D2D4D>DCn@@$H$@DDD n@$$PDDD n@$$`DDD n@$6$pT bDD DDn@n@|@$$ DD D n@@$$ DD D n@ @$$: DD D n@K@$\$ 
1080    D D DDn@
1081 @ @ $$ȩ DD D Dn@@$$ DD D Dn@@$$# =! L"D#D$ D%D&n@ Y@!h@"$u$* () D*D+ D, n@(@)$$0./ D0D1 D2 n@.@/$$6,4@5 D6D7 D8 n@4Q@5$b$<<:; D<D= D> n@:@;$$CL@A BDCDD DEDFn@@@A@B$$J`H'I DJDK DL n@H8@I$I$PpNqO DPDQ DR n@N@O$$UTT DUDVDUDV DW DYDZn@T@T$$_\] W^D_D` DaDbn@\ @]@^$$fd?e DfDkDm $P$pĪoao J8okoDpDq DpDqDrDt&Du/DvBDuGDvMDxSDz_D|dD}pDpDvDxD~DDDDDDDDDDDDDDDDD#DRDTDWDYDcDwDDDDDDDDDDDn@oz@o@o}@~p$$J8 kDDDDDD"D$D*D:D?DEDGDKDgDpD|DDn@y#@@@$$8J8 DD DD)D+D-D4DADMDPDSDXDXD\DdDfDjDuD|DDDDDDDDDDDDDDDDn@@@ @X$$ DDD n@$8$DDDDD!n@$#W$@DDDD D"n@$$v$dDDDD.D:D=DDn@$I$DDDD.D:D=DCn@$H$DD D D
1084 D
1085 D)
1086 D6
1087 D;
1088 D<
1089 D G
1090 D
1091 Q
1092 D Z
1093 D ]
1094 D c
1095 D f
1096 D z
1097 D
1098 D
1099 D
1100 D
1101 D
1102 D
1103 D
1104 D
1105 D 
1106 D!
1107 D"
1108 D) D* D" D$ D# D$ D# D$ D%& D&. D'D D(Q D-X D0n D1p D2z D3 D5 D6 D9 D: D= D> D@ DA D DD @@@@ @@(0 @/0@S! T!. @VA WP @X,a@{9_ @@o  \ @<Zy#@_ @  @ @l @4 @4  @ ;
1110 D DDD (D 9D <D >D@DFDODdDoDtDtDDxDDDDDDDDDDDD D"D!D"D#D$D%D&(!@J7!MJ!N]!Ot!P/Q!R!S!@T!@U!@td@!@7@6C7@]!@[u!@7@!@"@ "@t$"$*$)*") 9")G")S")D*D- D/D0*D1+D28D3:D4?D5QD4VD5YD7[D9aD:mD<pD=|D?D@D?D@DADBDDDEDFDGDHDIDJDLDKDLDMDNDP DQDRDSDT&DVHDWMg"@) @+y#@,M$Uu"$a|]?^ M_`DaDb Da DbDaDbDc!Dd+De5Dh>n@]@_@`@b>$F"$sno "pMqrDsDt DwDtDwDtDwDxDz"Dx(Dy+Dz1D{4D8D>DDDLD}TD~]DcDkD|D|DDDDDDDDDDDDDDDDDDD%D,D3D<DDDIDIDIDLDODWDZDcDkD~DDDDDDDDDDDDDDDDn@n"tuv@|"DI$ "$DD-
1111 D.$D/(D07n@$<"$5 3 #3 a4$#4D5D: D5D:D5#D:&D5-D:0D61D78D9?D:FDERDF\DGfDMpDNwDODPDQDRDSDUDVDWDXDYD^D_D`DbDa DbDaDbDcDd%De)Dg,Dh.n@31#@3L#@4Y#6m#7#8#9@X!@Y).$6#$lDkDk DlDmDnDpDq$Dp*Dr0Du0Ds;DuBDrHDtODuVDv`Dw`DxpDwuDx{Dy}DzD{D}DDDDDDDDDDDn@k#ne@o#@v`$#$0a MDDDD%D/DGn@"@#@@G$P$$a MDD DDDD D"D7n@@#@@$?'$$ aM9$$# DDDDD D#D&D(D0D7D7D 7D 7D, 7D8 7DH 7Dc 7D 7D 7D 7D 7D 7D 7D 7D
1112 7D
1113 7D)
1114 HDJ
1115 PDO
1116 PD
1118 D D D D D D D D D D( D D( *D. FD/ QD0 \D2 dD3 nD6 D7 D9 D: D; D9 D; D< D= D@ D? D@ DA DD DF DG DF DG DI DJ %DK ,DM 4DN ;DP @DQ GDT LDW D\ D^ Db Dd Df De Df Dd De Df Di Dk Dn Dq Dn $Dq &Dr (Ds 1Dt ?Du EDs JDu MDy qDz yD~ D D D D D D D D D D D D D D D D %D .D :D @D ND aD dD jD lD oD uD xD ~D D D D D D D D D D D D D D D D .D 8D @D UD `D jD zD D D D D D D D D D D D D D D D D D D D D
1119 ;D
1120 FD
1121 OD
1122 [D
1123 aD
1124 dD
1125 lD
1126 }D
1127 }D
1128 D
1129 D
1130 D
1131 D
1132 D
1133 D
1134 D
1135 D
1136 D
1137 D
1138 D
1139 D
1140 D#
1141 D$
1142 D%
1143 D'
1144 $D+
1145 .D>
1146 8D?
1147 HD@
1148 LDB
1149 hDC
1150 DD
1151 DE
1152 DF
1153 DG
1154 DI
1155 DK
1156 DL
1157 DN
1158 DP
1159 DQ
1160 D
1161 D
1162  D
1163  D
1164 ' D
1165 ) D
1166 9 D
1167 < D
1168 L D
1169 \ D
1170 t D
1171 w D
1172 { D
1173 D
1174 D
1175 D
1176 D D
1177 n@D$@Q$@x@(A@Wu]$@ @6 i$@\ @^ @n @ ]$@ Fx$@
1178 } $ $$
1180 a
1181 M
1183 D
1184 D
1185 D
1186 D
1187 D
1188 "D
1189 %D
1190 (D
1191 (D
1192 7D
1193 :D
1194 =D
1195 CD
1196 ID
1197 XD
1198 _D
1199 hD
1200 sD
1201 vD
1202 zD
1203 D
1204 D
1205 D
1206 D
1207 D
1208 D
1209 D
1210 D
1211 D
1212 D
1213 D
1214 D
1215 D
1216 D
1217 D
1218 D
1219 D
1220 D
1221 D
1222 n@
1223 z@
1224 #@
1226 @
1227 ($$$  a M  D D D n@ $$$ 
1229 $
1230 $ M $ D D D D D D D !D (D :D CD XD iD k!@
1231 %@ @ k$r%$ $  $ $ M 2% D D D D D (D" @D$ HD% SD& \D( `D) kD* qD- |D/ |D0 D5 D9 D: D; D< D= D? D@ D? DC $DF $DG <DK HDO QDP nDQ sDR DV DX D[ D\ D] D` Dc De
1232 Df Dg 'Df ,Dg 2Dh 4Di BDj JDk PDn \Do bDp mDq sDs Dt Du Dv Dx Dy Dz D{ D~ D D D D D D D D D D D D D D ?%@ %@  @ K%- e@. @/ |$@V @W k%@X @~ $v%$ ,  % % D D D D D D D ,D DD MD XD `D xD D D D D D D D D D D D D D D D D #D +D ,D /D 5D 8D CD ID LD WD `D hD pD sD x%@ %@  @ % e@ @ 5px$%$ % D D D D D D D D D D "D #D 'D
1233 (D ,D 2D 6D 9%@ &@ 9$;&$   ? M D D D D D D 'D 3D 8D ;D >D AD ID VD YD aD fD iD! kD" zD% D& D' D( D) D* D+ D$@ @ @ 5& C&@ P& $[&$/ . . ?. M. D/ D1 D/ D1 D2 D3 #D4 /D6 4D: SD; ZD< `D= iD> rD? zD@ n@. D$@. @. @. C&@0 $p&$D DC C aC MC DD DE DD DE DF DH DJ DI #DJ )DK ,DM 0DN 6DO <DR HDQ KDR NDQ XDR [DS dDT lDU DV DW DY DZ n@C @C &@F G $&$_ &^ &^ $^ &^ &^ D_ Da D_ Da Dd De Df ,De 4Dh <Di PDj SDk VDl [Dn _Dm bDn iDo pDq tDr zDt Du Dv Dw Dg Dx Dz D{ D| Dy D| D} D~ D D &@^ !@^ &@` e@d S$&$  ' D D D D D D $D $D 0D TD iD D D D D D D D D D D D n@ @ +'@ !@ $$:'$   ? M D D D 4D CD ZD eD eD hD iD vD {D ~D D D D D D D D D D D D D D D D $D 8D 8D LD TD TD \D D D D D D D D D D D n@ Q' @ / 87@ T$ ['$  D D D D D D D DD SD YD `D cD eD fD lD D D D D D D D %D ,D PD gD D D D D D D D D D D D D D D D D 'D 8D >D uD |D D D D D
1234 D D D D D D D D D D D n@ n' z'@ e@ y#@ e@ y#@ !@ ' !@ '@ 8 $'$  2 D D D D D D! $D" .D# .D$ RD% aD& vD' }D( D) D* D+ D* D+ D, D- D. D/ D0 D2 D3 D4 D5 D4 D5
1235 D7 D8 D9 -D8 0D9 3D8 5D9 7D; =D< CD> KD? \D> zDA DB DC DB DC DB DC DE DF DG DH DI DK DL (DM <DO ?DP GDQ Ln@  @ !@ '@" .'. L$T'$V T'U DV DY DW DY DZ D^ (D_ 2D` 5Db 8DY ;De BDf LDg MDh P'@U &@W %@X U$U'$k 'j Dk Dl
1236 Dm Dn Do &Dp 1Dq <Dr CDv JDw QDx XDy ](@j $b($ ' D D D D D #D 1D 1D :D AD AD JD UD `D kD v(@ n' %(@ 1}$}/($ >( M( D D D D $D 5D @D [D [D fD mD mD D D D D D D D D D D D D D D 3D 3D @D KD KD ]D hD yD D D D D D D D D D D D D
1237 D D 9D DD RD bD eD hD jD nD pD tD D D D D D D D D D D D D D DDDD n' @ d(@ ![y(@ @ (@ 3/ (@ @ (@ e$($t( (  ( DD DDDD!D)D4D?DJDXD!cD"jD#tD%{D&~D'D(D+D*D+D,D.D1D3D4D6D7D8D9D:D;D<D=D>D?DDDD@DA )@ n')3)H)@@U)@1j)@"jj)@3j)@: $v)$G)FdF DGDH DI DJDHDK DL"d@Fd@F$$)$P)ODPDQDRDSDT#DU%)@O)@Q#$')$Y)X)X )XDYD[ D\D^D_*D^/D_1D`7Dc7Da:DbADcHDdXDf`DgnDhtDgyDh|DjDiDhDmDoDqDrDqDrDqDrDsDuDvDwDxDy DxDyDzDy D|'D}2Du2D~7DADCDIDQDXD[D^DbDlDsDsDsDDDDDDDkDDDD)@X*@Z
1238 *f`*q *@r-*@w2ss$6*$)DDDDDD,D,D6D:DH)@*@O*@,O$OY*$o*DDD DDD!y*@$#*$** DDDD DDDD*@*@$*$*DDDDDDDD D"*@+@$$+$42%DDD DDD!D(%@$*+$`2%DDDDDD$D&D(D+D-D1D1D7D>DEDL%@1+@1$Q;+$2%DDD
1239 DDDDDD$D'D)D/D4D7D9D?DADHDODVD]Dd%@1+@k$kO+$ 2% $MDD DDD)D0D8DHDZDbDbDe%@D$@@$mb+$2%8 DD D$D(D=D@DBDE%@!@$Ly+$ 2%8 D D
1240  D D
1244 4F%[F !F6%%%P3Ff3h8(F%88G6s9%`:IF=F%$%cV%+8)%a>%,Kj&5F)%>%-<223F343P3%332F3F333344:F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@36#J-F9J 8m'mFnnzC:,H,-&cL#-&pPL-$h-DD DDDD-D-D4D;DADTDeDhDkDqDxD}DDDD}-@-@e@-@-$-$-DDDD DDDD D'D,D/D2D8D:DADLDRDR}-@e@-@-@R$Y-$-- DDDDD&D+D-D :D#@D'BD(BD'GD(I}-@ .@-@.@B$L$.$@@-?E.? D@DA D@DADB"}-@?P.@?$$[.$Md|.LDMDV DTDVDZD\D] Db$Dc1Dd?DeBDgEDhKDkNDjRDkT.@LP.@N.O.@Pn@QK$W.$zE.y.y DzD DDD D(D/D6D<D?3D4LD3PD4S+DX3D4XD3\D4_+D`3D4a+0DtDw35D5yD5y+5DyD|DDDDDDDDDDDDDDDDDDDDDDDD DDDD!D#D)D,D/D2D6D6D=D@DCDFDHDMDQDXD`DcP.@y.@{.|.}.~y#@-@/+/6c$k9/$(FDDD@$!G/(b dIdLr/dL:<Is1-W2W{// /=F^w%[F !F$%cV%
1245 )%b>%j&5F)%>%-<22/0P0|0!0"0%1&,1([1)1+1,1. 2/122X23|2A4f_4pv444&5 6@6666&7m777]999u::::;4<U<~<<=)=5=6>>D>E>"@`E@ag@YAvxAwAA B,BBBBC7CCCCDE2EF{/GC+GNGpGGG%G/H9<HkHH%H2H8I9DIJUJVJ]K^?KebKfKmKnKuKvL\/BLM7MN>N?N,0OePHPIPQQTQUQRSuSXYYY$Z)TZ4}ZEZRZe[r7[p[[[[$\U\\\\],]J]k]]]]"]+^49^Saaa(/arFaadOdbdxeDeve/fu///a%f*Yf3f>fGfgcglgxh<hhC(/id//Fisst3lF9tbrtj4F%6%%%P3Ff3h8(F%88G6s9%`:t\uIFu/v/%v?v Yv!tvv(vHw/aww5w?xU:xvrxxxy_y&/y9yByMyW,z7]z8z~&'~L~o~~h~~~4Tq!"ۀ2 35i/EG/́-9}3F343P3%332F3F333344:F%:sv<F<T;@3F%P3_AFtAAA6VFs9%%CC(C#F%>C!%wD@36#J-F9J 8̂i܃(3EyKɅS@rއw}kƓDVNsdrQZI9
1247    ɵ D
1249 LD TD iD oDtD{@+@@{$$'X W&& D'D( D)D'D*D)D*D,D*!D,#D0*D--D04D19D6ED8^D9lD:sD<vD>D?DADCDDDFDJDODRDVDX@&@&ʴ()@*Ƿ@+ط@,r-$$eXdd DeDfDkDeDiDnDmDp3Dq5Ds9Dt;@d@d@f;$B$|W{{ D|D DD|D D&D4@{!;$;A$W DD DDD D&D4@Q;$;\$ DD DDDD!D(D/D2D9D@DMDeDhDsDDDDD@@[mr@$$ DDDDDD"D'D*D,D;DYD\DnDuD|DDDDDDDDDD@@e@+̸@@$$ DD DDD#D*@@$,'$DDDDDDD$D*D0D9D9D;@@e@99$?<$<O ]kzDD" DD"D$D%D&D%$D&%D%*D(1D)wD-zD1D-D1D.D1D2D4D543Dr/D8D=D8D=D@DBDDDEDFDHDI"DL$DM*DO?DPJDRM@@e@$iU$U$cbOb bDcDfDmDn+Dq0Dr=DtEDuJ@b$O$ODD DDD%D'D)D0D3D:D=DDDGDPDPDXD`DaDfDmDDDDDDD@@͹e@P$ٹ$DDD
1250 D D)D,D1D1@e@@1$5$ y4DDDD!D'D0D=DCDp@@DP@@e@p$p`$P J8DDDD(D1D8DDDRDXDZDcDwD}DDDDDDDDDD;DBDCDHDLDRDWDYD^DtDuDDDDDDDDD@@e@$dNdPdP:<Is1-W2W53F^w343P3Ff3%[F !F3F3oF14F%6%%%P3h8(F%88G6s9%`:IFVĺۺ&@)&S@.+&u@/Q$KP`JmJ DKDLDKDM$w$QX`PmP DQDRDS@@P$E$W`VmV DWDXDYM@V$R$_`^m^ D_D`Da@@^$E$e<`dmd DeDfDgM@d$Rջ$o`nmn DoDpDq@@n$B$u`tmt DuDvDw@t$EEp` 5$]`[O[ [[g\D]D^D]D^D_Da#Dn4Do9De@DfXDhDiDjDkDlDmDqDrDvDyD{D|@[@[@[$$`O [DD D DDDNDhDmDtDtDtDDDDDDDDDD@@@ѿ@$$`O [DD D D DDDDDD&D(D-D.D8D<DADLDPDUDYD`DfDk@@@%@k$p2$D`O [DDDDDD"D@DDDDDD8DQDXDpDDDDDDD DDD )D *D 3D8D=DADLDQ@@@GQQ$Y_$`O [DD! D D# DD#D"D%$D&&D$,D#3D):D*<D+A@@ѿ@~&02e@A$E$0`.O. [./D0D1D0D1D<D>8D?9DAFDCODDPDFXDG]DH^DJdDKlDMxDNyDPDQDRDSDUDVDWD]@DfTDnDoDqDtDuDvDw@.@.@.$$~`|O| [|}D~DD~DDD<DDDD4D<D]DbDdDlDtDyD}DD@|@|@|$$` `O [DD
1252 O
1253  [
1256  @@@)$|$)` O  [ DDDDD%D@D`D!D"D$D%D&D'D)D*D,D-D/D1D2D4D5D6D:D@xDIDLDMDQ DRDSDTDV DW%Db,Dc1De4Dh5Di=DjBDkG@ @ @ )$O$r4,`pOp [pqDrDsDrDsDuDv<DxDyD|DDD`DhDpDuDyDD@p@p@p$$-`O [DDDDDD<D~DDDD DDDD(D-@@@$5$/` O[DDDDDD$D4DDDDDDDDDD@@@R@$$/`O [DDDDDD(DDD\DtDuDDDDDDDDDD
1258 D D DDDDD@@@ѿ@0@$[$Sl6`QOQ [QtRDSDTDUDT DU
1260 D D$D<D=D@DD@@0@@$I$;`O DDDD D D#D$D(D*@$,&$<;`O [DDD D DDD0DHDODQDTDUDWDeDfDmDpDqDtDx@@@X@$|d$
1261 ;`   ;D
1262 D D
1263  D D
1264 D D D'D3D=DIDPDRDSDUDZD_Da@@ @ (@ f$f5$ <` JeDDD D DD DDD D! D#LD$eD#hD%hD'pD(D'D)D,D-D/D0D1D2D1D2D1D2D4D3D6D8D; D<D=D>!@z@@(@@,&$&&K?&c@A$rH=`op p/qqDrDu DrDuDwDxDyDz D{ D|.D{1D|4D{:D|<D}AD~CDHDNDVDuVDw_DxaDyeDzpDp;@p@qI@qW@t V$ua$=` xDDD D DDD D>@@z@$C&B$>` /DD DDD D5;@@@I@$:&@D$@> DDDDDD$D,D=DDDI(@$K2$->`-- -/--D-@-I-U@-b@-n@-y@- $$.D@`.. .x..D.@.$s$9@`99 9/99D9@9I9U@9b@9n@9y@9 $$:pB`:: :x::D:@:z@:$wU$]B`[O[ [[\BD]D^D]D^D_Dd-Da2Dq@DrHDbRDeTDfDhDiDjDkDlDmDnDoDvDyD{D|@[@[@[$ $C`O [DDDDD%DrDDDDDDDDD-D2D<DADHDKDSDX@@@)$`$TE`O [DD D D DDDDDD4D8D=D@DXD\DaDdD|DDDDDD@@@%@$$$E`O [DDDDDD"D`DDDDDD@D[D`DDDDDDDDDDD D D #D.D0D4D?DD@@ѿ@GQD$L:$@H`O [DD! D D# DD#D"D$$D%1D&3D#7D)AD*CD+H@@ѿ@Z&@He@H$L$0H`.O. [./D0D1D0D1D4D5#D7*D8/D9<D;?D<?D>xD?{DADCDDDFDJDKDGDHDIDMDNDPDQ DR DSDUDVDW(D]`DfDqDtDuDvDw@.@.ѿ@/@4?$$~dJ`|O| [|}D~DD~DDD\DDDD8DyDDDDDDDD@|@|ѿ@}$$L`O [DDDDDD@DBDDDDDDDDD@@@$$L`O [DDDDD D,D@DhDlDDDDDDD@@ѿ@$$M`O [DDDDD%D`DDDDDTDYD`DbDfDsDx@@ѿ@$$ O`
1265 O
1266  [
1272 O
1273  [
1279 $,`m DDD D DD%D,DR@@R$T$`m DDD D DD%D,DR@@R$T1$Ԙ`m DDD
1281 D D DDDDDDDDDD&D-DEDLD\DbDoD wD!D#D$D%D&D'D(D*D+D-D,D.DD01D/4D1:D/<D0BD1HD2JD3TD4^D5hD6rD7|D8D9D:D<D=D>D?@/ @$&O/k&R:k&UCk&XIk3&[PkZ&^Yk$dcDdDpDoDrDqDp3Ds9Dt>@c&e8e@m>$E$@ O[DD DDD D D&D)D+D9DJDDDDDDDDDDD+D3D9D<DADED\D\DdDlDrDzDDDDDDDDDDDD'@t@@3@$C\$,C,DDDD$
1282 $8DDDD$
1283 &P$ D`O [D D!D"$ $'d`%O% [%&D'D(D)$ $,+#+ +D,D-D, D-D.D/D0$D1'D2-D34D4;D5>D6@D7E3@+3@+e@-E$L=$;П`:O: [:D;D@ D;D@D;D>"D@(D>)D@/DA2DB:DD:DC=DDFDF`DGoDHwDI|DJ@:@:S=hH>de@?$t$U\ #L`M ON[OtPQR S$T(DUD_D`+$-ddd:<Is1-W2W53F^w343P3Ff3%[F !F3F3oF14F%6%%%P3h8(F%88G6s9%`:IFVV&k&k&k&k4&kZ&k~&k&k&k&k&k3&kX&k}&k&k& k&!k&"k:&#ka&$l&% l&&l&'l:$W+R9$S ATMUYVDWDX DWDXD](D^.Dc8De>Dg@DlXDm^DodDpjDrtDsf@R@St@T@U@V$${v9$w AxMyYzD{D| D{D|D(D@DFDLDRD\Dnf@v@wt@x@y@z$x$9$ AMYDD D DD,D0D6D@DLf@@$N$9$ AMYDD D DD(D,D2D<DHf@@$J$09$ AMYDDDD!D:D@DDDJDTDjDpDtDDDDf@@@$$9$ AMYDD D DDDD D&D+f@@$- $9$ AMYDD D DDDD D&D+f@@$-$@9$ AMYDD D DD%D+D0D6D @D
1284 Lf@@$N+$ 9$ AMYDD D DDDD D&D+f@ @$-;$#9$ A M!Y"D#D$D#D$'D(4D,OD-UD/\D3wD4}D6D:D;D=DADBDIDKDLDNDOf@G @!@"$Q$9$ AMYDD D DD%D+D0D6D@DLf@@$N`$ 9$ AMYDD D DDDD D&D+f@@$-o$<9$ AMYDDDD!D8DNDTDXDnDtDxD~DDf@@@$~$9$ AMYDD D DDDD D&D+f@@$-$9$ AMYDD D DDDD D&D+f@@$-$@9$ AMYDDD DD0D6D@DRDXD\Dmf@@t@@@$w$9$ AMYDD D DDDD D&D +f@@$-$ 9$  AMYDDDD!D8DNDTDXDnDtD xD!~D#D$f@ @ @$$,'9$( A)M*Y+D,D- D, D-D4D/D1 D2&D5+f@'@($-$=89$9 A:M;Y<D=D> D= D>DED@DB DC&DF+f@8@9$-$NI9$J AKMLYMDNDO DN DODVDQDS DT&DW+f@I@J$-$_Z9$[ A\M]Y^D_D`D_D`!Dd(De>DfDDhHDi^DjdDnhDozf@Z@[\]@^$ $wr9$s AtMuYvDwDx Dw DxDDzD| D}&D+f@r@s$-$Ш9$ AMYDD D DDDD D&D+f@@$-+$9$ AMYDD D DD(D,D2D<DBDLDXf@@$Z<$\9$ AMYDD D DD(D,D2D<DHf@@$JL$9$ AMYDD D DD,D2D8D>DHDTf@@$V\$9$ AMYDDDD%D@D@DDDZD`D`DtD}DDDDDDlG@@y&le@@`$$9$ AMYDD D DD(D,D2D<DHf@@$J$ 9$  A MYDD D DD%D+D0D6D8DDf@ @ $F$$P9$  A!M"Y#D$D% D$ D%D,D)D*"D-$f@@ $&$6x19$2 A3M4Y5D6D7 D6 D7D>D9D; D<&D?+f@1@2$-$GB9$C ADMEYFDGDH DG DHDL%DM+DO0DP6DR8DSDf@B@C$F$\W9$X AYMZY[D\D]D\D]!DaDDe[DfdDhlDlDmDoDsDtDxDyD{D|lWGXt@Y@Z@[$$ج9$ AMYDD D DDDD D&D+f@@$- $9$ AMYDD D DD(D,D2D<DHf@@$J$T9$ AMYDDDD!D8D<DRDXD`DvD|DDDDDf@@@$,$9$ AMYDD DDD,D4DIDODXD_DeDlDrD|DDDDDDDf@@t@@@$<$Ю9$ AMYDD D DD*D0D8D>DDDPf@@$RL$$9$ AMYDD D DD(D,D2D <D
1285 Hf@@$J\$p 9$ AMYDD D DD%D+D4D:D@DLf@ @$Nl$&!9$" A#M$Y%D&D' D&D'D)D+ D,#D/,D02D2<D3BD5LD6RD8\D9bD;lD<xf@!@"$z|$D<?9$@ AAMBYCDDDE DDDEDG DI(DJ,DI.DJ1DK3DL9DN@DODDNFDOIDPKDQQDSXDT\DS^DTaDUcDViDXpDYtDXvDYyDZ{D[D]D^D`DaDcDdf@?@@$$9$ AMYDD D DDDD"D$f@@$&$9$ AMYDDDD$$$9$ DDD Df@$$8DDD f@$dFinit.c/usr/src/build/133731-i386/BUILD/glibc-2.2.5/csu/gcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,5);0000000000000;0037777777777;long long int:t(0,6)=@s64;r(0,6);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=@s64;r(0,7);0000000000000;01777777777777777777777;short int:t(0,8)=@s16;r(0,8);-32768;32767;short unsigned int:t(0,9)=@s16;r(0,9);0;65535;signed char:t(0,10)=@s8;r(0,10);-128;127;unsigned char:t(0,11)=@s8;r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);8;0;complex double:t(0,17)=r(0,17);16;0;complex long double:t(0,18)=r(0,18);24;0;__builtin_va_list:t(0,19)=*(0,20)=(0,20)../include/libc-symbols.h/usr/src/build/133731-i386/BUILD/glibc-2.2.5/build-i386-linux/config.h../sysdeps/gnu/_G_config.h../sysdeps/unix/sysv/linux/bits/types.h../include/features.h../include/sys/cdefs.h../misc/sys/cdefs.h/usr/lib/gcc-lib/i386-redhat-linux/2.96/include/stddef.hsize_t:t(8,1)=(0,4)__u_char:t(4,1)=(0,11)__u_short:t(4,2)=(0,9)__u_int:t(4,3)=(0,4)__u_long:t(4,4)=(0,5)__u_quad_t:t(4,5)=(0,7)__quad_t:t(4,6)=(0,6)__int8_t:t(4,7)=(0,10)__uint8_t:t(4,8)=(0,11)__int16_t:t(4,9)=(0,8)__uint16_t:t(4,10)=(0,9)__int32_t:t(4,11)=(0,1)__uint32_t:t(4,12)=(0,4)__int64_t:t(4,13)=(0,6)__uint64_t:t(4,14)=(0,7)__qaddr_t:t(4,15)=(4,16)=*(4,6)__dev_t:t(4,17)=(4,5)__uid_t:t(4,18)=(4,3)__gid_t:t(4,19)=(4,3)__ino_t:t(4,20)=(4,4)__mode_t:t(4,21)=(4,3)__nlink_t:t(4,22)=(4,3)__off_t:t(4,23)=(0,3)__loff_t:t(4,24)=(4,6)__pid_t:t(4,25)=(0,1)__ssize_t:t(4,26)=(0,1)__rlim_t:t(4,27)=(4,4)__rlim64_t:t(4,28)=(4,5)__id_t:t(4,29)=(4,3)__fsid_t:t(4,30)=(4,31)=s8__val:(4,32)=ar(4,33)=r(4,33);0000000000000;0037777777777;;0;1;(0,1),0,64;;__daddr_t:t(4,34)=(0,1)__caddr_t:t(4,35)=(4,36)=*(0,2)__time_t:t(4,37)=(0,3)__useconds_t:t(4,38)=(0,4)__suseconds_t:t(4,39)=(0,3)__swblk_t:t(4,40)=(0,3)__clock_t:t(4,41)=(0,3)__clockid_t:t(4,42)=(0,1)__timer_t:t(4,43)=(0,1)__key_t:t(4,44)=(0,1)__ipc_pid_t:t(4,45)=(0,9)__blksize_t:t(4,46)=(0,3)__blkcnt_t:t(4,47)=(0,3)__blkcnt64_t:t(4,48)=(4,6)__fsblkcnt_t:t(4,49)=(4,4)__fsblkcnt64_t:t(4,50)=(4,5)__fsfilcnt_t:t(4,51)=(4,4)__fsfilcnt64_t:t(4,52)=(4,5)__ino64_t:t(4,53)=(4,5)__off64_t:t(4,54)=(4,24)__t_scalar_t:t(4,55)=(0,3)__t_uscalar_t:t(4,56)=(0,5)__intptr_t:t(4,57)=(0,1)__socklen_t:t(4,58)=(0,4)../linuxthreads/sysdeps/pthread/bits/pthreadtypes.h../sysdeps/unix/sysv/linux/bits/sched.h__sched_param:T(10,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(9,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(9,2)=(9,3)=*(9,4)=xs_pthread_descr_struct:__pthread_attr_s:T(9,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(10,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(8,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(0,19),224,32;__stacksize:(8,1),256,32;;pthread_attr_t:t(9,6)=(9,5)pthread_cond_t:t(9,7)=(9,8)=s12__c_lock:(9,1),0,64;__c_waiting:(9,2),64,32;;pthread_condattr_t:t(9,9)=(9,10)=s4__dummy:(0,1),0,32;;pthread_key_t:t(9,11)=(0,4)pthread_mutex_t:t(9,12)=(9,13)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(9,2),64,32;__m_kind:(0,1),96,32;__m_lock:(9,1),128,64;;pthread_mutexattr_t:t(9,14)=(9,15)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(9,16)=(0,1)_pthread_rwlock_t:T(9,17)=s32__rw_lock:(9,1),0,64;__rw_readers:(0,1),64,32;__rw_writer:(9,2),96,32;__rw_read_waiting:(9,2),128,32;__rw_write_waiting:(9,2),160,32;__rw_kind:(0,1),192,32;__rw_pshared:(0,1),224,32;;pthread_rwlock_t:t(9,18)=(9,17)pthread_rwlockattr_t:t(9,19)=(9,20)=s8__lockkind:(0,1),0,32;__pshared:(0,1),32,32;;pthread_spinlock_t:t(9,21)=(0,1)pthread_barrier_t:t(9,22)=(9,23)=s20__ba_lock:(9,1),0,64;__ba_required:(0,1),64,32;__ba_present:(0,1),96,32;__ba_waiting:(9,2),128,32;;pthread_barrierattr_t:t(9,24)=(9,25)=s4__pshared:(0,1),0,32;;pthread_t:t(9,26)=(0,5)wchar_t:t(11,1)=(0,3)wint_t:t(11,2)=(0,4)../include/wchar.h../wcsmbs/wchar.h../sysdeps/unix/sysv/linux/i386/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(11,2),0,32;__wchb:(13,4)=ar(4,33);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(3,1)=(3,2)=s12__pos:(4,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(3,3)=(3,4)=s16__pos:(4,54),0,64;__state:(13,1),64,64;;../include/gconv.h../iconv/gconv.h :T(17,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(17,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(17,3)=(17,4)=*(17,5)=f(0,1)__gconv_init_fct:t(17,6)=(17,7)=*(17,8)=f(0,1)__gconv_end_fct:t(17,9)=(17,10)=*(17,11)=f(0,20)__gconv_trans_fct:t(17,12)=(17,13)=*(17,14)=f(0,1)__gconv_trans_context_fct:t(17,15)=(17,16)=*(17,17)=f(0,1)__gconv_trans_query_fct:t(17,18)=(17,19)=*(17,20)=f(0,1)__gconv_trans_init_fct:t(17,21)=(17,22)=*(17,23)=f(0,1)__gconv_trans_end_fct:t(17,24)=(17,25)=*(17,26)=f(0,20)__gconv_trans_data:T(17,27)=s20__trans_fct:(17,12),0,32;__trans_context_fct:(17,15),32,32;__trans_end_fct:(17,24),64,32;__data:(0,19),96,32;__next:(17,28)=*(17,27),128,32;;__gconv_step:T(17,29)=s56__shlib_handle:(17,30)=*(17,31)=xs__gconv_loaded_object:,0,32;__modname:(17,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(4,36),96,32;__to_name:(4,36),128,32;__fct:(17,3),160,32;__init_fct:(17,6),192,32;__end_fct:(17,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(0,19),416,32;;__gconv_step_data:T(17,33)=s36__outbuf:(17,34)=*(0,11),0,32;__outbufend:(17,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(17,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(17,28),256,32;;__gconv_info:T(17,36)=s8__nsteps:(8,1),0,32;__steps:(17,37)=*(17,29),32,32;__data:(17,38)=ar(4,33);0;-1;(17,33),64,0;;__gconv_t:t(17,39)=(17,40)=*(17,36)_G_iconv_t:t(3,5)=(3,6)=u44__cd:(17,36),0,64;__combined:(3,7)=s44__cd:(17,36),0,64;__data:(17,33),64,288;;,0,352;;_G_int16_t:t(3,8)=(0,8)_G_int32_t:t(3,9)=(0,1)_G_uint16_t:t(3,10)=(0,9)_G_uint32_t:t(3,11)=(0,4)_IO_stdin_used:G(0,1)/u/httpd/html/devel/buildweb/pkg/swish-e/src/swish.c/usr/lib/gcc-lib/i386-redhat-linux/2.96/include/limits.h/usr/lib/gcc-lib/i386-redhat-linux/2.96/include/syslimits.h/usr/include/limits.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/include/linux/limits.h/usr/include/bits/posix2_lim.hswish.h/usr/include/stdio.h/usr/include/bits/types.h__u_char:t(16,1)=(0,11)__u_short:t(16,2)=(0,9)__u_int:t(16,3)=(0,4)__u_long:t(16,4)=(0,5)__u_quad_t:t(16,5)=(0,7)__quad_t:t(16,6)=(0,6)__int8_t:t(16,7)=(0,10)__uint8_t:t(16,8)=(0,11)__int16_t:t(16,9)=(0,8)__uint16_t:t(16,10)=(0,9)__int32_t:t(16,11)=(0,1)__uint32_t:t(16,12)=(0,4)__int64_t:t(16,13)=(0,6)__uint64_t:t(16,14)=(0,7)__qaddr_t:t(16,15)=(16,16)=*(16,6)__dev_t:t(16,17)=(16,5)__uid_t:t(16,18)=(16,3)__gid_t:t(16,19)=(16,3)__ino_t:t(16,20)=(16,4)__mode_t:t(16,21)=(16,3)__nlink_t:t(16,22)=(16,3)__off_t:t(16,23)=(0,3)__loff_t:t(16,24)=(16,6)__pid_t:t(16,25)=(0,1)__ssize_t:t(16,26)=(0,1)__rlim_t:t(16,27)=(16,4)__rlim64_t:t(16,28)=(16,5)__id_t:t(16,29)=(16,3)__fsid_t:t(16,30)=(16,31)=s8__val:(16,32)=ar(16,33)=r(16,33);0000000000000;0037777777777;;0;1;(0,1),0,64;;__daddr_t:t(16,34)=(0,1)__caddr_t:t(16,35)=(16,36)=*(0,2)__time_t:t(16,37)=(0,3)__useconds_t:t(16,38)=(0,4)__suseconds_t:t(16,39)=(0,3)__swblk_t:t(16,40)=(0,3)__clock_t:t(16,41)=(0,3)__clockid_t:t(16,42)=(0,1)__timer_t:t(16,43)=(0,1)__key_t:t(16,44)=(0,1)__ipc_pid_t:t(16,45)=(0,9)__blksize_t:t(16,46)=(0,3)__blkcnt_t:t(16,47)=(0,3)__blkcnt64_t:t(16,48)=(16,6)__fsblkcnt_t:t(16,49)=(16,4)__fsblkcnt64_t:t(16,50)=(16,5)__fsfilcnt_t:t(16,51)=(16,4)__fsfilcnt64_t:t(16,52)=(16,5)__ino64_t:t(16,53)=(16,5)__off64_t:t(16,54)=(16,24)__t_scalar_t:t(16,55)=(0,3)__t_uscalar_t:t(16,56)=(0,5)__intptr_t:t(16,57)=(0,1)__socklen_t:t(16,58)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(20,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(19,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(19,2)=(19,3)=*(19,4)=xs_pthread_descr_struct:__pthread_attr_s:T(19,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(20,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(15,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(0,19),224,32;__stacksize:(15,1),256,32;;pthread_attr_t:t(19,6)=(19,5)pthread_cond_t:t(19,7)=(19,8)=s12__c_lock:(19,1),0,64;__c_waiting:(19,2),64,32;;pthread_condattr_t:t(19,9)=(19,10)=s4__dummy:(0,1),0,32;;pthread_key_t:t(19,11)=(0,4)pthread_mutex_t:t(19,12)=(19,13)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(19,2),64,32;__m_kind:(0,1),96,32;__m_lock:(19,1),128,64;;pthread_mutexattr_t:t(19,14)=(19,15)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(19,16)=(0,1)pthread_t:t(19,17)=(0,5)FILE:t(13,1)=(13,2)=xs_IO_FILE:__FILE:t(13,3)=(13,2)/usr/include/libio.h/usr/include/_G_config.h/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(25,1)=(25,2)=s8__count:(0,1),0,32;__value:(25,3)=u4__wch:(24,2),0,32;__wchb:(25,4)=ar(16,33);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(22,1)=(22,2)=s12__pos:(16,23),0,32;__state:(25,1),32,64;;_G_fpos64_t:t(22,3)=(22,4)=s16__pos:(16,54),0,64;__state:(25,1),64,64;;/usr/include/gconv.h :T(28,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(28,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(28,3)=(28,4)=*(28,5)=f(0,1)__gconv_init_fct:t(28,6)=(28,7)=*(28,8)=f(0,1)__gconv_end_fct:t(28,9)=(28,10)=*(28,11)=f(0,20)__gconv_trans_fct:t(28,12)=(28,13)=*(28,14)=f(0,1)__gconv_trans_context_fct:t(28,15)=(28,16)=*(28,17)=f(0,1)__gconv_trans_query_fct:t(28,18)=(28,19)=*(28,20)=f(0,1)__gconv_trans_init_fct:t(28,21)=(28,22)=*(28,23)=f(0,1)__gconv_trans_end_fct:t(28,24)=(28,25)=*(28,26)=f(0,20)__gconv_trans_data:T(28,27)=s20__trans_fct:(28,12),0,32;__trans_context_fct:(28,15),32,32;__trans_end_fct:(28,24),64,32;__data:(0,19),96,32;__next:(28,28)=*(28,27),128,32;;__gconv_step:T(28,29)=s56__shlib_handle:(28,30)=*(28,31)=xs__gconv_loaded_object:,0,32;__modname:(28,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(16,36),96,32;__to_name:(16,36),128,32;__fct:(28,3),160,32;__init_fct:(28,6),192,32;__end_fct:(28,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(0,19),416,32;;__gconv_step_data:T(28,33)=s36__outbuf:(28,34)=*(0,11),0,32;__outbufend:(28,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(28,35)=*(25,1),160,32;__state:(25,1),192,64;__trans:(28,28),256,32;;__gconv_info:T(28,36)=s8__nsteps:(15,1),0,32;__steps:(28,37)=*(28,29),32,32;__data:(28,38)=ar(16,33);0;-1;(28,33),64,0;;__gconv_t:t(28,39)=(28,40)=*(28,36)_G_iconv_t:t(22,5)=(22,6)=u44__cd:(28,36),0,64;__combined:(22,7)=s44__cd:(28,36),0,64;__data:(28,33),64,288;;,0,352;;_G_int16_t:t(22,8)=(0,8)_G_int32_t:t(22,9)=(0,1)_G_uint16_t:t(22,10)=(0,9)_G_uint32_t:t(22,11)=(0,4)/usr/lib/gcc-lib/i386-redhat-linux/2.96/include/stdarg.h__gnuc_va_list:t(34,1)=(0,19)_IO_lock_t:t(21,1)=(0,20)_IO_marker:T(21,2)=s12_next:(21,3)=*(21,2),0,32;_sbuf:(21,4)=*(13,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(21,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(13,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(16,36),32,32;_IO_read_end:(16,36),64,32;_IO_read_base:(16,36),96,32;_IO_write_base:(16,36),128,32;_IO_write_ptr:(16,36),160,32;_IO_write_end:(16,36),192,32;_IO_buf_base:(16,36),224,32;_IO_buf_end:(16,36),256,32;_IO_save_base:(16,36),288,32;_IO_backup_base:(16,36),320,32;_IO_save_end:(16,36),352,32;_markers:(21,3),384,32;_chain:(21,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(16,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(21,6)=ar(16,33);0;0;(0,2),568,8;_lock:(21,7)=*(21,1),576,32;_offset:(16,54),608,64;__pad1:(0,19),672,32;__pad2:(0,19),704,32;_mode:(0,1),736,32;_unused2:(21,8)=ar(16,33);0;51;(0,2),768,416;;_IO_FILE:t(21,9)=(13,2)__io_read_fn:t(21,10)=(21,11)=f(16,26)__io_write_fn:t(21,12)=(21,13)=f(16,26)__io_seek_fn:t(21,14)=(21,15)=f(0,1)__io_close_fn:t(21,16)=(21,17)=f(0,1)fpos_t:t(13,4)=(22,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/endian.h/usr/include/bits/endian.h/usr/include/stdlib.h/usr/include/math.h/usr/include/bits/huge_val.h/usr/include/bits/mathdef.h/usr/include/bits/mathcalls.h :T(49,1)=e_IEEE_:-1,_SVID_:0,_XOPEN_:1,_POSIX_:2,_ISOC_:3,;_LIB_VERSION_TYPE:t(49,2)=(49,1)exception:T(49,3)=s32type:(0,1),0,32;name:(16,36),32,32;arg1:(0,13),64,64;arg2:(0,13),128,64;retval:(0,13),192,64;;/usr/include/bits/mathinline.h/usr/include/sys/types.hu_char:t(58,1)=(16,1)u_short:t(58,2)=(16,2)u_int:t(58,3)=(16,3)u_long:t(58,4)=(16,4)quad_t:t(58,5)=(16,6)u_quad_t:t(58,6)=(16,5)fsid_t:t(58,7)=(16,30)loff_t:t(58,8)=(16,24)ino_t:t(58,9)=(16,20)dev_t:t(58,10)=(16,17)gid_t:t(58,11)=(16,19)mode_t:t(58,12)=(16,21)nlink_t:t(58,13)=(16,22)uid_t:t(58,14)=(16,18)off_t:t(58,15)=(16,23)pid_t:t(58,16)=(16,25)id_t:t(58,17)=(16,29)ssize_t:t(58,18)=(16,26)daddr_t:t(58,19)=(16,34)caddr_t:t(58,20)=(16,35)key_t:t(58,21)=(16,44)/usr/include/time.htime_t:t(61,1)=(16,37)clockid_t:t(61,2)=(16,42)timer_t:t(61,3)=(16,43)ulong:t(58,22)=(0,5)ushort:t(58,23)=(0,9)uint:t(58,24)=(0,4)int8_t:t(58,25)=(0,10)int16_t:t(58,26)=(0,8)int32_t:t(58,27)=(0,1)int64_t:t(58,28)=(0,6)u_int8_t:t(58,29)=(0,11)u_int16_t:t(58,30)=(0,9)u_int32_t:t(58,31)=(0,4)u_int64_t:t(58,32)=(0,7)register_t:t(58,33)=(0,1)/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(71,1)=(0,1)__sigset_t:t(71,2)=(71,3)=s128__val:(71,4)=ar(16,33);0;31;(0,5),0,1024;;sigset_t:t(67,1)=(71,2)timespec:T(72,1)=s8tv_sec:(16,37),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(73,1)=s8tv_sec:(16,37),0,32;tv_usec:(16,39),32,32;;suseconds_t:t(67,2)=(16,39)__fd_mask:t(67,3)=(0,3)fd_set:t(67,4)=(67,5)=s128__fds_bits:(67,6)=ar(16,33);0;31;(67,3),0,1024;;fd_mask:t(67,7)=(67,3)/usr/include/sys/sysmacros.hblkcnt_t:t(58,34)=(16,47)fsblkcnt_t:t(58,35)=(16,49)fsfilcnt_t:t(58,36)=(16,51)/usr/include/sys/stat.h/usr/include/bits/stat.hstat:T(79,1)=s88st_dev:(16,17),0,64;__pad1:(0,9),64,16;st_ino:(16,20),96,32;st_mode:(16,21),128,32;st_nlink:(16,22),160,32;st_uid:(16,18),192,32;st_gid:(16,19),224,32;st_rdev:(16,17),256,64;__pad2:(0,9),320,16;st_size:(16,23),352,32;st_blksize:(16,46),384,32;st_blocks:(16,47),416,32;st_atime:(16,37),448,32;__unused1:(0,5),480,32;st_mtime:(16,37),512,32;__unused2:(0,5),544,32;st_ctime:(16,37),576,32;__unused3:(0,5),608,32;__unused4:(0,5),640,32;__unused5:(0,5),672,32;;/usr/include/locale.h/usr/include/bits/locale.h :T(83,1)=e__LC_CTYPE:0,__LC_NUMERIC:1,__LC_TIME:2,__LC_COLLATE:3,__LC_MONETARY:4,__LC_MESSAGES:5,__LC_ALL:6,__LC_PAPER:7,__LC_NAME:8,__LC_ADDRESS:9,__LC_TELEPHONE:10,__LC_MEASUREMENT:11,__LC_IDENTIFICATION:12,;lconv:T(80,1)=s56decimal_point:(16,36),0,32;thousands_sep:(16,36),32,32;grouping:(16,36),64,32;int_curr_symbol:(16,36),96,32;currency_symbol:(16,36),128,32;mon_decimal_point:(16,36),160,32;mon_thousands_sep:(16,36),192,32;mon_grouping:(16,36),224,32;positive_sign:(16,36),256,32;negative_sign:(16,36),288,32;int_frac_digits:(0,2),320,8;frac_digits:(0,2),328,8;p_cs_precedes:(0,2),336,8;p_sep_by_space:(0,2),344,8;n_cs_precedes:(0,2),352,8;n_sep_by_space:(0,2),360,8;p_sign_posn:(0,2),368,8;n_sign_posn:(0,2),376,8;__int_p_cs_precedes:(0,2),384,8;__int_p_sep_by_space:(0,2),392,8;__int_n_cs_precedes:(0,2),400,8;__int_n_sep_by_space:(0,2),408,8;__int_p_sign_posn:(0,2),416,8;__int_n_sign_posn:(0,2),424,8;;/usr/include/ctype.h :T(84,1)=e_ISupper:256,_ISlower:512,_ISalpha:1024,_ISdigit:2048,_ISxdigit:4096,_ISspace:8192,_ISprint:16384,_ISgraph:32768,_ISblank:1,_IScntrl:2,_ISpunct:4,_ISalnum:8,;/usr/include/errno.h/usr/include/bits/errno.h/usr/include/linux/errno.h/usr/include/asm/errno.hclock_t:t(93,1)=(16,41)tm:T(93,2)=s44tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;tm_gmtoff:(0,3),288,32;tm_zone:(28,32),320,32;;itimerspec:T(93,3)=s16it_interval:(72,1),0,64;it_value:(72,1),64,64;;acconfig.hconfig.h/usr/include/dirent.h/usr/include/bits/dirent.hdirent:T(104,1)=s268d_ino:(16,20),0,32;d_off:(16,23),32,32;d_reclen:(0,9),64,16;d_type:(0,11),80,8;d_name:(104,2)=ar(16,33);0;255;(0,2),88,2048;; :T(101,1)=eDT_UNKNOWN:0,DT_FIFO:1,DT_CHR:2,DT_DIR:4,DT_BLK:6,DT_REG:8,DT_LNK:10,DT_SOCK:12,DT_WHT:14,;DIR:t(101,2)=(101,3)=xs__dirstream:/usr/include/regex.hs_reg_t:t(108,1)=(0,3)active_reg_t:t(108,2)=(0,5)reg_syntax_t:t(108,3)=(0,5) :T(108,4)=eREG_NOERROR:0,REG_NOMATCH:1,REG_BADPAT:2,REG_ECOLLATE:3,REG_ECTYPE:4,REG_EESCAPE:5,REG_ESUBREG:6,REG_EBRACK:7,REG_EPAREN:8,REG_EBRACE:9,REG_BADBR:10,REG_ERANGE:11,REG_ESPACE:12,REG_BADRPT:13,REG_EEND:14,REG_ESIZE:15,REG_ERPAREN:16,;reg_errcode_t:t(108,5)=(108,4)re_pattern_buffer:T(108,6)=s32buffer:(28,34),0,32;allocated:(0,5),32,32;used:(0,5),64,32;syntax:(108,3),96,32;fastmap:(16,36),128,32;translate:(16,36),160,32;re_nsub:(15,1),192,32;can_be_null:(0,4),224,1;regs_allocated:(0,4),225,2;fastmap_accurate:(0,4),227,1;no_sub:(0,4),228,1;not_bol:(0,4),229,1;not_eol:(0,4),230,1;newline_anchor:(0,4),231,1;;regex_t:t(108,7)=(108,6)regoff_t:t(108,8)=(0,1)re_registers:T(108,9)=s12num_regs:(0,4),0,32;start:(108,10)=*(108,8),32,32;end:(108,10),64,32;;regmatch_t:t(108,11)=(108,12)=s8rm_so:(108,8),0,32;rm_eo:(108,8),32,32;;div_t:t(110,1)=(110,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(110,3)=(110,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;random_data:T(110,5)=s28fptr:(110,6)=*(58,27),0,32;rptr:(110,6),32,32;state:(110,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(110,6),192,32;;drand48_data:T(110,7)=s24__x:(110,8)=ar(16,33);0;2;(0,9),0,48;__old_x:(110,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(110,9)=(110,10)=*(110,11)=f(0,1)/usr/include/setjmp.h/usr/include/bits/setjmp.h__jmp_buf:t(120,1)=(120,2)=ar(16,33);0;5;(0,1)__jmp_buf_tag:T(118,1)=s156__jmpbuf:(120,1),0,192;__mask_was_saved:(0,1),192,32;__saved_mask:(71,2),224,1024;;jmp_buf:t(118,2)=(118,3)=ar(16,33);0;0;(118,1)sigjmp_buf:t(118,4)=(118,2) :T(12,1)=eBASEDOCTYPE:0,TXT:1,HTML:2,XML:3,WML:4,XML2:5,HTML2:6,TXT2:7,;propEntry:T(12,2)=s8propLen:(0,4),0,32;propValue:(12,3)=ar(16,33);0;0;(0,11),32,8;;propEntry:t(12,4)=(12,2)docProperties:T(12,5)=s8n:(0,1),0,32;propEntry:(12,6)=ar(16,33);0;0;(12,7)=*(12,2),32,32;;docProperties:t(12,8)=(12,5)metaEntry:T(12,9)=s48metaName:(16,36),0,32;metaID:(0,1),32,32;metaType:(0,1),64,32;inPropRange:(12,10)=*(0,1),96,32;in_tag:(0,1),128,32;max_len:(0,1),160,32;extractpath_default:(16,36),192,32;loPropRange:(12,11)=*(12,4),224,32;hiPropRange:(12,11),256,32;alias:(0,1),288,32;rank_bias:(0,1),320,32;sorted_data:(12,10),352,32;;PROP_LOCATION:t(12,12)=(12,13)=s8length:(0,3),0,32;seek:(0,3),32,32;;PROP_INDEX:t(12,14)=(12,15)=s8prop_position:(12,16)=ar(16,33);0;0;(12,12),0,64;;FileRec:t(12,17)=(12,18)=s12filenum:(0,1),0,32;docProperties:(12,19)=*(12,8),32,32;prop_index:(12,20)=*(12,14),64,32;;FileProp:t(12,21)=(12,22)=s56fp:(12,23)=*(13,1),0,32;real_path:(16,36),32,32;orig_path:(16,36),64,32;work_path:(16,36),96,32;real_filename:(16,36),128,32;fsize:(0,3),160,32;bytes_read:(0,3),192,32;done:(0,1),224,32;external_program:(0,1),256,32;mtime:(61,1),288,32;doctype:(0,1),320,32;index_no_content:(0,1),352,32;stordesc:(12,24)=*(12,25)=xsStoreDescription:,384,32;hasfilter:(12,26)=*(12,27)=xsFilterList:,416,32;;LOCATION:T(12,28)=s20next:(12,29)=*(12,28),0,32;metaID:(0,1),32,32;filenum:(0,1),64,32;frequency:(0,1),96,32;posdata:(12,30)=ar(16,33);0;0;(0,1),128,32;;LOCATION:t(12,31)=(12,28)ENTRY:T(12,32)=s32next:(12,33)=*(12,32),0,32;tfrequency:(0,1),32,32;currentChunkLocationList:(12,34)=*(12,31),64,32;currentlocation:(12,34),96,32;allLocationList:(12,34),128,32;u1:(12,35)=s8wordID:(0,3),0,32;last_filenum:(0,1),32,32;;,160,64;word:(21,6),224,8;;ENTRY:t(12,36)=(12,32)swline:T(12,37)=s12next:(12,38)=*(12,37),0,32;nodep:(12,38),32,32;line:(16,36),64,32;; :T(12,39)=eFUZZY_NONE:0,FUZZY_STEMMING:1,FUZZY_SOUNDEX:2,FUZZY_METAPHONE:3,FUZZY_DOUBLE_METAPHONE:4,;FuzzyIndexType:t(12,40)=(12,39)INDEXDATAHEADER:t(12,41)=(12,42)=s20480lenwordchars:(0,1),0,32;wordchars:(16,36),32,32;lenbeginchars:(0,1),64,32;beginchars:(16,36),96,32;lenendchars:(0,1),128,32;endchars:(16,36),160,32;lenignorelastchar:(0,1),192,32;ignorelastchar:(16,36),224,32;lenignorefirstchar:(0,1),256,32;ignorefirstchar:(16,36),288,32;lenbumpposchars:(0,1),320,32;bumpposchars:(16,36),352,32;savedasheader:(16,36),384,32;lensavedasheader:(0,1),416,32;lennumberchars:(0,1),448,32;numberchars:(16,36),480,32;numberchars_used_flag:(0,1),512,32;lenindexedon:(0,1),544,32;indexedon:(16,36),576,32;lenindexn:(0,1),608,32;indexn:(16,36),640,32;lenindexd:(0,1),672,32;indexd:(16,36),704,32;lenindexp:(0,1),736,32;indexp:(16,36),768,32;lenindexa:(0,1),800,32;indexa:(16,36),832,32;minwordlimit:(0,1),864,32;maxwordlimit:(0,1),896,32;fuzzy_mode:(12,40),928,32;totalwords:(0,1),960,32;totalfiles:(0,1),992,32;ignoreTotalWordCountWhenRanking:(0,1),1024,32;TotalWordsPerFile:(12,10),1056,32;TotalWordsPerFileMax:(0,1),1088,32;wordcharslookuptable:(12,43)=ar(16,33);0;255;(0,1),1120,8192;begincharslookuptable:(12,43),9312,8192;endcharslookuptable:(12,43),17504,8192;ignorefirstcharlookuptable:(12,43),25696,8192;ignorelastcharlookuptable:(12,43),33888,8192;bumpposcharslookuptable:(12,43),42080,8192;translatecharslookuptable:(12,43),50272,8192;numbercharslookuptable:(12,43),58464,8192;hashstoplist:(12,44)=ar(16,33);0;1008;(12,38),66656,32288;stopList:(12,45)=*(16,36),98944,32;stopMaxSize:(0,1),98976,32;stopPos:(0,1),99008,32;propIDX_to_metaID:(12,10),99040,32;metaID_to_PropIDX:(12,10),99072,32;property_count:(0,1),99104,32;buzzwords_used_flag:(0,1),99136,32;hashbuzzwordlist:(12,44),99168,32288;is_use_words_flag:(0,1),131456,32;hashuselist:(12,44),131488,32288;metaEntryArray:(12,46)=*(12,47)=*(12,9),163776,32;metaCounter:(0,1),163808,32;;IndexFILE:T(12,48)=s21572next:(12,49)=*(12,48),0,32;nodep:(12,49),32,32;line:(16,36),64,32;total_bytes:(0,5),96,32;total_word_positions:(0,5),128,32;prop_string_cache:(12,45),160,32;DB:(0,19),192,32;header:(12,41),224,163840;keywords:(12,50)=ar(16,33);0;255;(16,36),164064,8192;propIDToDisplay:(12,10),172256,32;propIDToSort:(12,10),172288,32;meta_map:(12,10),172320,32;path_order:(12,10),172352,32;current_file:(0,1),172384,32;path_meta:(12,47),172416,32;modified_meta:(12,47),172448,32;cur_prop:(12,11),172480,32;filenum:(0,1),172512,32;merge_file_num_map:(12,10),172544,32;;IndexFILE:t(12,51)=(12,48)RESULT_LIST:T(12,52)=s12head:(12,53)=*(12,54)=xsRESULT:,0,32;tail:(12,53),32,32;sw:(12,55)=*(12,56)=xsSWISH:,64,32;;RESULT_LIST:t(12,57)=(12,52)RESULT:T(12,54)=s56next:(12,53),0,32;count:(0,1),32,32;filenum:(0,1),64,32;fi:(12,17),96,96;rank:(0,1),192,32;frequency:(0,1),224,32;tfrequency:(0,1),256,32;PropSort:(12,45),288,32;iPropSort:(12,10),320,32;indexf:(12,58)=*(12,51),352,32;reslist:(12,59)=*(12,57),384,32;posdata:(12,30),416,32;;RESULT:t(12,60)=(12,54)multiswline:T(12,61)=s8next:(12,62)=*(12,61),0,32;list:(12,38),32,32;;ENTRYARRAY:t(12,63)=(12,64)=s8numWords:(0,1),0,32;elist:(12,65)=*(12,66)=*(12,36),32,32;;url_info:T(12,67)=s8next:(12,68)=*(12,67),0,32;url:(16,36),32,32;;IndexContents:T(12,69)=s12next:(12,70)=*(12,69),0,32;DocType:(0,1),32,32;patt:(12,38),64,32;;StoreDescription:T(12,25)=s16next:(12,24),0,32;DocType:(0,1),32,32;field:(16,36),64,32;size:(0,1),96,32;;int_st:T(12,71)=s12next:(12,72)=*(12,71),0,32;index:(0,1),32,32;val:(12,30),64,32;;int_lookup_st:T(12,73)=s4044n_entries:(0,1),0,32;hash_entries:(12,74)=ar(16,33);0;1008;(12,72),32,32288;all_entries:(12,75)=ar(16,33);0;0;(12,72),32320,32;;char_st:T(12,76)=s12next:(12,77)=*(12,76),0,32;index:(0,1),32,32;val:(16,36),64,32;;char_lookup_st:T(12,78)=s4044n_entries:(0,1),0,32;hash_entries:(12,79)=ar(16,33);0;1008;(12,77),32,32288;all_entries:(12,80)=ar(16,33);0;0;(12,77),32320,32;;regex_list:T(12,81)=s60next:(12,82)=*(12,81),0,32;re:(108,7),32,256;replace:(16,36),288,32;replace_count:(0,1),320,32;replace_length:(0,1),352,32;global:(0,1),384,32;negate:(0,1),416,32;pattern:(16,36),448,32;;regex_list:t(12,83)=(12,81)path_extract_list:T(12,84)=s12next:(12,85)=*(12,84),0,32;meta_entry:(12,47),32,32;regex:(12,86)=*(12,83),64,32;;path_extract_list:t(12,87)=(12,84) :T(12,88)=ePROP_UNDEFINED:-1,PROP_UNKNOWN:0,PROP_STRING:1,PROP_INTEGER:2,PROP_FLOAT:3,PROP_DATE:4,PROP_ULONG:5,;PropType:t(12,89)=(12,88) :T(12,90)=eUNDEF_META_DISABLE:0,UNDEF_META_INDEX:1,UNDEF_META_AUTO:2,UNDEF_META_ERROR:3,UNDEF_META_IGNORE:4,;UndefMetaFlag:t(12,91)=(12,90)u_PropValue1:t(12,92)=(12,93)=u8v_str:(16,36),0,32;v_int:(0,1),0,32;v_date:(61,1),0,32;v_float:(0,13),0,64;v_ulong:(0,5),0,32;;PropValue:t(12,94)=(12,95)=s16datatype:(12,89),0,32;value:(12,92),32,64;destroy:(0,1),96,32;;DB_RESULTS:T(12,96)=s16next:(12,97)=*(12,96),0,32;resultlist:(12,59),32,32;sortresultlist:(12,98)=*(12,60),64,32;currentresult:(12,98),96,32;;SWISH:T(12,56)=s1712SearchAlt:(12,99)=*(12,100)=xsMOD_SearchAlt:,0,32;ResultOutput:(12,101)=*(12,102)=xsMOD_ResultOutput:,32,32;Filter:(12,103)=*(12,104)=xsMOD_Filter:,64,32;ResultSort:(12,105)=*(12,106)=xsMOD_ResultSort:,96,32;Entities:(12,107)=*(12,108)=xsMOD_Entities:,128,32;Db:(12,109)=*(12,110)=xsMOD_DB:,160,32;Search:(12,111)=*(12,112)=xsMOD_Search:,192,32;Index:(12,113)=*(12,114)=xsMOD_Index:,224,32;FS:(12,115)=*(12,116)=xsMOD_FS:,256,32;HTTP:(12,117)=*(12,118)=xsMOD_HTTP:,288,32;SwishWords:(12,119)=*(12,120)=xsMOD_Swish_Words:,320,32;Prog:(12,121)=*(12,122)=xsMOD_Prog:,352,32;PropLimit:(12,123)=*(12,124)=xsMOD_PropLimit:,384,32;indexlist:(12,58),416,32;Prop_IO_Buf:(28,34),448,32;PropIO_allocated:(0,5),480,32;PropCompressionLevel:(0,1),512,32;TotalWords:(0,1),544,32;TotalFiles:(0,1),576,32;verbose:(0,1),608,32;commonerror:(0,1),640,32;lasterror:(0,1),672,32;lasterrorstr:(12,125)=ar(16,33);0;500;(0,2),704,4008;isvowellookuptable:(12,43),4736,8192;dirlist:(12,38),12928,32;suffixlist:(12,38),12960,32;mtime_limit:(61,1),12992,32;truncateDocSize:(0,3),13024,32;replaceRegexps:(12,86),13056,32;pathExtractList:(12,126)=*(12,87),13088,32;nocontentslist:(12,38),13120,32;DefaultDocType:(0,1),13152,32;indexcontents:(12,70),13184,32;indexComments:(0,1),13216,32;storedescription:(12,24),13248,32;ignoremetalist:(12,38),13280,32;dontbumpstarttagslist:(12,38),13312,32;dontbumpendtagslist:(12,38),13344,32;UndefinedMetaTags:(12,91),13376,32;UndefinedXMLAttributes:(12,91),13408,32;parser_warn_level:(0,1),13440,32;obeyRobotsNoIndex:(0,1),13472,32;links_meta:(12,47),13504,32;images_meta:(12,47),13536,32;IndexAltTag:(0,1),13568,32;IndexAltTagMeta:(16,36),13600,32;AbsoluteLinks:(0,1),13632,32;XMLClassAttributes:(12,38),13664,32;;SWISH:t(12,127)=(12,56)StringList:t(12,128)=(12,129)=s8n:(0,1),0,32;word:(12,45),32,32;;_indexing_data_source_def:T(12,130)=s16IndexingDataSourceName:(28,32),0,32;IndexingDataSourceId:(28,32),32,32;indexpath_fn:(12,131)=*(12,132)=f(0,20),64,32;parseconfline_fn:(12,133)=*(12,134)=f(0,1),96,32;;mem.h/usr/include/memory.h_mem_zone:T(122,1)=s20next:(122,2)=*(122,3)=xs_zone:,0,32;name:(16,36),32,32;size:(15,1),64,32;attributes:(0,1),96,32;allocs:(0,4),128,32;;MEM_ZONE:t(122,4)=(122,1)string.hswregex.herror.h :T(127,1)=eINDEX_FILE_NOT_FOUND:-255,UNKNOWN_INDEX_FILE_FORMAT:-254,NO_WORDS_IN_SEARCH:-253,WORDS_TOO_COMMON:-252,INDEX_FILE_IS_EMPTY:-251,INDEX_FILE_ERROR:-250,UNKNOWN_PROPERTY_NAME_IN_SEARCH_DISPLAY:-249,UNKNOWN_PROPERTY_NAME_IN_SEARCH_SORT:-248,INVALID_PROPERTY_TYPE:-247,UNKNOWN_METANAME:-246,UNIQUE_WILDCARD_NOT_ALLOWED_IN_WORD:-245,WORD_NOT_FOUND:-244,SWISH_LISTRESULTS_EOF:-243,INVALID_SWISH_HANDLE:-242,SEARCH_WORD_TOO_BIG:-241,QUERY_SYNTAX_ERROR:-240,PROP_LIMIT_ERROR:-239,;list.hsearch.hMOD_Search:T(12,112)=s40044beginhits:(0,1),0,32;maxhits:(0,1),32,32;numPropertiesToDisplay:(0,1),64,32;currentMaxPropertiesToDisplay:(0,1),96,32;propNameToDisplay:(12,45),128,32;db_results:(12,97),160,32;resulthashlist:(129,1)=ar(16,33);0;10000;(12,98),192,320032;bigrank:(0,1),320224,32;PhraseDelimiter:(0,1),320256,32;removed_stopwords:(0,1),320288,32;resultSearchZone:(129,2)=*(122,4),320320,32;;index.hdev_ino:T(130,1)=s16dev:(58,10),0,64;ino:(58,9),64,32;next:(130,2)=*(130,1),96,32;;IgnoreLimitPositions:T(130,3)=s8n:(0,1),0,32;pos:(12,10),32,32;;METAIDTABLE:t(130,4)=(130,5)=s16array:(12,10),0,32;max:(0,1),32,32;num:(0,1),64,32;defaultID:(0,1),96,32;;MOD_Index:T(12,114)=s544684metaIDtable:(130,4),0,128;entryArray:(130,6)=*(12,63),128,32;hashentries:(130,7)=ar(16,33);0;100002;(12,66),160,3200096;hashentriesdirty:(130,8)=ar(16,33);0;100002;(0,2),3200256,800024;compression_buffer:(28,34),4000288,32;len_compression_buffer:(0,1),4000320,32;worddata_buffer:(28,34),4000352,32;len_worddata_buffer:(0,1),4000384,32;sz_worddata_buffer:(0,1),4000416,32;filenum:(0,1),4000448,32;tmpdir:(16,36),4000480,32;swap_location_name:(130,9)=ar(16,33);0;376;(16,36),4000512,12064;fp_loc_write:(130,10)=ar(16,33);0;376;(12,23),4012576,12064;fp_loc_read:(130,10),4024640,12064;inode_hash:(130,11)=ar(16,33);0;10000;(130,2),4036704,320032;lenswishword:(0,1),4356736,32;swishword:(16,36),4356768,32;lenword:(0,1),4356800,32;word:(16,36),4356832,32;swap_locdata:(0,1),4356864,32;swap_tell:(130,12)=*(130,13)=f(0,3),4356896,32;swap_write:(130,14)=*(130,15)=f(15,1),4356928,32;swap_seek:(130,16)=*(130,17)=f(0,1),4356960,32;swap_read:(130,18)=*(130,19)=f(15,1),4356992,32;swap_close:(130,20)=*(130,21)=f(0,1),4357024,32;swap_putc:(130,22)=*(130,23)=f(0,1),4357056,32;swap_getc:(130,20),4357088,32;plimit:(0,1),4357120,32;flimit:(0,1),4357152,32;nIgnoreLimitWords:(0,1),4357184,32;IgnoreLimitPositionsArray:(130,24)=*(130,25)=*(130,3),4357216,32;chunk_size:(0,1),4357248,32;optimalChunkLocZoneSize:(0,1),4357280,32;freeLocMemChain:(12,34),4357312,32;perDocTmpZone:(129,2),4357344,32;currentChunkLocZone:(129,2),4357376,32;totalLocZone:(129,2),4357408,32;entryZone:(129,2),4357440,32;;file.hhttp.hMOD_HTTP:T(12,118)=s40024lenspiderdirectory:(0,1),0,32;spiderdirectory:(16,36),32,32;maxdepth:(0,1),64,32;delay:(0,1),96,32;equivalentservers:(12,62),128,32;url_hash:(132,1)=ar(16,33);0;10000;(12,68),160,320032;;merge.hmetaMergeEntry:T(133,1)=s20next:(133,2)=*(133,1),0,32;metaName:(16,36),32,32;oldMetaID:(0,1),64,32;newMetaID:(0,1),96,32;metaType:(0,1),128,32;;docprop.hmetanames.hparse_conffile.hresult_output.hResultExtFmtStrList:T(137,1)=s16name:(16,36),0,32;fmtstr:(16,36),32,32;next:(137,2)=*(137,1),64,32;nodep:(137,2),96,32;;MOD_ResultOutput:T(12,102)=s16headerOutVerbose:(0,1),0,32;extendedformat:(16,36),32,32;stdResultFieldDelimiter:(16,36),64,32;resultextfmtlist:(137,2),96,32;;result_sort.hMOD_ResultSort:T(12,106)=s2076isPreSorted:(0,1),0,32;presortedindexlist:(12,38),32,32;iSortTranslationTable:(12,43),64,8192;iSortCaseTranslationTable:(12,43),8256,8192;numPropertiesToSort:(0,1),16448,32;currentMaxPropertiesToSort:(0,1),16480,32;propNameToSort:(12,45),16512,32;propModeToSort:(12,10),16544,32;resultSortZone:(129,2),16576,32;;keychar_out.hdate_time.hdb.h :T(141,1)=eDB_CREATE:0,DB_READ:1,DB_READWRITE:2,;DB_OPEN_MODE:t(141,2)=(141,1)MOD_DB:T(12,110)=s164DB_name:(16,36),0,32;DB_Create:(141,3)=*(141,4)=f(0,19),32,32;DB_Open:(141,5)=*(141,6)=f(0,19),64,32;DB_Close:(28,25),96,32;DB_Remove:(28,25),128,32;DB_InitWriteHeader:(141,7)=*(21,17),160,32;DB_WriteHeaderData:(141,8)=*(141,9)=f(0,1),192,32;DB_EndWriteHeader:(141,7),224,32;DB_InitReadHeader:(141,7),256,32;DB_ReadHeaderData:(141,10)=*(141,11)=f(0,1),288,32;DB_EndReadHeader:(141,7),320,32;DB_InitWriteWords:(141,7),352,32;DB_GetWordID:(141,12)=*(141,13)=f(0,3),384,32;DB_WriteWord:(141,14)=*(141,15)=f(0,1),416,32;DB_WriteWordHash:(141,14),448,32;DB_WriteWordData:(141,16)=*(141,17)=f(0,3),480,32;DB_EndWriteWords:(141,7),512,32;DB_InitReadWords:(141,7),544,32;DB_ReadWordHash:(141,18)=*(141,19)=f(0,1),576,32;DB_ReadFirstWordInvertedIndex:(141,20)=*(141,21)=f(0,1),608,32;DB_ReadNextWordInvertedIndex:(141,20),640,32;DB_ReadWordData:(141,22)=*(141,23)=f(0,3),672,32;DB_EndReadWords:(141,7),704,32;DB_InitWriteFiles:(141,7),736,32;DB_WriteFile:(141,8),768,32;DB_EndWriteFiles:(141,7),800,32;DB_InitReadFiles:(141,7),832,32;DB_ReadFile:(141,24)=*(141,25)=f(0,1),864,32;DB_EndReadFiles:(141,7),896,32;DB_InitWriteSortedIndex:(141,7),928,32;DB_WriteSortedIndex:(141,8),960,32;DB_EndWriteSortedIndex:(141,7),992,32;DB_InitReadSortedIndex:(141,7),1024,32;DB_ReadSortedIndex:(141,24),1056,32;DB_ReadSortedData:(141,26)=*(141,27)=f(0,1),1088,32;DB_EndReadSortedIndex:(141,7),1120,32;DB_WriteProperty:(141,28)=*(141,29)=f(0,20),1152,32;DB_WritePropPositions:(141,30)=*(141,31)=f(0,20),1184,32;DB_ReadPropPositions:(141,30),1216,32;DB_ReadProperty:(141,32)=*(141,33)=f(16,36),1248,32;DB_Reopen_PropertiesForRead:(28,25),1280,32;;fs.hPATH_LIST:t(142,1)=(142,2)=s20pathname:(12,86),0,32;dirname:(12,86),32,32;filename:(12,86),64,32;dircontains:(12,86),96,32;title:(12,86),128,32;;MOD_FS:T(12,116)=s44filerules:(142,1),0,160;filematch:(142,1),160,160;followsymlinks:(0,1),320,32;;dump.hproplimit.hDEBUG_MAP:t(0,21)=(0,22)=s12name:(16,36),0,32;bit:(0,4),32,32;description:(16,36),64,32;;debug_map:S(0,23)=ar(0,1);0;-1;(0,21) :T(0,24)=eMODE_SEARCH:0,MODE_INDEX:1,MODE_DUMP:2,MODE_WORDS:3,MODE_MERGE:4,MODE_UPDATE:5,;CMD_MODE:t(0,25)=(0,24)CMDPARAMS:t(0,26)=(0,27)=s40run_mode:(0,25),0,32;wordlist:(16,36),32,32;keychar:(0,2),64,8;tmpsortprops:(12,38),96,32;conflist:(12,38),128,32;hasverbose:(0,1),160,32;index_read_only:(0,1),192,32;swap_mode:(0,1),224,32;structure:(0,1),256,32;merge_out_file:(16,36),288,32;;main:F(0,1)argc:p(0,1)argv:p(12,45)argv:r(12,45)sw:r(0,28)=*(12,127)params:r(0,29)=*(0,26)printTime:f(0,20)time:p(0,13)hh:r(0,1)mm:r(0,1)delta:r(0,1)usage:f(0,20)defaultIndexingSystem:r(28,32)printversion:f(0,20)isDebugWord:f(0,4)word:p(16,36)params:p(0,29)i:r(0,1)new_swish_params:f(0,29)params:(0,29)free_command_line_params:f(0,20)params:r(0,29)is_another_param:f(16,36)next_param:f(16,36)argv:p(0,30)=*(12,45)argv:r(0,30)c:r(16,36)get_param_number:f(0,1)argv:p(0,30)c:p(0,1)c:(0,2)badchar:(16,36)num:r(0,3)string:r(16,36)get_command_line_params:f(0,20)sw:p(0,28)c:r(0,2)lenwordlist:(0,1)w:r(16,36)data_source:r(0,31)=*(0,32)=*(12,130)stat_buf:(79,1)bit:r(0,4)f:r(12,23)__result:r(0,1)i:(0,1)j:r(0,1)backslash:(0,1)s:r(16,36)check_readonly_mode:f(0,1)prog:p(16,36)prog:r(16,36)tmp:r(16,36)cmd_dump:f(0,20)sw:r(0,28)cmd_index:f(0,20)hasdir:(0,1)hasindex:(0,1)elapsedStart:(0,13)cpuStart:(0,13)tmpswline:r(12,38)tmp:r(12,38)cmd_merge:f(0,20)sw_input:p(0,28)sw_input:r(0,28)sw_out:r(0,28)cmd_keywords:f(0,20)cmd_search:f(0,20)rc:r(0,1)elapsedSearchStart:(0,13)elapsedEnd:r(0,13)sortmode:(0,1)tmplist:r(12,38)field:(16,36)write_index_file:f(0,20)process_stopwords:p(0,1)elapsedStart:p(0,13)cpuStart:p(0,13)merge:p(0,1)is_update:p(0,1)process_stopwords:r(0,1)merge:(0,1)totalfiles:r(0,1)stopwords:r(0,1)pos:r(0,1)keychar_out.cOutputKeyChar:F(0,20)sw:p(0,21)=*(1,127)keychar:p(0,1)tmpindexlist:(1,58)keychar2:r(0,1)keywords:r(7,36)methods.cdata_sources:G(0,21)=ar(0,1);0;-1;(0,22)=*(1,130)index.cdev_ino:T(120,1)=s16dev:(49,10),0,64;ino:(49,9),64,32;next:(120,2)=*(120,1),96,32;;IgnoreLimitPositions:T(120,3)=s8n:(0,1),0,32;pos:(1,10),32,32;;METAIDTABLE:t(120,4)=(120,5)=s16array:(1,10),0,32;max:(0,1),32,32;num:(0,1),64,32;defaultID:(0,1),96,32;;MOD_Index:T(1,114)=s544684metaIDtable:(120,4),0,128;entryArray:(120,6)=*(1,63),128,32;hashentries:(120,7)=ar(7,33);0;100002;(1,66),160,3200096;hashentriesdirty:(120,8)=ar(7,33);0;100002;(0,2),3200256,800024;compression_buffer:(19,34),4000288,32;len_compression_buffer:(0,1),4000320,32;worddata_buffer:(19,34),4000352,32;len_worddata_buffer:(0,1),4000384,32;sz_worddata_buffer:(0,1),4000416,32;filenum:(0,1),4000448,32;tmpdir:(7,36),4000480,32;swap_location_name:(120,9)=ar(7,33);0;376;(7,36),4000512,12064;fp_loc_write:(120,10)=ar(7,33);0;376;(1,23),4012576,12064;fp_loc_read:(120,10),4024640,12064;inode_hash:(120,11)=ar(7,33);0;10000;(120,2),4036704,320032;lenswishword:(0,1),4356736,32;swishword:(7,36),4356768,32;lenword:(0,1),4356800,32;word:(7,36),4356832,32;swap_locdata:(0,1),4356864,32;swap_tell:(120,12)=*(120,13)=f(0,3),4356896,32;swap_write:(120,14)=*(120,15)=f(6,1),4356928,32;swap_seek:(120,16)=*(120,17)=f(0,1),4356960,32;swap_read:(120,18)=*(120,19)=f(6,1),4356992,32;swap_close:(120,20)=*(120,21)=f(0,1),4357024,32;swap_putc:(120,22)=*(120,23)=f(0,1),4357056,32;swap_getc:(120,20),4357088,32;plimit:(0,1),4357120,32;flimit:(0,1),4357152,32;nIgnoreLimitWords:(0,1),4357184,32;IgnoreLimitPositionsArray:(120,24)=*(120,25)=*(120,3),4357216,32;chunk_size:(0,1),4357248,32;optimalChunkLocZoneSize:(0,1),4357280,32;freeLocMemChain:(1,34),4357312,32;perDocTmpZone:(120,26)=*(115,4),4357344,32;currentChunkLocZone:(120,26),4357376,32;totalLocZone:(120,26),4357408,32;entryZone:(120,26),4357440,32;;hash.hcheck.hMOD_Search:T(1,112)=s40044beginhits:(0,1),0,32;maxhits:(0,1),32,32;numPropertiesToDisplay:(0,1),64,32;currentMaxPropertiesToDisplay:(0,1),96,32;propNameToDisplay:(1,45),128,32;db_results:(1,97),160,32;resulthashlist:(123,1)=ar(7,33);0;10000;(1,98),192,320032;bigrank:(0,1),320224,32;PhraseDelimiter:(0,1),320256,32;removed_stopwords:(0,1),320288,32;resultSearchZone:(120,26),320320,32;;stemmer.h :T(126,1)=eSTEM_OK:0,STEM_NOT_ALPHA:1,STEM_TOO_SMALL:2,STEM_WORD_TOO_BIG:3,STEM_TO_NOTHING:4,;STEM_RETURNS:t(126,2)=(126,1)soundex.hdouble_metaphone.hmetastring:t(128,1)=(128,2)=s16str:(7,36),0,32;length:(0,1),32,32;bufsize:(0,1),64,32;free_string_on_destroy:(0,1),96,32;;compress.hhtml.hxml.hparser.htxt.hMOD_ResultSort:T(1,106)=s2076isPreSorted:(0,1),0,32;presortedindexlist:(1,38),32,32;iSortTranslationTable:(1,43),64,8192;iSortCaseTranslationTable:(1,43),8256,8192;numPropertiesToSort:(0,1),16448,32;currentMaxPropertiesToSort:(0,1),16480,32;propNameToSort:(1,45),16512,32;propModeToSort:(1,10),16544,32;resultSortZone:(120,26),16576,32;;filter.hFilterList:T(1,27)=s20next:(1,26),0,32;prog:(7,36),32,32;options:(7,36),64,32;regex:(1,86),96,32;suffix:(7,36),128,32;;FilterList:t(139,1)=(1,27)MOD_Filter:T(1,104)=s8filterdir:(7,36),0,32;filterlist:(139,2)=*(139,1),32,32;;swish_qsort.hcmp_t:t(143,1)=(103,11)initModule_Index:F(0,20)sw:r(0,21)idx:r(1,113)freeModule_Index:F(0,20)sw:p(0,21)configModule_Index:F(0,1)sl:p(0,22)=*(1,128)w0:r(7,36)retval:(0,1)env_tmp:r(7,36)remove_last_file_from_list:f(0,20)indexf:p(1,58)ep:r(1,66)prev_ep:r(1,66)l:r(1,34)index_no_content:f(0,1)fprop:p(0,23)=*(1,21)fi:p(0,24)=*(1,17)buffer:p(7,36)fprop:r(0,23)idx:(1,113)title:r(7,36)n:r(0,1)position:(0,1)metaID:(0,1)loc_chain:T(0,25)=s8next:(0,26)=*(0,25),0,32;size:(0,1),32,32;;alloc_location:F(1,34)idx:p(1,113)size:p(0,1)size:r(0,1)tmp:r(0,26)big:r(0,26)tmp2:(1,34)avail:r(0,1)p_avail:(0,26)new_location:F(1,34)is_location_full:F(0,1)add_position_location:F(1,34)oldp:p(0,19)frequency:p(0,1)oldp:r(0,19)frequency:r(0,1)newp:r(1,34)oldsize:r(0,1)do_index_file:F(0,20)fprop:p(0,23)countwords:r(0,27)=*(0,28)=f(0,1)indexf:(1,58)wordcount:r(0,1)rd_buffer:r(7,36)strType:(0,29)=ar(7,33);0;29;(0,2)fi:(1,17)getentry:F(1,66)word:p(7,36)hashval:(0,1)e:r(1,66)addentry:F(0,20)e:p(1,66)filenum:p(0,1)structure:p(0,1)metaID:p(0,1)position:p(0,1)position:r(0,1)found:r(0,1)tp:r(1,34)newtp:r(1,34)prevtp:r(1,34)indexf:r(1,58)m:r(1,47)addCommonProperties:F(0,20)fi:p(0,24)title:p(7,36)summary:p(7,36)start:p(0,1)fi:r(0,24)q:r(1,47)properties:(0,30)=*(1,19)tmp:(0,5)header:(0,31)=*(1,41)filename:r(7,36)filenum:(0,1)index_path_parts:f(0,20)path:p(7,36)list:p(1,126)header:p(0,31)properties:p(0,30)list:r(1,126)positionMeta:(0,1)matched:(0,1)str:r(7,36)getfilecount:F(0,1)getNumberOfIgnoreLimitWords:F(0,1)getPositionsFromIgnoreLimitWords:F(0,20)k:r(0,1)m:r(0,1)bytes_size:(0,1)chunk_size:(0,1)frequency:(0,1)tmpval:(0,1)positions:r(1,10)local_positions:(0,32)=ar(7,33);0;1023;(0,1)next:(1,34)ep2:(1,66)estop:(1,65)estopsz:(0,1)estopmsz:(0,1)totalwords:r(0,1)totalfiles:(0,1)filepos:(120,24)fpos:r(120,25)p:(19,34)q:r(19,34)flag:(0,11)adjustWordPositions:F(0,20)worddata:p(19,34)sz_worddata:p(1,10)n_files:p(0,1)ilp:p(120,24)r_filenum:(0,1)w_filenum:(0,1)posdata:r(1,10)r_nextposmeta:(0,5)w_nextposmeta:(19,34)local_posdata:(0,32)r_flag:(0,11)w_flag:(19,34)q:(19,34)entrystructcmp:F(0,1)e1:p(0,33)=*(0,20)e2:p(0,33)e1:r(0,33)e2:r(0,33)sort_words:F(0,20)sortChunkLocations:F(0,20)metaID:r(0,1)ptmp:(19,34)ptmp2:r(19,34)compressed_data:(19,34)prev:(1,34)coalesce_all_word_locations:F(0,20)epi:r(1,66)write_index:F(0,20)ep:(120,6)totalwords:(0,1)percent:r(0,1)lastPercent:(0,1)last_loc_swap:(0,1)stripIgnoreLastChars:F(0,20)word:r(7,36)stripIgnoreFirstChars:F(0,20)addword:f(0,20)numMetaNames:p(0,1)metaID:p(1,10)word_position:p(1,10)word_position:r(1,10)next_word:F(0,1)buf:p(1,45)word:p(1,45)lenword:p(1,10)buf:r(1,45)next_swish_word:F(0,1)bump_flag:r(0,1)__res:r(0,1)build_metaID_list:f(0,1)metas:r(0,34)=*(120,4)header:(0,31)indexstring:F(0,1)s:p(7,36)position:p(1,10)s:r(7,36)wordcount:(0,1)buf_pos:(7,36)cur_pos:(7,36)word:(7,36)lenword:(0,1)swishword:(7,36)lenswishword:(0,1)c:r(19,34)codes:(0,35)=ar(7,33);0;1;(7,36)add_coalesced:F(0,20)coalesced:p(19,34)sz_coalesced:p(0,1)coalesced:r(19,34)tmp:r(0,1)tloc:r(1,34)tprev:r(1,34)tp:(19,34)coalesce_word_locations:F(0,20)curmetaID:(0,1)curfilenum:r(0,1)num_locs:r(0,1)worst_case_size:(0,1)size_p:(19,34)uflag:(0,11)cflag:(19,34)loc:r(1,34)buffer:V(0,36)=ar(7,33);0;262143;(0,11)coalesced_buffer:r(19,34)merge.c/usr/include/assert.hmerge_indexes:F(0,20)sw_input:p(0,21)=*(5,127)sw_output:p(0,21)cur_index:r(5,58)filenum_map:r(5,23)tmpfilename:(9,36)idx_output:(5,113)e:(5,66)hash:(0,1)sz_worddata:(0,1)loc_count:(0,1)word_count:(0,1)wordID:(0,3)nextposmetaID:(0,5)worddata:(21,34)s:(21,34)local_posdata:(0,22)=ar(9,33);0;1023;(0,1)posdata:r(5,10)dup_header:f(0,20)sw_input:p(0,21)sw_input:r(0,21)sw_output:r(0,21)out_header:r(0,23)=*(5,41)HEAD_CMP:t(0,24)=(0,25)=*(0,26)=s8len:(0,1),0,32;str:(9,36),32,32;;compare_header:f(0,20)index:p(9,36)name:p(9,36)in:p(0,19)out:p(0,19)index:r(9,36)name:(9,36)in:r(0,19)out:r(0,19)check_header_match:f(0,20)in_index:p(5,58)in_index:r(5,58)out_header:(0,23)in_header:r(0,23)make_meta_map:f(0,20)in_header:(0,23)in_meta:r(5,47)out_meta:(5,47)meta_map:(5,10)in_alias:r(5,47)out_alias:r(5,47)compnums:f(0,1)s1:p(0,27)=*(0,20)s2:p(0,27)s1:r(0,27)s2:r(0,27)a:r(0,1)b:r(0,1)v1:r(0,1)v2:r(0,1)load_filename_sort:f(0,20)cur_index:p(5,58)path_meta:r(5,47)sort_array:r(5,10)print_file_removed:f(0,20)older:p(5,58)op:p(5,11)newer:p(5,58)np:p(5,11)older:r(5,58)op:r(5,11)newer:r(5,58)p1:(9,36)d1:r(9,36)p2:r(9,36)d2:r(9,36)get_next_file_in_order:f(5,58)winner:r(5,58)fi:(5,17)ret:r(0,1)wp:r(5,11)cp:(5,11)add_file:f(0,20)filenum_map:p(5,23)indexf:(5,58)idx:r(5,113)d:r(5,19)tmp:r(5,11)docProperties:(5,19)meta_entry:(5,9)header:r(0,23)idx1:r(0,1)get_map:f(5,10)array:(5,10)idf:(5,58)new_filenum:r(0,1)dump_index_words:f(0,20)indexf:p(5,58)indexf:r(5,58)word:(0,28)=ar(9,33);0;1;(0,2)resultword:(9,36)write_word_pos:f(0,20)file_num_map:p(5,10)e:p(5,66)posdata:p(0,1)file_num_map:r(5,10)filenum:r(0,1)posdata:r(0,1)new_file:r(0,1)sorted_data:S(5,10)stemmer.cRuleList:t(0,21)=(0,22)=s28id:(0,1),0,32;old_end:(7,36),32,32;new_end:(7,36),64,32;old_offset:(0,1),96,32;new_offset:(0,1),128,32;min_root_size:(0,1),160,32;condition:(0,23)=*(0,24)=f(0,1),192,32;;step1a_rules:S(0,25)=ar(0,1);0;-1;(0,21)step1b_rules:S(0,26)=ar(0,1);0;-1;(0,21)step1b1_rules:S(0,27)=ar(0,1);0;-1;(0,21)step1c_rules:S(0,28)=ar(0,1);0;-1;(0,21)step2_rules:S(0,29)=ar(0,1);0;-1;(0,21)step3_rules:S(0,30)=ar(0,1);0;-1;(0,21)step4_rules:S(0,31)=ar(0,1);0;-1;(0,21)step5a_rules:S(0,32)=ar(0,1);0;-1;(0,21)step5b_rules:S(0,33)=ar(0,1);0;-1;(0,21)all_steps:S(0,34)=ar(0,1);0;-1;(0,35)=*(0,21)WordSize:F(0,1)result:r(0,1)state:r(0,1)ContainsVowel:F(0,1)EndsWithCVC:F(0,1)length:r(0,1)AddAnE:F(0,1)RemoveAnE:F(0,1)ReplaceEnd:F(0,1)rule:p(0,35)rule:r(0,35)ending:r(7,36)tmp_ch:(0,2)end:r(7,36)Stem:F(0,1)inword:p(1,45)word:(0,36)=ar(7,33);0;1000;(0,2)rule_result:r(0,1)soundex.csoundex:F(0,1)u:r(0,2)l:r(0,2)soundCode:(0,21)=ar(7,33);0;4;(0,2)soundTable:V(0,22)=ar(7,33);0;25;(0,2)soundXit:F(0,1)filter.cinitModule_Filter:F(0,20)sw:p(0,21)=*(19,127)md:r(19,103)freeModule_Filter:F(0,20)fm:r(123,2)fm2:r(123,2)configModule_Filter:F(0,1)sl:p(0,22)=*(19,128)w0:(11,36)filter:r(123,2)f:r(123,2)addfilter:f(123,2)rp:p(123,2)suffix:p(11,36)prog:p(11,36)options:p(11,36)filterdir:p(11,36)suffix:r(11,36)newnode:r(123,2)buf:r(11,36)hasfilter:F(19,26)filename:p(11,36)filename:r(11,36)fl:r(123,2)s:r(11,36)fe:(11,36)FilterOpen:F(19,23)fprop:p(0,23)=*(19,21)filtercmd:r(11,36)fi:r(123,2)cmd_opts:(11,36)opt_mask:r(11,36)fp:(19,23)prog:r(11,36)FilterClose:F(0,1)fp:p(19,23)fp:r(19,23)filterCallCmdOptStr:f(11,36)opt_mask:p(11,36)cmdopt:r(11,36)co:r(11,36)om:(11,36)filterCallCmdOptParam2:f(11,36)str:p(11,36)param:p(0,1)str:r(11,36)param:r(0,2)nul:V(11,36)x:r(11,36)parse_conffile.centities.hMOD_Entities:T(12,108)=s4convertEntities:(0,1),0,32;;search_alt.hLOGICAL_OP:t(137,1)=(137,2)=s16and:(16,36),0,32;or:(16,36),32,32;not:(16,36),64,32;defaultrule:(0,1),96,32;;MOD_SearchAlt:T(12,100)=s20enableAltSearchSyntax:(0,1),0,32;srch_op:(137,1),32,128;;extprog.h/usr/include/zlib.h/usr/include/zconf.hByte:t(145,1)=(0,11)uInt:t(145,2)=(0,4)uLong:t(145,3)=(0,5)Bytef:t(145,4)=(145,1)charf:t(145,5)=(0,2)intf:t(145,6)=(0,1)uIntf:t(145,7)=(145,2)uLongf:t(145,8)=(145,3)voidpf:t(145,9)=(0,19)voidp:t(145,10)=(0,19)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(147,1)=(16,57)socklen_t:t(147,2)=(16,58)/usr/include/bits/confname.h :T(152,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(152,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(152,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.halloc_func:t(144,1)=(144,2)=*(144,3)=f(145,9)free_func:t(144,4)=(144,5)=*(144,6)=f(0,20)z_stream_s:T(144,7)=s56next_in:(144,8)=*(145,4),0,32;avail_in:(145,2),32,32;total_in:(145,3),64,32;next_out:(144,8),96,32;avail_out:(145,2),128,32;total_out:(145,3),160,32;msg:(16,36),192,32;state:(144,9)=*(144,10)=xsinternal_state:,224,32;zalloc:(144,1),256,32;zfree:(144,4),288,32;opaque:(145,9),320,32;data_type:(0,1),352,32;adler:(145,3),384,32;reserved:(145,3),416,32;;z_stream:t(144,11)=(144,7)z_streamp:t(144,12)=(144,13)=*(144,11)gzFile:t(144,14)=(145,10)internal_state:T(144,10)=s4dummy:(0,1),0,32;;getdefaults:F(0,20)sw:p(0,21)=*(12,127)conffile:p(16,36)hasdir:p(12,10)hasindex:p(12,10)hasverbose:p(0,1)gotdir:(0,1)gotindex:(0,1)line:(0,22)=ar(16,33);0;1999;(0,2)fp:(12,23)linenumber:(0,1)baddirective:(0,1)sl:(0,23)=*(12,128)indexf:(12,58)StringValue:r(28,34)w0:r(16,36)m:r(12,47)words:r(12,45)meta_entry:r(12,47)new_meta:r(12,47)rank:r(0,1)max_length:(0,1)ic:r(12,70)sd:r(12,24)read_integer:f(0,1)string:p(16,36)message:p(16,36)low:p(0,1)high:p(0,1)message:r(16,36)getYesNoOrAbort:F(0,1)sl:p(0,23)n:p(0,1)lastparam:p(0,1)sl:r(0,23)add_ExtractPath:f(0,20)name:p(16,36)m:p(12,47)params:p(12,45)name:(16,36)params:(12,45)list:r(12,126)last:r(12,126)free_Extracted_Path:F(0,20)next:r(12,126)Build_ReplaceRules:f(0,20)reg_list:p(0,24)=*(12,86)params:r(12,45)reg_list:(0,24)pattern:r(16,36)replace:r(16,36)global:(0,1)strtoDocType:F(0,1)s:p(16,36)doc_map:V(0,25)=ar(16,33);0;6;(0,26)=s8type:(16,36),0,32;id:(0,1),32,32;;getDocTypeOrAbort:f(0,1)doctype:r(0,1)grabCmdOptions:F(0,20)listOfWords:p(0,27)=*(12,38)listOfWords:r(0,27)readstopwordsfile:f(0,20)indexf:p(12,58)stopw_file:p(16,36)stopw_file:r(16,36)line:(0,22)readbuzzwordsfile:f(0,20)parseconfline:f(0,1)readusewordsfile:f(0,20)usew_file:p(16,36)usew_file:r(16,36)get_undefined_meta_flags:f(0,20)w0:p(16,36)setting:p(0,28)=*(12,91)setting:r(0,28)freeSwishConfigOptions:F(0,20)next:r(12,70)next:r(12,24)swregex.cadd_regex_patterns:F(0,20)name:p(7,36)reg_list:p(0,21)=*(1,86)params:p(1,45)regex_pattern:p(0,1)params:r(1,45)negate:(0,1)pos:r(7,36)ptr:r(7,36)delimiter:(0,1)cflags:(0,1)add_replace_expression:F(0,20)reg_list:p(0,21)expression:p(7,36)name:(7,36)reg_list:(0,21)expression:(7,36)save:(7,36)delimiter:r(0,1)pattern:(7,36)replace:r(7,36)match_regex_list:F(0,1)str:p(7,36)regex:p(1,86)regex:r(1,86)pmatch:(0,22)=ar(7,33);0;0;(101,11)matched:r(0,1)process_regex_list:F(7,36)matched:p(1,10)matched:r(1,10)regex_replace:f(7,36)offset:p(0,1)pmatch:(0,23)=ar(7,33);0;9;(101,11)c:r(7,36)newstr:(7,36)escape:(0,1)pos:(0,1)last_offset:r(0,1)start:r(7,36)free_regex_list:F(0,20)reg_list:r(0,21)list:r(1,86)next:r(1,86)add_regular_expression:F(0,20)pattern:p(7,36)replace:p(7,36)cflags:p(0,1)global:p(0,1)negate:p(0,1)pattern:r(7,36)cflags:r(0,1)global:r(0,1)negate:r(0,1)new_node:r(1,86)last:r(1,86)status:r(0,1)double_metaphone.cva_list:t(65,1)=(24,1)NewMetaString:F(0,21)=*(68,1)init_str:p(6,36)init_str:r(6,36)s:r(0,21)empty_string:(0,22)=ar(6,33);0;0;(0,2)DestroyMetaString:F(0,20)s:p(0,21)IncreaseBuffer:F(0,20)chars_needed:p(0,1)chars_needed:r(0,1)MakeUpper:F(0,20)i:r(6,36)IsVowel:F(0,1)pos:p(0,1)SlavoGermanic:F(0,1)GetLength:F(0,1)GetAt:F(0,2)SetAt:F(0,20)StringAt:F(0,1)length:p(0,1)start:r(0,1)test:r(6,36)pos:r(6,36)ap:r(65,1)MetaphAdd:F(0,20)new_str:p(6,36)new_str:r(6,36)add_length:r(0,1)DoubleMetaphone:F(0,20)str:p(6,36)codes:p(0,23)=*(6,36)str:r(6,36)codes:(0,23)length:(0,1)original:r(0,21)primary:(0,21)secondary:(0,21)current:(0,1)last:(0,1)swish2.cswish_words.hDEBUG_MASK:G(0,4)SwishNew:F(0,21)=*(1,127)SwishResetSearch:F(0,20)SwishClose:F(0,20)sw:(0,21)tmpindexlist:r(1,58)SwishInit:F(0,21)indexfiles:p(7,36)indexfiles:r(7,36)sl:r(0,22)=*(1,128)SwishOpen:F(0,21)SwishAttach:F(0,1)srch:r(1,111)indexlist:r(1,58)tmplist:r(1,58)SwishSearch:F(0,1)words:p(7,36)props:p(7,36)sort:p(7,36)props:r(7,36)sort:r(7,36)slprops:(0,22)slsort:(0,22)header_level:r(0,1)field:r(7,36)SwishSeek:F(0,1)sp:r(1,98)SwishHeaderParameter:F(7,36)parameter_name:p(7,36)parameter_name:r(7,36)SwishStopWords:F(1,45)filename:p(7,36)numstops:p(1,10)numstops:r(1,10)SwishWords:F(7,36)IndexingDataSource:G(0,23)=*(1,130)tmp_header_buffer:G(0,24)=ar(7,33);0;49;(0,2)search.crank.hinitModule_Search:F(0,20)resetModule_Search:F(0,20)tmp:r(1,97)freeModule_Search:F(0,20)configModule_Search:F(0,1)icomp:F(0,1)s1:p(0,23)=*(0,20)s2:p(0,23)s1:r(0,23)s2:r(0,23)icomp_posdata:F(0,1)s1:p(0,23)compResultsByFileNum:F(0,1)icomp2:F(0,1)search:F(0,1)words:r(7,36)structure:r(0,1)sw_srch_str:r(7,36)limit_result_list:f(0,20)rtmp:r(1,98)rp:r(1,98)last:(1,98)db_results:r(1,97)search_2:F(0,1)hassearch:(0,1)indexYes:(0,1)totalResults:r(0,1)searchwordlist:(1,38)tmplist2:(1,38)PhraseDelimiter:(0,11)db_tmp:r(1,97)srch:(1,111)fixmetanames:F(1,38)sp:p(1,38)metapar:r(0,1)tmpp:r(1,38)newp:r(1,38)fixnot1:F(1,38)sp:r(1,38)prev:r(1,38)fixnot2:F(1,38)openparen:r(0,1)found:(0,1)expandphrase:F(1,38)delimiter:p(0,1)delimiter:(0,2)tmp:r(1,38)inphrase:r(0,1)operator:r(7,36)printheaderbuzzwords:F(0,20)hashval:r(0,1)parseterm:F(1,59)parseone:p(0,1)searchwordlist:p(0,24)=*(1,38)rulenum:r(0,1)l_rp:r(1,59)new_l_rp:r(1,59)andLevel:(0,1)operate:F(1,59)l_rp:p(1,59)rulenum:p(0,1)wordin:p(7,36)DB:p(0,19)andLevel:p(0,1)return_l_rp:r(1,59)newResultsList:f(1,59)l:r(1,59)addResultToList:F(0,20)l_r:p(1,59)r:p(1,98)l_r:r(1,59)r:r(1,98)test_structure:F(0,1)posdata:p(1,10)p:r(1,10)q:r(1,10)getfileinfo:F(1,59)curmetaID:r(0,1)l_rp:(1,59)nextposmetaname:(0,5)p:(7,36)tfrequency:(0,1)s:(19,34)buffer:(19,34)sz_buffer:(0,1)stack_posdata:(1,43)posdata:(1,10)resultword:(7,36)isrule:F(0,1)ops:V(0,25)=ar(7,33);0;5;(7,36)u_isrule:F(0,1)op:r(0,26)=*(132,1)isnotrule:F(0,1)u_isnotrule:F(0,1)isbooleanrule:F(0,1)isunaryrule:F(0,1)getrulenum:F(0,1)u_SelectDefaultRulenum:F(0,1)make_db_res_and_free:f(0,20)l_res:p(1,59)l_res:r(1,59)tmp:(1,96)andresultlists:F(1,59)l_r1:p(1,59)l_r2:p(1,59)l_r1:r(1,59)l_r2:r(1,59)new_results_list:(1,59)r1:r(1,98)r2:(1,98)res:r(0,1)orresultlists:F(1,59)r1:(1,98)rp:(1,98)tmp:r(1,98)result_size:r(0,1)markentry:T(0,27)=s8next:(0,28)=*(0,27),0,32;num:(0,1),32,32;;marknum:F(0,20)markentrylist:p(0,29)=*(0,28)num:p(0,1)markentrylist:r(0,29)num:r(0,1)hashval:r(0,4)mp:r(0,28)ismarked:F(0,1)markentrylist:p(0,29)initmarkentrylist:F(0,20)freemarkentrylist:F(0,20)notresultlist:F(1,59)filenums:r(0,1)new_results_list:r(1,59)markentrylist:(0,30)=ar(7,33);0;10000;(0,28)phraseresultlists:F(1,59)distance:p(0,1)newRank:r(0,1)allpositions:(1,10)addtoresultlist:F(0,20)rank:p(0,1)tfrequency:p(0,1)rank:(0,1)newnode:r(1,98)SwishNext:F(1,98)res:(1,98)res2:(1,98)db_results_winner:r(1,97)num:(0,1)isMetaNameOpNext:F(0,1)searchWord:p(1,38)searchWord:r(1,38)__s1:r(0,31)=*(0,11)freeresultlist:F(0,20)dbres:p(1,97)dbres:r(1,97)freeresult:F(0,20)rp:p(1,98)sortresultsbyfilenum:F(1,59)ptmp:r(0,32)=*(1,98)notresultlists:F(1,59)r2:r(1,98)ignore_words_in_query:F(1,38)searchwordlist:p(1,38)phrase_delimiter:p(0,1)searchwordlist:r(1,38)phrase_delimiter:(0,11)cur_token:r(1,38)prev_token:(1,38)prev_prev_token:(1,38)in_phrase:(0,1)paren_count:(0,1)remove:(0,1)first_char:r(0,2)mergeresulthashlist:F(1,59)next:(1,98)start:r(1,98)newnode:(1,98)tot_frequency:r(0,1)pos_off:(0,1)swish_words.cMOD_Swish_Words:T(1,120)=s8word:(7,36),0,32;lenword:(0,1),32,32;;initModule_Swish_Words:F(0,20)self:r(1,119)freeModule_Swish_Words:F(0,20)isSearchOperatorChar:f(0,1)inphrase:p(0,1)c:r(0,1)phrase_delimiter:r(0,1)next_token:f(0,1)backslash:r(0,1)next_swish_word:f(0,1)header:p(0,22)=*(1,41)word:r(1,45)parse_swish_words:f(1,38)header:p(0,22)max_size:p(0,1)swish_words:(1,38)curpos:(7,36)codes:(0,23)=ar(7,33);0;1;(7,36)replace_swline:f(0,20)original:p(0,24)=*(1,38)entry:p(1,38)new_words:p(1,38)original:r(0,24)entry:r(1,38)new_words:r(1,38)temp:r(1,38)checkbuzzword:f(0,1)header:r(0,22)fudge_wildcard:f(0,20)original:p(0,24)original:(0,24)tmp:r(7,36)wild_card:(1,38)isBooleanOperatorWord:F(7,36)tokenize_query_string:F(1,38)tokens:(1,38)temp:(1,38)swish_words:r(1,38)next_node:r(1,38)max_size:(0,1)inphrase:(0,1)nextoperator:r(7,36)andword:r(1,38)__s1:r(0,25)=*(0,11)proplimit.cGetPropertyByFile:f(1,11)d:r(1,11)LOOKUP_TABLE:T(0,22)=s8filenum:(0,1),0,32;sort:(0,5),32,32;;LOOKUP_TABLE:t(0,23)=(0,22)PARAMS:T(0,24)=s16next:(0,25)=*(0,24),0,32;propname:(19,34),32,32;lowrange:(19,34),64,32;highrange:(19,34),96,32;;PARAMS:t(0,26)=(0,24)MOD_PropLimit:T(1,124)=s4params:(0,27)=*(0,26),0,32;;initModule_PropLimit:F(0,20)self:r(1,123)ClearLimitParameter:F(0,20)tmp:r(0,27)freeModule_PropLimit:F(0,20)SetLimitParameter:F(0,1)propertyname:p(7,36)low:p(7,36)hi:p(7,36)newparam:r(0,27)params:r(0,27)test_prop:f(0,1)meta_entry:p(1,47)key:p(1,11)sort_array:p(0,28)=*(0,23)meta_entry:r(1,47)sort_array:r(0,28)fileprop:r(1,11)cmp_value:r(0,1)binary_search:f(0,1)sort_array:p(0,28)numelements:p(0,1)result:p(1,10)direction:p(0,1)exact_match:p(1,10)numelements:r(0,1)low:(0,1)high:(0,1)mid:r(0,1)cmp:r(0,1)half:r(0,4)find_prop:f(0,1)foundLo:(0,1)foundHi:r(0,1)some_selected:(0,1)exact_match:(0,1)sortbysort:F(0,1)s1:p(0,29)=*(0,20)s2:p(0,29)s1:r(0,29)s2:r(0,29)sortbyfile:F(0,1)s1:p(0,29)create_lookup_array:f(0,1)some_found:r(0,1)params_to_props:f(0,1)param:p(0,27)param:r(0,27)error_flag:(0,1)lowrange:r(19,34)highrange:(19,34)load_index:f(0,1)params:p(0,27)curp:r(0,27)Prepare_PropLookup:F(0,1)total_indexes:(0,1)total_no_docs:(0,1)LimitByProperty:F(0,1)limit:(0,1)prop:r(1,11)is_prop_limit_used:F(0,1)search_alt.cinitModule_SearchAlt:F(0,20)msa:r(19,99)freeModule_SearchAlt:F(0,20)configModule_SearchAlt:F(0,1)w0:r(11,36)convAltSearch2SwishStr:F(11,36)slst:(0,22)sr_new:(11,36)p:r(11,36)tmp:r(11,36)sr_or:(11,36)sr_and:(11,36)sr_not:(11,36)s_or:(19,45)s_and:(19,45)s_not:(19,45)n_or:r(0,1)n_and:(0,1)n_not:(0,1)result_output.cclock_t:t(23,1)=(5,41)time_t:t(23,2)=(5,37)clockid_t:t(23,3)=(5,42)timer_t:t(23,4)=(5,43)timespec:T(23,5)=s8tv_sec:(5,37),0,32;tv_nsec:(0,3),32,32;;tm:T(23,6)=s44tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;tm_gmtoff:(0,3),288,32;tm_zone:(23,7)=*(0,2),320,32;;itimerspec:T(23,8)=s16it_interval:(23,5),0,64;it_value:(23,5),64,64;;_G_fpos_t:t(37,1)=(37,2)=s12__pos:(5,23),0,32;__state:(40,1),32,64;;_G_fpos64_t:t(37,3)=(37,4)=s16__pos:(5,54),0,64;__state:(40,1),64,64;; :T(43,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(43,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(43,3)=(43,4)=*(43,5)=f(0,1)__gconv_init_fct:t(43,6)=(43,7)=*(43,8)=f(0,1)__gconv_end_fct:t(43,9)=(43,10)=*(43,11)=f(0,20)__gconv_trans_fct:t(43,12)=(43,13)=*(43,14)=f(0,1)__gconv_trans_context_fct:t(43,15)=(43,16)=*(43,17)=f(0,1)__gconv_trans_query_fct:t(43,18)=(43,19)=*(43,20)=f(0,1)__gconv_trans_init_fct:t(43,21)=(43,22)=*(43,23)=f(0,1)__gconv_trans_end_fct:t(43,24)=(43,25)=*(43,26)=f(0,20)__gconv_trans_data:T(43,27)=s20__trans_fct:(43,12),0,32;__trans_context_fct:(43,15),32,32;__trans_end_fct:(43,24),64,32;__data:(0,19),96,32;__next:(43,28)=*(43,27),128,32;;__gconv_step:T(43,29)=s56__shlib_handle:(43,30)=*(43,31)=xs__gconv_loaded_object:,0,32;__modname:(23,7),32,32;__counter:(0,1),64,32;__from_name:(5,36),96,32;__to_name:(5,36),128,32;__fct:(43,3),160,32;__init_fct:(43,6),192,32;__end_fct:(43,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(0,19),416,32;;__gconv_step_data:T(43,32)=s36__outbuf:(43,33)=*(0,11),0,32;__outbufend:(43,33),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(43,34)=*(40,1),160,32;__state:(40,1),192,64;__trans:(43,28),256,32;;__gconv_info:T(43,35)=s8__nsteps:(7,1),0,32;__steps:(43,36)=*(43,29),32,32;__data:(43,37)=ar(5,33);0;-1;(43,32),64,0;;__gconv_t:t(43,38)=(43,39)=*(43,35)_G_iconv_t:t(37,5)=(37,6)=u44__cd:(43,35),0,64;__combined:(37,7)=s44__cd:(43,35),0,64;__data:(43,32),64,288;;,0,352;;_G_int16_t:t(37,8)=(0,8)_G_int32_t:t(37,9)=(0,1)_G_uint16_t:t(37,10)=(0,9)_G_uint32_t:t(37,11)=(0,4)s_reg_t:t(106,1)=(0,3)active_reg_t:t(106,2)=(0,5)reg_syntax_t:t(106,3)=(0,5) :T(106,4)=eREG_NOERROR:0,REG_NOMATCH:1,REG_BADPAT:2,REG_ECOLLATE:3,REG_ECTYPE:4,REG_EESCAPE:5,REG_ESUBREG:6,REG_EBRACK:7,REG_EPAREN:8,REG_EBRACE:9,REG_BADBR:10,REG_ERANGE:11,REG_ESPACE:12,REG_BADRPT:13,REG_EEND:14,REG_ESIZE:15,REG_ERPAREN:16,;reg_errcode_t:t(106,5)=(106,4)re_pattern_buffer:T(106,6)=s32buffer:(43,33),0,32;allocated:(0,5),32,32;used:(0,5),64,32;syntax:(106,3),96,32;fastmap:(5,36),128,32;translate:(5,36),160,32;re_nsub:(7,1),192,32;can_be_null:(0,4),224,1;regs_allocated:(0,4),225,2;fastmap_accurate:(0,4),227,1;no_sub:(0,4),228,1;not_bol:(0,4),229,1;not_eol:(0,4),230,1;newline_anchor:(0,4),231,1;;regex_t:t(106,7)=(106,6)regoff_t:t(106,8)=(0,1)re_registers:T(106,9)=s12num_regs:(0,4),0,32;start:(106,10)=*(106,8),32,32;end:(106,10),64,32;;regmatch_t:t(106,11)=(106,12)=s8rm_so:(106,8),0,32;rm_eo:(106,8),32,32;; :T(53,1)=eBASEDOCTYPE:0,TXT:1,HTML:2,XML:3,WML:4,XML2:5,HTML2:6,TXT2:7,;propEntry:T(53,2)=s8propLen:(0,4),0,32;propValue:(53,3)=ar(5,33);0;0;(0,11),32,8;;propEntry:t(53,4)=(53,2)docProperties:T(53,5)=s8n:(0,1),0,32;propEntry:(53,6)=ar(5,33);0;0;(53,7)=*(53,2),32,32;;docProperties:t(53,8)=(53,5)metaEntry:T(53,9)=s48metaName:(5,36),0,32;metaID:(0,1),32,32;metaType:(0,1),64,32;inPropRange:(53,10)=*(0,1),96,32;in_tag:(0,1),128,32;max_len:(0,1),160,32;extractpath_default:(5,36),192,32;loPropRange:(53,11)=*(53,4),224,32;hiPropRange:(53,11),256,32;alias:(0,1),288,32;rank_bias:(0,1),320,32;sorted_data:(53,10),352,32;;PROP_LOCATION:t(53,12)=(53,13)=s8length:(0,3),0,32;seek:(0,3),32,32;;PROP_INDEX:t(53,14)=(53,15)=s8prop_position:(53,16)=ar(5,33);0;0;(53,12),0,64;;FileRec:t(53,17)=(53,18)=s12filenum:(0,1),0,32;docProperties:(53,19)=*(53,8),32,32;prop_index:(53,20)=*(53,14),64,32;;FileProp:t(53,21)=(53,22)=s56fp:(53,23)=*(32,1),0,32;real_path:(5,36),32,32;orig_path:(5,36),64,32;work_path:(5,36),96,32;real_filename:(5,36),128,32;fsize:(0,3),160,32;bytes_read:(0,3),192,32;done:(0,1),224,32;external_program:(0,1),256,32;mtime:(23,2),288,32;doctype:(0,1),320,32;index_no_content:(0,1),352,32;stordesc:(53,24)=*(53,25)=xsStoreDescription:,384,32;hasfilter:(53,26)=*(53,27)=xsFilterList:,416,32;;LOCATION:T(53,28)=s20next:(53,29)=*(53,28),0,32;metaID:(0,1),32,32;filenum:(0,1),64,32;frequency:(0,1),96,32;posdata:(53,30)=ar(5,33);0;0;(0,1),128,32;;LOCATION:t(53,31)=(53,28)ENTRY:T(53,32)=s32next:(53,33)=*(53,32),0,32;tfrequency:(0,1),32,32;currentChunkLocationList:(53,34)=*(53,31),64,32;currentlocation:(53,34),96,32;allLocationList:(53,34),128,32;u1:(53,35)=s8wordID:(0,3),0,32;last_filenum:(0,1),32,32;;,160,64;word:(36,6),224,8;;ENTRY:t(53,36)=(53,32)swline:T(53,37)=s12next:(53,38)=*(53,37),0,32;nodep:(53,38),32,32;line:(5,36),64,32;; :T(53,39)=eFUZZY_NONE:0,FUZZY_STEMMING:1,FUZZY_SOUNDEX:2,FUZZY_METAPHONE:3,FUZZY_DOUBLE_METAPHONE:4,;FuzzyIndexType:t(53,40)=(53,39)INDEXDATAHEADER:t(53,41)=(53,42)=s20480lenwordchars:(0,1),0,32;wordchars:(5,36),32,32;lenbeginchars:(0,1),64,32;beginchars:(5,36),96,32;lenendchars:(0,1),128,32;endchars:(5,36),160,32;lenignorelastchar:(0,1),192,32;ignorelastchar:(5,36),224,32;lenignorefirstchar:(0,1),256,32;ignorefirstchar:(5,36),288,32;lenbumpposchars:(0,1),320,32;bumpposchars:(5,36),352,32;savedasheader:(5,36),384,32;lensavedasheader:(0,1),416,32;lennumberchars:(0,1),448,32;numberchars:(5,36),480,32;numberchars_used_flag:(0,1),512,32;lenindexedon:(0,1),544,32;indexedon:(5,36),576,32;lenindexn:(0,1),608,32;indexn:(5,36),640,32;lenindexd:(0,1),672,32;indexd:(5,36),704,32;lenindexp:(0,1),736,32;indexp:(5,36),768,32;lenindexa:(0,1),800,32;indexa:(5,36),832,32;minwordlimit:(0,1),864,32;maxwordlimit:(0,1),896,32;fuzzy_mode:(53,40),928,32;totalwords:(0,1),960,32;totalfiles:(0,1),992,32;ignoreTotalWordCountWhenRanking:(0,1),1024,32;TotalWordsPerFile:(53,10),1056,32;TotalWordsPerFileMax:(0,1),1088,32;wordcharslookuptable:(53,43)=ar(5,33);0;255;(0,1),1120,8192;begincharslookuptable:(53,43),9312,8192;endcharslookuptable:(53,43),17504,8192;ignorefirstcharlookuptable:(53,43),25696,8192;ignorelastcharlookuptable:(53,43),33888,8192;bumpposcharslookuptable:(53,43),42080,8192;translatecharslookuptable:(53,43),50272,8192;numbercharslookuptable:(53,43),58464,8192;hashstoplist:(53,44)=ar(5,33);0;1008;(53,38),66656,32288;stopList:(53,45)=*(5,36),98944,32;stopMaxSize:(0,1),98976,32;stopPos:(0,1),99008,32;propIDX_to_metaID:(53,10),99040,32;metaID_to_PropIDX:(53,10),99072,32;property_count:(0,1),99104,32;buzzwords_used_flag:(0,1),99136,32;hashbuzzwordlist:(53,44),99168,32288;is_use_words_flag:(0,1),131456,32;hashuselist:(53,44),131488,32288;metaEntryArray:(53,46)=*(53,47)=*(53,9),163776,32;metaCounter:(0,1),163808,32;;IndexFILE:T(53,48)=s21572next:(53,49)=*(53,48),0,32;nodep:(53,49),32,32;line:(5,36),64,32;total_bytes:(0,5),96,32;total_word_positions:(0,5),128,32;prop_string_cache:(53,45),160,32;DB:(0,19),192,32;header:(53,41),224,163840;keywords:(53,50)=ar(5,33);0;255;(5,36),164064,8192;propIDToDisplay:(53,10),172256,32;propIDToSort:(53,10),172288,32;meta_map:(53,10),172320,32;path_order:(53,10),172352,32;current_file:(0,1),172384,32;path_meta:(53,47),172416,32;modified_meta:(53,47),172448,32;cur_prop:(53,11),172480,32;filenum:(0,1),172512,32;merge_file_num_map:(53,10),172544,32;;IndexFILE:t(53,51)=(53,48)RESULT_LIST:T(53,52)=s12head:(53,53)=*(53,54)=xsRESULT:,0,32;tail:(53,53),32,32;sw:(53,55)=*(53,56)=xsSWISH:,64,32;;RESULT_LIST:t(53,57)=(53,52)RESULT:T(53,54)=s56next:(53,53),0,32;count:(0,1),32,32;filenum:(0,1),64,32;fi:(53,17),96,96;rank:(0,1),192,32;frequency:(0,1),224,32;tfrequency:(0,1),256,32;PropSort:(53,45),288,32;iPropSort:(53,10),320,32;indexf:(53,58)=*(53,51),352,32;reslist:(53,59)=*(53,57),384,32;posdata:(53,30),416,32;;RESULT:t(53,60)=(53,54)multiswline:T(53,61)=s8next:(53,62)=*(53,61),0,32;list:(53,38),32,32;;ENTRYARRAY:t(53,63)=(53,64)=s8numWords:(0,1),0,32;elist:(53,65)=*(53,66)=*(53,36),32,32;;url_info:T(53,67)=s8next:(53,68)=*(53,67),0,32;url:(5,36),32,32;;IndexContents:T(53,69)=s12next:(53,70)=*(53,69),0,32;DocType:(0,1),32,32;patt:(53,38),64,32;;StoreDescription:T(53,25)=s16next:(53,24),0,32;DocType:(0,1),32,32;field:(5,36),64,32;size:(0,1),96,32;;int_st:T(53,71)=s12next:(53,72)=*(53,71),0,32;index:(0,1),32,32;val:(53,30),64,32;;int_lookup_st:T(53,73)=s4044n_entries:(0,1),0,32;hash_entries:(53,74)=ar(5,33);0;1008;(53,72),32,32288;all_entries:(53,75)=ar(5,33);0;0;(53,72),32320,32;;char_st:T(53,76)=s12next:(53,77)=*(53,76),0,32;index:(0,1),32,32;val:(5,36),64,32;;char_lookup_st:T(53,78)=s4044n_entries:(0,1),0,32;hash_entries:(53,79)=ar(5,33);0;1008;(53,77),32,32288;all_entries:(53,80)=ar(5,33);0;0;(53,77),32320,32;;regex_list:T(53,81)=s60next:(53,82)=*(53,81),0,32;re:(106,7),32,256;replace:(5,36),288,32;replace_count:(0,1),320,32;replace_length:(0,1),352,32;global:(0,1),384,32;negate:(0,1),416,32;pattern:(5,36),448,32;;regex_list:t(53,83)=(53,81)path_extract_list:T(53,84)=s12next:(53,85)=*(53,84),0,32;meta_entry:(53,47),32,32;regex:(53,86)=*(53,83),64,32;;path_extract_list:t(53,87)=(53,84) :T(53,88)=ePROP_UNDEFINED:-1,PROP_UNKNOWN:0,PROP_STRING:1,PROP_INTEGER:2,PROP_FLOAT:3,PROP_DATE:4,PROP_ULONG:5,;PropType:t(53,89)=(53,88) :T(53,90)=eUNDEF_META_DISABLE:0,UNDEF_META_INDEX:1,UNDEF_META_AUTO:2,UNDEF_META_ERROR:3,UNDEF_META_IGNORE:4,;UndefMetaFlag:t(53,91)=(53,90)u_PropValue1:t(53,92)=(53,93)=u8v_str:(5,36),0,32;v_int:(0,1),0,32;v_date:(23,2),0,32;v_float:(0,13),0,64;v_ulong:(0,5),0,32;;PropValue:t(53,94)=(53,95)=s16datatype:(53,89),0,32;value:(53,92),32,64;destroy:(0,1),96,32;;DB_RESULTS:T(53,96)=s16next:(53,97)=*(53,96),0,32;resultlist:(53,59),32,32;sortresultlist:(53,98)=*(53,60),64,32;currentresult:(53,98),96,32;;SWISH:T(53,56)=s1712SearchAlt:(53,99)=*(53,100)=xsMOD_SearchAlt:,0,32;ResultOutput:(53,101)=*(53,102)=xsMOD_ResultOutput:,32,32;Filter:(53,103)=*(53,104)=xsMOD_Filter:,64,32;ResultSort:(53,105)=*(53,106)=xsMOD_ResultSort:,96,32;Entities:(53,107)=*(53,108)=xsMOD_Entities:,128,32;Db:(53,109)=*(53,110)=xsMOD_DB:,160,32;Search:(53,111)=*(53,112)=xsMOD_Search:,192,32;Index:(53,113)=*(53,114)=xsMOD_Index:,224,32;FS:(53,115)=*(53,116)=xsMOD_FS:,256,32;HTTP:(53,117)=*(53,118)=xsMOD_HTTP:,288,32;SwishWords:(53,119)=*(53,120)=xsMOD_Swish_Words:,320,32;Prog:(53,121)=*(53,122)=xsMOD_Prog:,352,32;PropLimit:(53,123)=*(53,124)=xsMOD_PropLimit:,384,32;indexlist:(53,58),416,32;Prop_IO_Buf:(43,33),448,32;PropIO_allocated:(0,5),480,32;PropCompressionLevel:(0,1),512,32;TotalWords:(0,1),544,32;TotalFiles:(0,1),576,32;verbose:(0,1),608,32;commonerror:(0,1),640,32;lasterror:(0,1),672,32;lasterrorstr:(53,125)=ar(5,33);0;500;(0,2),704,4008;isvowellookuptable:(53,43),4736,8192;dirlist:(53,38),12928,32;suffixlist:(53,38),12960,32;mtime_limit:(23,2),12992,32;truncateDocSize:(0,3),13024,32;replaceRegexps:(53,86),13056,32;pathExtractList:(53,126)=*(53,87),13088,32;nocontentslist:(53,38),13120,32;DefaultDocType:(0,1),13152,32;indexcontents:(53,70),13184,32;indexComments:(0,1),13216,32;storedescription:(53,24),13248,32;ignoremetalist:(53,38),13280,32;dontbumpstarttagslist:(53,38),13312,32;dontbumpendtagslist:(53,38),13344,32;UndefinedMetaTags:(53,91),13376,32;UndefinedXMLAttributes:(53,91),13408,32;parser_warn_level:(0,1),13440,32;obeyRobotsNoIndex:(0,1),13472,32;links_meta:(53,47),13504,32;images_meta:(53,47),13536,32;IndexAltTag:(0,1),13568,32;IndexAltTagMeta:(5,36),13600,32;AbsoluteLinks:(0,1),13632,32;XMLClassAttributes:(53,38),13664,32;;SWISH:t(53,127)=(53,56)StringList:t(53,128)=(53,129)=s8n:(0,1),0,32;word:(53,45),32,32;;_indexing_data_source_def:T(53,130)=s16IndexingDataSourceName:(23,7),0,32;IndexingDataSourceId:(23,7),32,32;indexpath_fn:(53,131)=*(53,132)=f(0,20),64,32;parseconfline_fn:(53,133)=*(53,134)=f(0,1),96,32;;no_better_place_module.hinitModule_ResultOutput:F(0,20)sw:p(0,21)=*(53,127)md:r(53,101)freeModule_ResultOutput:F(0,20)l:r(129,2)ln:r(129,2)configModule_ResultOutput:F(0,1)sl:p(0,22)=*(53,128)sl:r(0,22)md:(53,101)w0:r(5,36)cmdlineModule_ResultOutput:F(0,1)opt:p(0,1)args:p(53,45)initPrintExtResult:F(0,20)fmt:p(5,36)fmt:r(5,36)propname:(5,36)subfmt:(5,36)printSortedResults:F(0,20)r:r(53,98)fi:(0,23)=*(53,17)resultmaxhits:(0,1)resultbeginhits:r(0,1)counter:(0,1)delimiter:r(5,36)f_out:(53,23)format:r(5,36)printExtResultEntry:f(0,20)f_out:p(53,23)r:p(53,98)f:r(53,23)printResultControlChar:f(5,36)f:p(53,23)s:p(5,36)s:r(5,36)se:(5,36)printTagAbbrevControl:f(5,36)t:r(5,36)buf:(0,24)=ar(5,33);0;999;(0,2)parsePropertyResultControl:f(5,36)propertyname:p(53,45)subfmt:p(53,45)s1:r(5,36)len:r(0,1)printPropertyResultControl:f(0,20)propname:p(5,36)subfmt:p(5,36)f:(53,23)pv:(0,25)=*(53,94)c:r(5,36)addResultExtFormatStr:f(129,2)rp:p(129,2)name:p(5,36)fmtstr:p(5,36)rp:r(129,2)name:r(5,36)newnode:r(129,2)hasResultExtFmtStr:F(5,36)rfl:r(129,2)resultHeaderOut:F(0,1)min_verbose:p(0,1)printfmt:p(5,36)resultPrintHeader:F(0,20)h:p(0,26)=*(53,41)pathname:p(5,36)merged:p(0,1)min_verbose:r(0,1)merged:r(0,1)fname:(5,36)rank.cswish_log:S(0,21)=ar(0,1);0;-1;(0,1)swish_log10:S(0,22)=ar(0,1);0;-1;(0,1)RankFactor:t(0,23)=(0,24)=s8mask:(0,1),0,32;rank:(0,1),32,32;;ranks:S(0,25)=ar(0,1);0;-1;(0,23)getrank:F(0,1)sw:p(0,26)=*(1,127)freq:p(0,1)tfreq:p(0,1)freq:r(0,1)factor:r(0,1)reduction:r(0,1)words:(0,1)getrank_old:F(0,1)sw:p(0,26)factor:(0,13)rank:(0,13)reduction:r(0,13)hash.chash:F(0,4)bighash:F(0,4)numhash:F(0,4)i:p(0,1)bignumhash:F(0,4)verybighash:F(0,4)addStopList:F(0,20)header:p(0,21)=*(1,41)header:r(0,21)arrayWord:r(7,36)addstophash:F(0,20)header:p(0,21)isstopword:F(0,1)addbuzzwordhash:F(0,20)freebuzzwordhash:F(0,20)isbuzzword:F(0,1)freestophash:F(0,20)freeStopList:F(0,20)addusehash:F(0,20)isuseword:F(0,1)compress.cramdisk.hcompress1:F(0,20)fp:p(1,23)f_putc:p(124,22)fp:r(1,23)_i:r(0,1)_r:r(0,1)_s:(0,21)=ar(7,33);0;4;(0,11)SW_compress2:F(19,34)buffer:p(19,34)buffer:r(19,34)compress3:F(19,34)_s:(0,21)uncompress1:F(0,1)f_getc:p(124,20)f_getc:r(124,20)_c:r(0,1)uncompress2:F(0,1)buffer:p(0,22)=*(19,34)buffer:r(0,22)p:r(19,34)PACKLONG:F(0,5)num:p(0,5)num:r(0,5)_i:(0,5)PACKLONG2:F(0,20)UNPACKLONG:F(0,5)UNPACKLONG2:F(0,5)compress_location_values:F(0,20)buf:p(0,22)flagp:p(0,22)flag:r(19,34)common_structure:(0,1)compress_location_positions:F(0,20)flag:p(19,34)compress_location:F(19,34)sw:p(0,23)=*(1,127)l:p(1,34)sw:r(0,23)max_size:r(0,1)flag:(19,34)uncompress_location_values:F(0,20)filenum:p(1,10)frequency:p(1,10)buf:r(0,22)filenum:r(1,10)frequency:r(1,10)four_bit_count:G(0,5)four_bit_bytes:G(0,5)not_four:G(0,5)not_four_bytes:G(0,5)four_bit_called:G(0,5)uncompress_location_positions:F(0,20)flag:p(0,1)flag:r(0,11)structure:(0,1)uncompress_location:F(1,34)sw:p(0,23)p:p(19,34)CompressCurrentLocEntry:F(0,20)next:r(1,34)SwapLocData:F(0,20)buf:p(19,34)lenbuf:p(0,1)sw:(0,23)buf:(19,34)lenbuf:(0,1)unSwapLocData:F(0,20)idx_swap_file:p(0,1)ep:p(1,66)buf:r(19,34)lenbuf:r(0,1)e:(1,66)fp:(1,23)sortSwapLocData:F(0,20)not_four_called:G(0,5)db.cdb_native.hnumhash:T(127,1)=s8index:(0,1),0,32;next:(127,2)=*(127,1),32,32;;Handle_DBNative:T(127,3)=s841204offsetstart:(0,1),0,32;sw:(127,4)=*(1,127),32,32;hashstart:(0,1),64,32;offsets:(127,5)=ar(7,33);0;265;(0,3),96,8512;hashoffsets:(127,6)=ar(7,33);0;100002;(0,3),8608,3200096;lasthashval:(127,7)=ar(7,33);0;100002;(0,1),3208704,3200096;wordhash_counter:(0,1),6408800,32;nextwordoffset:(0,3),6408832,32;lastsortedindex:(0,3),6408864,32;next_sortedindex:(0,3),6408896,32;worddata_counter:(0,1),6408928,32;wordhashdata:(127,8)=*(0,3),6408960,32;hash:(127,9)=ar(7,33);0;10000;(127,2),6408992,320032;hashzone:(120,26),6729024,32;num_words:(0,1),6729056,32;mode:(126,2),6729088,32;dbname:(7,36),6729120,32;rd:(127,10)=*(127,11)=xsramdisk:,6729152,32;w_tell:(120,12),6729184,32;w_write:(120,14),6729216,32;w_seek:(120,16),6729248,32;w_read:(120,18),6729280,32;w_close:(120,20),6729312,32;w_putc:(120,22),6729344,32;w_getc:(120,20),6729376,32;fp:(1,23),6729408,32;prop:(1,23),6729440,32;tmp_index:(0,1),6729472,32;tmp_prop:(0,1),6729504,32;cur_index_file:(7,36),6729536,32;cur_prop_file:(7,36),6729568,32;unique_ID:(0,3),6729600,32;;initModule_DB:F(0,20)sw:p(127,4)freeModule_DB:F(0,20)configModule_DB:F(0,1)sl:p(0,21)=*(1,128)write_header:F(0,20)totalwords:p(0,1)totalfiles:p(0,1)write_word:F(0,20)sw:r(127,4)wordID:r(0,3)build_worddata:F(0,20)tmp:r(0,5)curmetanamepos:(0,5)write_worddata:F(0,20)read_worddata:F(0,3)buffer:p(0,23)=*(19,34)sz_buffer:p(1,10)add_worddata:F(0,20)epi:p(1,66)olddata:p(19,34)sz_olddata:p(0,1)maxtotsize:r(0,1)stack_buffer:(0,24)=ar(7,33);0;31999;(0,11)newdata:(19,34)sz_newdata:(0,1)tfreq1:r(0,1)tfreq2:r(0,1)p1:(19,34)p2:(19,34)curmetaID_1:(0,1)curmetaID_2:r(0,1)nextposmetaname_1:(0,5)nextposmetaname_2:(0,5)curmetanamepos_1:(0,5)last_filenum:(0,1)stack_posdata:(0,25)=ar(7,33);0;1999;(0,1)write_MetaNames:F(0,20)id:p(0,1)sw:(127,4)id:(0,1)header:(0,22)DB:(0,19)entry:r(1,47)s:r(19,34)write_words_to_header:F(0,1)header_ID:p(0,1)hash:p(0,26)=*(1,38)num_words:r(0,1)buffer:(7,36)write_integer_table_to_header:F(0,1)table:p(1,10)table_size:p(0,1)table_size:r(0,1)buffer:r(7,36)read_header:F(0,20)len:(0,1)tmp1:r(0,5)tmp2:r(0,5)parse_MetaNames_from_buffer:F(0,20)num_metanames:r(0,1)metaType:r(0,1)alias:(0,1)bias:r(0,1)parse_stopwords_from_buffer:F(0,20)parse_buzzwords_from_buffer:F(0,20)parse_integer_table_from_buffer:F(0,20)getfilewords:F(7,36)j:(0,1)wordlen:r(0,1)bufferpos:(0,1)bufferlen:(0,1)word:(0,27)=ar(7,33);0;1;(0,11)setTotalWordsPerFile:F(0,20)idx:p(0,1)wordcount:p(0,1)idx:r(0,1)getTotalWordsPerFile:F(0,20)wordcount:p(1,10)wordcount:r(1,10)DB_Create:F(0,19)dbname:p(7,36)DB_Open:F(0,19)mode:p(0,1)DB_Close:F(0,20)DB_Remove:F(0,20)DB_InitWriteHeader:F(0,1)DB_WriteHeaderData:F(0,1)s:p(19,34)len:p(0,1)DB_EndWriteHeader:F(0,1)DB_InitReadHeader:F(0,1)DB_ReadHeaderData:F(0,1)id:p(1,10)s:p(0,23)len:p(1,10)DB_EndReadHeader:F(0,1)DB_InitWriteWords:F(0,1)DB_GetWordID:F(0,3)DB_WriteWord:F(0,1)wordID:p(0,3)DB_WriteWordHash:F(0,1)DB_WriteWordData:F(0,3)lendata:p(0,1)DB_EndWriteWords:F(0,1)DB_InitReadWords:F(0,1)DB_ReadWordHash:F(0,1)wordID:p(127,8)DB_ReadFirstWordInvertedIndex:F(0,1)resultword:p(1,45)DB_ReadNextWordInvertedIndex:F(0,1)DB_ReadWordData:F(0,3)worddata:p(0,23)lendata:p(1,10)DB_EndReadWords:F(0,1)DB_InitWriteFiles:F(0,1)DB_WriteFile:F(0,1)filedata:p(19,34)sz_filedata:p(0,1)DB_EndWriteFiles:F(0,1)DB_InitReadFiles:F(0,1)DB_ReadFile:F(0,1)filedata:p(0,23)sz_filedata:p(1,10)DB_EndReadFiles:F(0,1)DB_InitWriteSortedIndex:F(0,1)DB_WriteSortedIndex:F(0,1)propID:p(0,1)data:p(19,34)sz_data:p(0,1)DB_EndWriteSortedIndex:F(0,1)DB_InitReadSortedIndex:F(0,1)DB_ReadSortedIndex:F(0,1)data:p(0,23)sz_data:p(1,10)DB_ReadSortedData:F(0,1)data:p(1,10)index:p(0,1)value:p(1,10)DB_EndReadSortedIndex:F(0,1)DB_WriteProperty:F(0,20)fi:p(0,28)=*(1,17)buf_len:p(0,1)uncompressed_len:p(0,1)db:p(0,19)DB_WritePropPositions:F(0,20)fi:p(0,28)DB_ReadPropPositions:F(0,20)DB_ReadProperty:F(7,36)buf_len:p(1,10)uncompressed_len:p(1,10)DB_Reopen_PropertiesForRead:F(0,20)db_native.cnumhash:T(128,1)=s8index:(0,1),0,32;next:(128,2)=*(128,1),32,32;;Handle_DBNative:T(128,3)=s841204offsetstart:(0,1),0,32;sw:(128,4)=*(16,127),32,32;hashstart:(0,1),64,32;offsets:(128,5)=ar(7,33);0;265;(0,3),96,8512;hashoffsets:(128,6)=ar(7,33);0;100002;(0,3),8608,3200096;lasthashval:(128,7)=ar(7,33);0;100002;(0,1),3208704,3200096;wordhash_counter:(0,1),6408800,32;nextwordoffset:(0,3),6408832,32;lastsortedindex:(0,3),6408864,32;next_sortedindex:(0,3),6408896,32;worddata_counter:(0,1),6408928,32;wordhashdata:(128,8)=*(0,3),6408960,32;hash:(128,9)=ar(7,33);0;10000;(128,2),6408992,320032;hashzone:(128,10)=*(116,4),6729024,32;num_words:(0,1),6729056,32;mode:(125,2),6729088,32;dbname:(7,36),6729120,32;rd:(128,11)=*(128,12)=xsramdisk:,6729152,32;w_tell:(128,13)=*(128,14)=f(0,3),6729184,32;w_write:(128,15)=*(128,16)=f(5,1),6729216,32;w_seek:(128,17)=*(128,18)=f(0,1),6729248,32;w_read:(128,19)=*(128,20)=f(5,1),6729280,32;w_close:(128,21)=*(128,22)=f(0,1),6729312,32;w_putc:(128,23)=*(128,24)=f(0,1),6729344,32;w_getc:(128,21),6729376,32;fp:(16,23),6729408,32;prop:(16,23),6729440,32;tmp_index:(0,1),6729472,32;tmp_prop:(0,1),6729504,32;cur_index_file:(7,36),6729536,32;cur_prop_file:(7,36),6729568,32;unique_ID:(0,3),6729600,32;;initModule_DBNative:F(0,20)sw:p(128,4)sw:r(128,4)Db:r(16,109)freeModule_DBNative:F(0,20)configModule_DBNative:F(0,1)sl:p(0,21)=*(16,128)DB_CheckHeader:f(0,20)DB:p(0,22)=*(128,3)DB:r(0,22)swish_magic:r(0,3)prop:r(0,3)newNativeDBHandle:f(0,22)dbname:r(7,36)DB_Create_Native:F(0,19)DB_Open_Native:F(0,19)mode:r(0,1)DB:(0,22)openRoutine:(0,23)=*(0,24)=f(16,23)DB_Close_File_Native:f(0,20)fp:p(0,25)=*(16,23)filename:p(16,45)tempflag:p(16,10)fp:r(0,25)filename:r(16,45)newname:r(7,36)DB_Close_Native:F(0,20)fp:(16,23)DB_Remove_Native:F(0,20)db:r(0,19)DB_InitWriteHeader_Native:F(0,1)DB_EndWriteHeader_Native:F(0,1)DB_WriteHeaderData_Native:F(0,1)s:p(28,33)s:r(28,33)fp:r(16,23)DB_InitReadHeader_Native:F(0,1)DB_ReadHeaderData_Native:F(0,1)id:p(16,10)s:p(0,26)=*(28,33)len:p(16,10)id:r(16,10)DB_EndReadHeader_Native:F(0,1)DB_InitWriteWords_Native:F(0,1)cmp_wordhashdata:F(0,1)DB_EndWriteWords_Native:F(0,1)f_hash_offset:r(0,3)f_offset:r(0,3)buffer:(0,28)=ar(7,33);0;4095;(0,11)ramdisk_size:r(0,3)read:r(0,3)DB_GetWordID_Native:F(0,3)pos:r(0,3)DB_WriteWord_Native:F(0,1)DB_WriteWordData_Native:F(0,3)worddata:p(28,33)numhash:r(128,2)numhashval:r(0,1)DB_WriteWordHash_Native:F(0,1)DB_InitReadWords_Native:F(0,1)DB_EndReadWords_Native:F(0,1)DB_ReadWordHash_Native:F(0,1)wordID:p(128,8)offset:r(0,3)dataoffset:(0,3)fileword:r(7,36)DB_ReadFirstWordInvertedIndex_Native:F(0,1)resultword:p(16,45)DB_ReadNextWordInvertedIndex_Native:F(0,1)dataoffset:r(0,3)DB_ReadWordData_Native:F(0,3)worddata:p(0,26)lendata:p(16,10)buffer:r(28,33)DB_EndWriteFiles_Native:F(0,1)DB_WriteFile_Native:F(0,1)filedata:p(28,33)DB_InitReadFiles_Native:F(0,1)DB_ReadFile_Native:F(0,1)filedata:p(0,26)sz_filedata:p(16,10)DB_EndReadFiles_Native:F(0,1)DB_InitWriteSortedIndex_Native:F(0,1)DB_WriteSortedIndex_Native:F(0,1)data:p(28,33)propID:r(0,1)tmp1:(0,3)DB_EndWriteSortedIndex_Native:F(0,1)DB_InitReadSortedIndex_Native:F(0,1)DB_ReadSortedIndex_Native:F(0,1)data:p(0,26)sz_data:p(16,10)sz_data:r(16,10)next:r(0,3)id:r(0,3)tmp:r(0,3)DB_ReadSortedData_Native:F(0,1)data:p(16,10)value:p(16,10)data:r(16,10)index:r(0,1)value:r(16,10)DB_EndReadSortedIndex_Native:F(0,1)printlong:F(0,20)fp:p(16,23)f_write:p(128,15)f_write:r(128,15)readlong:F(0,5)f_read:p(128,19)num:(0,5)DB_InitWriteFiles_Native:F(0,1)DB_WriteProperty_Native:F(0,20)indexf:p(16,58)fi:p(0,29)=*(16,17)written_bytes:r(5,1)pindex:r(16,20)prop_loc:r(0,30)=*(16,12)header:r(0,31)=*(16,41)count:r(0,1)index_size:r(0,1)propIDX:(0,1)DB_WritePropPositions_Native:F(0,20)fi:p(0,29)header:r(0,31)DB_ReadPropPositions_Native:F(0,20)seek_pos:r(0,3)DB_ReadProperty_Native:F(7,36)buf_len:p(16,10)uncompressed_len:p(16,10)buf_len:r(16,10)uncompressed_len:r(16,10)propIDX:r(0,1)length:r(0,3)DB_Reopen_PropertiesForRead_Native:F(0,20)no_rename:(0,1)ramdisk.cramdisk:T(0,21)=s24cur_pos:(0,5),0,32;end_pos:(0,5),32,32;n_buffers:(0,4),64,32;buf_size:(0,4),96,32;buffer:(0,22)=*(19,34),128,32;zone:(0,23)=*(115,4),160,32;;ramdisk_create:F(0,24)=*(0,21)buf_size:p(0,1)name:r(7,36)buf_size:r(0,1)rd:r(0,24)ramdisk_close:F(0,1)add_buffer_ramdisk:F(0,20)rd:p(0,24)ramdisk_tell:F(0,3)ramdisk_write:F(6,1)buffer:p(0,25)=*(0,20)sz1:p(6,1)sz2:p(6,1)sz2:r(6,1)lenbuf:r(0,4)num_buffer:(0,4)start_pos:r(0,4)tmplenbuf:(0,4)avail:r(0,4)ramdisk_seek:F(0,1)pos:p(0,3)set:p(0,1)set:r(0,1)ramdisk_read:F(6,1)buf:p(0,19)len:(0,4)num_buffer:r(0,4)buffer_offset:(0,4)ramdisk_getc:F(0,1)c:(0,11)ramdisk_putc:F(0,1)tmp:(0,11)check.cisokword:F(0,1)same:(0,1)numberrow:r(0,1)vowelrow:(0,1)consrow:(0,1)lastchar:r(0,2)getdoctype:F(0,1)indexcontents:p(1,70)indexcontents:r(1,70)swl:r(1,38)fe:(7,36)hasdescription:F(1,24)doctype:p(0,1)sd:p(1,24)sd:r(1,24)file.cssize_t:t(2,1)=(7,26)intptr_t:t(2,2)=(7,57)socklen_t:t(2,3)=(7,58)u_char:t(57,1)=(7,1)u_short:t(57,2)=(7,2)u_int:t(57,3)=(7,3)u_long:t(57,4)=(7,4)quad_t:t(57,5)=(7,6)u_quad_t:t(57,6)=(7,5)fsid_t:t(57,7)=(7,30)loff_t:t(57,8)=(7,24)ino_t:t(57,9)=(7,20)dev_t:t(57,10)=(7,17)gid_t:t(57,11)=(7,19)mode_t:t(57,12)=(7,21)nlink_t:t(57,13)=(7,22)uid_t:t(57,14)=(7,18)off_t:t(57,15)=(7,23)pid_t:t(57,16)=(7,25)id_t:t(57,17)=(7,29)daddr_t:t(57,18)=(7,34)caddr_t:t(57,19)=(7,35)key_t:t(57,20)=(7,44)ulong:t(57,21)=(0,5)ushort:t(57,22)=(0,9)uint:t(57,23)=(0,4)int8_t:t(57,24)=(0,10)int16_t:t(57,25)=(0,8)int32_t:t(57,26)=(0,1)int64_t:t(57,27)=(0,6)u_int8_t:t(57,28)=(0,11)u_int16_t:t(57,29)=(0,9)u_int32_t:t(57,30)=(0,4)u_int64_t:t(57,31)=(0,7)register_t:t(57,32)=(0,1)blkcnt_t:t(57,33)=(7,47)fsblkcnt_t:t(57,34)=(7,49)fsfilcnt_t:t(57,35)=(7,51)div_t:t(111,1)=(111,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(111,3)=(111,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;random_data:T(111,5)=s28fptr:(111,6)=*(57,26),0,32;rptr:(111,6),32,32;state:(111,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(111,6),192,32;;drand48_data:T(111,7)=s24__x:(111,8)=ar(7,33);0;2;(0,9),0,48;__old_x:(111,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;__compar_fn_t:t(111,9)=(111,10)=*(111,11)=f(0,1)normalize_path:F(0,20)path:r(7,36)isdirectory:F(0,1)stbuf:(78,1)isfile:F(0,1)islink:F(0,1)getsize:F(0,1)openIndexFILEForWrite:F(15,23)openIndexFILEForRead:F(15,23)openIndexFILEForReadAndWrite:F(15,23)CreateEmptyFile:F(0,20)fp:r(15,23)indexpath:F(0,20)sw:p(0,21)=*(15,127)read_stream:F(7,36)fp:p(15,23)filelen:p(0,3)max_size:p(0,3)filelen:r(0,3)c:r(0,3)offset:(0,3)bufferlen:r(0,3)buffer:r(27,34)tmp:r(27,34)bytes_read:(9,1)flush_stream:F(0,20)fprop:p(0,22)=*(15,21)fprop:r(0,22)tmpbuf:(0,23)=ar(7,33);0;4095;(0,2)read:r(0,1)init_file_properties:F(0,22)fprop:(0,22)init_file_prop_settings:F(0,20)fprop:p(0,22)file_properties:F(0,22)real_path:p(7,36)work_file:p(7,36)real_path:r(7,36)work_file:r(7,36)free_file_properties:F(0,20)temp_file_template:S(7,36)create_tempfile:F(15,23)f_mode:p(27,32)prefix:p(7,36)file_name_buffer:p(15,45)remove_file_name:p(0,1)file_name_buffer:r(15,45)temp_fd:r(0,1)old_mode:r(57,12)temp_file:r(15,23)file_name:r(7,36)file_name_len:r(0,1)idx:(15,113)tmpdir:r(7,36)error.cset_error_handle:F(0,20)where:p(1,23)where:r(1,23)SwishErrorsToStderr:F(0,20)progerr:F(0,20)msgfmt:p(7,36)msgfmt:r(7,36)progerrno:F(0,20)set_progerr:F(0,20)errornum:p(0,1)errornum:r(0,1)set_progerrno:F(0,20)errstr:r(7,36)progwarn:F(0,20)progwarnno:F(0,20)error_msg_map:t(0,22)=(0,23)=s12critical:(0,1),0,32;error_num:(0,1),32,32;message_string:(7,36),64,32;;swishErrors:S(0,24)=ar(0,1);0;-1;(0,22)SwishError:F(0,1)SwishErrorString:F(7,36)SwishLastErrorMsg:F(7,36)getErrorString:F(7,36)number:p(0,1)number:r(0,1)message:V(0,25)=ar(7,33);0;49;(0,2)SwishCriticalError:F(0,1)SwishAbortLastError:F(0,20)FUZZY_OPTS:t(0,26)=(0,27)=s8fuzzy_mode:(1,40),0,32;name:(7,36),32,32;;fuzzy_opts:S(0,28)=ar(0,1);0;-1;(0,26)set_fuzzy_mode:F(1,40)param:p(7,36)param:r(7,36)fuzzy_mode_to_string:F(7,36)mode:p(1,40)mode:r(1,40)error_handle:G(1,23)list.caddswline:F(1,38)rp:p(1,38)line:p(7,36)rp:r(1,38)line:r(7,36)newnode:r(1,38)dupswline:F(1,38)tmp2:(1,38)addindexfile:F(1,58)rp:p(1,58)rp:r(1,58)newnode:r(1,58)freeswline:F(0,20)tmplist:p(1,38)tmplist:r(1,38)tmplist2:r(1,38)freeindexfile:F(0,20)tmplist:p(1,58)tmplist2:r(1,58)init_header:F(0,20)free_header:F(0,20)splitswline:F(0,20)p:r(7,36)mem.cemalloc:F(0,19)size:p(5,1)size:r(5,1)p:r(0,19)erealloc:F(0,19)ptr:p(0,19)efree:F(0,20)ptr:r(0,19)Mem_Summary:F(0,20)title:p(6,36)final:p(0,1)_zone:T(121,3)=s20next:(121,2),0,32;free:(5,1),32,32;ptr:(18,34),64,32;alloc:(0,19),96,32;size:(5,1),128,32;;ZONE:t(0,21)=(121,3)allocChunk:f(0,22)=*(0,21)zone:r(0,22)Mem_ZoneCreate:F(0,23)=*(121,4)name:p(6,36)attributes:p(0,1)name:r(6,36)attributes:r(0,1)head:r(0,23)Mem_ZoneAlloc:F(0,19)head:p(0,23)newzone:r(0,22)ptr:r(18,34)Mem_ZoneFree:F(0,20)head:p(0,24)=*(0,23)head:r(0,24)next:r(0,22)tmp:r(0,22)Mem_ZoneReset:F(0,20)Mem_ZoneSize:F(0,1)string.clstrstr:F(5,36)t:p(5,36)lens:r(0,1)lent:(0,1)first:(0,1)getword:f(5,36)in_buf:p(13,45)quotechar:(0,11)uc:r(0,11)start:(5,36)buf:(0,21)=ar(5,33);0;1000;(0,2)cur_char:r(5,36)getconfvalue:F(5,36)line:p(5,36)var:p(5,36)line:r(5,36)var:r(5,36)lentmpvalue:(0,1)tmpvalue:r(5,36)p:r(5,36)replace:F(5,36)string:p(5,36)oldpiece:p(5,36)newpiece:p(5,36)limit:r(0,1)curpos:r(0,1)lennewpiece:(0,1)lenoldpiece:(0,1)curnewlen:(0,1)c:(5,36)q:r(5,36)lennewstring:(0,1)newstring:(5,36)isoksuffix:F(0,1)filename:p(5,36)rulelist:p(13,38)filename:r(5,36)rulelist:r(13,38)fe:(5,36)SafeStrCopy:F(5,36)dest:p(5,36)orig:p(5,36)initialsize:p(13,10)dest:r(5,36)initialsize:r(13,10)oldlen:r(0,1)ccomp:F(0,1)s1:p(0,22)=*(0,20)s2:p(0,22)s1:r(0,22)s2:r(0,22)sortstring:F(0,20)mergestrings:F(5,36)s1:p(5,36)s2:p(5,36)ilen1:r(0,1)ilen2:(0,1)ilent:(0,1)p:(5,36)makelookuptable:F(0,20)l:p(13,10)l:r(13,10)makeallstringlookuptables:F(0,20)sw:p(0,23)=*(13,127)parse_line:F(0,24)=*(13,128)sl:r(0,24)cursize:r(0,1)maxsize:(0,1)freeStringList:F(0,20)sl:p(0,24)SafeMemCopy:F(25,34)dest:p(25,34)orig:p(25,34)off_dest:p(0,1)sz_dest:p(13,10)dest:r(25,34)off_dest:r(0,1)sz_dest:r(13,10)isnumstring:F(0,1)s:p(25,34)s:r(25,34)remove_newlines:F(0,20)remove_tags:F(0,20)intag:r(0,1)bin2string:F(25,34)data:p(25,34)data:r(25,34)str_skip_ws:F(5,36)str_trim_ws:F(0,20)string:r(5,36)charDecode_C_Escape:F(0,2)se:p(13,45)se:r(13,45)se2:(5,36)strtolower:F(5,36)p:r(25,34)iso8859_to_ascii7_lower_map:S(0,25)=ar(0,1);0;-1;(0,11)char_ISO_normalize:F(0,11)str_ISO_normalize:F(5,36)StringListToString:F(25,34)len_s:(0,1)len_w:r(0,1)TranslateChars:F(25,34)trlookup:p(13,10)trlookup:r(13,10)BuildTranslateChars:F(0,1)from:p(25,34)to:p(25,34)cstr_basename:F(5,36)path:p(5,36)str_basename:F(5,36)path:r(5,36)cstr_dirname:F(5,36)dir:r(5,36)estrdup:F(5,36)str:p(5,36)str:r(5,36)estrndup:F(5,36)n:p(7,1)n:r(7,1)lens:r(7,1)newlen:r(7,1)news:r(5,36)estrredup:F(5,36)s2:r(5,36)docprop.cfreeProperty:F(0,20)prop:p(12,11)prop:r(12,11)freeDocProperties:F(0,20)docProperties:p(12,19)docProperties:r(12,19)freefileinfo:F(0,20)fi:p(0,21)=*(12,17)fi:r(0,21)DecodeDocProperty:F(16,36)meta_entry:p(12,47)i:(0,5)getDocProperty:f(12,11)sw:p(0,22)=*(12,127)result:p(12,98)meta_entry:p(12,46)result:r(12,98)meta_entry:r(12,46)getResultPropAsString:F(16,36)sw:p(0,22)ID:p(0,1)meta_entry:(12,47)SwishResultPropertyStr:F(16,36)pname:p(16,36)sw:r(0,22)indexf:r(12,58)SwishResultPropertyULong:F(0,5)pname:r(16,36)pv:r(0,23)=*(12,94)value:r(0,5)getResultPropValue:F(0,23)r:p(12,98)r:r(12,98)pv:r(0,23)i:r(0,4)i:r(0,5)freeResultPropValue:F(0,20)pv:p(0,23)printStandardResultProperties:F(0,20)f:p(12,23)srch:(12,111)propValue:r(16,36)metaIDs:(12,10)EncodeProperty:f(0,1)encodedStr:p(12,45)propstring:p(16,36)error_flag:p(12,10)error_flag:r(12,10)newstr:r(16,36)tmpnum:r(16,36)string:(16,36)source:r(16,36)dest:r(16,36)CreateProperty:F(12,11)propValue:p(28,34)propLen:p(0,1)preEncoded:p(0,1)propValue:r(28,34)propLen:r(0,1)docProp:r(12,11)tmp:(16,36)append_property:F(12,11)p:p(12,11)txt:p(16,36)p:r(12,11)txt:r(16,36)newlen:r(0,1)add_a_space:(0,1)str:(16,36)addDocProperties:F(0,20)header:p(0,24)=*(12,41)docProperties:p(0,25)=*(12,19)filename:p(16,36)header:r(0,24)addDocProperty:F(0,1)docProperties:p(0,25)docProperties:r(0,25)dp:r(0,26)=*(12,5)Compare_Properties:F(0,1)p1:p(12,11)p2:p(12,11)p1:r(12,11)p2:r(12,11)duplicate_in_mem_property:f(12,11)props:p(12,19)props:r(12,19)meta_entry:(12,9)allocatePropIOBuffer:f(28,34)buf_needed:p(0,5)buf_needed:r(0,5)total_size:r(0,5)compress_property:f(28,34)buf_len:p(12,10)uncompressed_len:p(12,10)PropBuf:r(28,34)dest_size:(0,1)uncompress_property:f(28,34)input_buf:p(28,34)uncompressed_size:p(12,10)input_buf:r(28,34)uncompressed_size:r(12,10)WritePropertiesToDisk:F(0,20)fi:p(0,21)header:(0,24)docProperties:(12,19)uncompressed_len:(0,1)buf:r(28,34)buf_len:(0,1)ReadSingleDocPropertiesFromDisk:F(12,11)propbuf:r(28,34)ReadAllDocPropertiesFromDisk:F(12,19)fi:(12,17)new_prop:r(12,11)addSearchResultDisplayProperty:F(0,20)propName:p(16,36)srch:r(12,111)initSearchResultProperties:F(0,1)dump_single_property:F(0,20)propstr:r(16,36)proptype:r(0,2)dump_file_properties:F(0,20)metanames.cdefaultMetaNames:t(0,21)=(0,22)=s8metaName:(7,36),0,32;metaType:(0,1),32,32;;SwishDefaultMetaNames:S(0,23)=ar(0,1);0;-1;(0,21)add_default_metanames:F(0,20)addMetaEntry:F(1,47)header:p(0,24)=*(1,41)metaname:p(7,36)metaType:p(0,1)metaname:r(7,36)tmpEntry:r(1,47)metaWord:r(7,36)create_meta_entry:f(1,47)newEntry:(1,47)addNewMetaEntry:F(1,47)header:p(0,24)metaWord:p(7,36)metaCounter:r(0,1)newEntry:r(1,47)metaEntryArray:r(1,46)ClearInMetaFlags:F(0,20)init_property_list:F(0,20)getMetaNameByNameNoAlias:F(1,47)getMetaNameByName:F(1,47)getMetaNameByID:F(1,47)getPropNameByNameNoAlias:F(1,47)getPropNameByName:F(1,47)getPropNameByID:F(1,47)is_meta_entry:F(0,1)freeMetaEntries:F(0,20)meta:r(1,47)isDontBumpMetaName:F(0,1)tag:p(7,36)tmptag:r(7,36)result_sort.cPROP_LOOKUP:t(0,21)=(0,22)=s8prop_index:(1,20),0,32;SortProp:(1,11),32,32;;PropLookup:S(0,23)=*(0,21)initModule_ResultSort:F(0,20)sw:p(0,24)=*(1,127)sw:r(0,24)md:r(1,105)resetModule_ResultSort:F(0,20)sw:p(0,24)freeModule_ResultSort:F(0,20)configModule_ResultSort:F(0,1)sl:p(0,25)=*(1,128)sl:r(0,25)md:(1,105)w1:(19,34)w2:(19,34)w3:(19,34)incr:(0,1)addSearchResultSortProperty:F(0,20)propName:p(7,36)rs:r(1,105)initSortResultProperties:F(0,1)compResultsByNonSortedProps:F(0,1)s1:p(0,26)=*(0,20)s2:p(0,26)s1:r(0,26)s2:r(0,26)num_fields:r(0,1)ResultSort:r(1,105)compResultsBySortedProps:F(0,1)s1:p(0,26)ResultSort:(1,105)LoadSortedProps:F(1,10)m:p(1,47)getLookupResultSortedProperties:F(1,10)props:r(1,10)getResultSortProperties:F(1,45)props:r(1,45)sortresults:F(0,1)TotalResults:(0,1)ptmp:r(0,27)=*(1,98)db_results:(1,97)compResults:(103,10)rs:(1,105)presorted_data_not_available:(0,1)compFileProps:f(0,1)is_presorted_prop:F(0,1)CreatePropSortArray:F(1,10)free_cache:p(0,1)fi:r(0,28)sort_array:(1,10)out_array:(1,10)total_files:(0,1)k:(0,1)sortFileProperties:F(0,20)out_buffer:r(19,34)cur:r(19,34)props_sorted:(0,1)header:(0,29)=*(1,41)iTranslationTableExceptions:G(0,30)=ar(0,1);0;-1;(0,31)=s8from:(0,11),0,8;order:(0,11),8,8;offset:(0,1),32,32;;initStrCaseCmpTranslationTable:F(0,20)iCaseTranslationTable:p(1,10)iCaseTranslationTable:r(1,10)initStrCmpTranslationTable:F(0,20)sw_strcasecmp:F(0,1)s1:p(19,34)s2:p(19,34)iTranslationTable:p(1,10)s1:r(19,34)s2:r(19,34)iTranslationTable:r(1,10)sw_strcmp:F(0,1)CurrentPreSortMetaEntry:S(1,47)dump.cdump_index_file_list:F(0,20)end:(0,1)p:r(1,11)header:(0,22)=*(1,41)count:(0,1)DB_decompress:F(0,20)metaname:(0,1)word:(0,23)=ar(7,33);0;1;(0,2)worddata:(19,34)meta_used:(1,10)end_meta:(0,1)check_sorted_index:F(0,1)dump_metanames:F(0,20)check_presorted:p(0,1)check_presorted:(0,1)swish_qsort.csize_t:t(5,1)=(0,4)wchar_t:t(5,2)=(0,3)cmp_t:t(0,21)=(1,11)swapfunc:f(0,20)a:p(8,36)b:p(8,36)swaptype:p(0,1)a:r(8,36)b:r(8,36)i:r(0,3)pi:r(0,22)=*(0,3)pj:r(0,22)pi:r(8,36)pj:r(8,36)med3:f(8,36)c:p(8,36)cmp:p(0,23)=*(0,21)c:r(8,36)swish_qsort:F(0,20)a:p(0,19)n:p(5,1)es:p(5,1)cmp:p(0,23)pa:(8,36)pb:r(8,36)pc:r(8,36)pd:(8,36)pl:r(8,36)pm:(8,36)pn:(8,36)d:r(0,1)r:r(0,1)swaptype:(0,1)swap_cnt:(0,1)date_time.c/usr/include/sys/time.htimezone:T(120,1)=s8tz_minuteswest:(0,1),0,32;tz_dsttime:(0,1),32,32;;__timezone_ptr_t:t(120,2)=(120,3)=*(120,1)__itimer_which:T(120,4)=eITIMER_REAL:0,ITIMER_VIRTUAL:1,ITIMER_PROF:2,;itimerval:T(120,5)=s16it_interval:(70,1),0,64;it_value:(70,1),64,64;;__itimer_which_t:t(120,6)=(0,1)TimeElapsed:F(0,13)t:(70,1)TimeCPU:F(0,13)getTheDateISO:F(7,36)date:r(7,36)now:(1,2)no_better_place_module.ctranslatecharHeaderOut:F(0,20)v:p(0,1)h:p(0,22)=*(1,41)v:(0,1)h:(0,22)from_pos:r(0,1)to_pos:(0,1)from:(7,36)to:(7,36)fs.cDOCENTRYARRAY:t(0,21)=(0,22)=s12currentsize:(0,1),0,32;maxsize:(0,1),32,32;filenames:(1,45),64,32;;initModule_FS:F(0,20)fs:(1,115)freeModule_FS:F(0,20)fs:r(1,115)configModule_FS:F(0,1)sl:p(0,24)=*(1,128)get_rules:f(0,1)pathlist:p(0,25)=*(124,1)w1:r(7,36)both:r(7,36)regex_pattern:(0,1)new:r(7,36)fs_already_indexed:f(0,1)p:r(120,2)buf:(70,1)key:(0,26)=ar(7,33);0;33;(0,2)hashval:(0,4)indexadir:f(0,20)dir:p(7,36)dir:(7,36)allgoodfiles:(0,1)dfd:(0,27)=*(92,2)dp:(0,28)=*(95,1)pathbuflen:(0,1)pathname:r(7,36)sortfilelist:(0,29)=*(0,21)sortdirlist:(0,29)dirlen:(0,1)filelen:r(0,1)indexafile:f(0,20)check_FileTests:f(0,1)test:p(0,25)test:r(0,25)file:(7,36)split_path:f(0,20)directory:p(1,45)file:p(1,45)file:r(1,45)p1:r(7,36)p2:r(7,36)p3:r(7,36)printfile:f(0,20)fprop:r(0,30)=*(1,21)compfilenames:F(0,1)s1:p(0,31)=*(0,20)s2:p(0,31)s1:r(0,31)s2:r(0,31)printfiles:f(0,20)e:p(0,29)e:r(0,29)printdirs:f(0,20)adddocentry:f(0,29)fs_indexpath:F(0,20)FileSystemIndexingDataSource:G(1,130)http.c__gnuc_va_list:t(24,1)=(0,19)va_list:t(24,2)=(24,1)/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(44,1)=(37,1)/usr/include/bits/signum.h__sighandler_t:t(44,2)=(44,3)=*(44,4)=f(0,20)sig_t:t(44,5)=(44,2)/usr/include/bits/siginfo.h/usr/include/bits/wordsize.hsigval:T(50,1)=u4sival_int:(0,1),0,32;sival_ptr:(0,19),0,32;;sigval_t:t(50,2)=(50,1)siginfo:T(50,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(50,4)=u116_pad:(50,5)=ar(7,33);0;28;(0,1),0,928;_kill:(50,6)=s8si_pid:(7,25),0,32;si_uid:(7,18),32,32;;,0,64;_timer:(50,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(50,8)=s12si_pid:(7,25),0,32;si_uid:(7,18),32,32;si_sigval:(50,2),64,32;;,0,96;_sigchld:(50,9)=s20si_pid:(7,25),0,32;si_uid:(7,18),32,32;si_status:(0,1),64,32;si_utime:(7,41),96,32;si_stime:(7,41),128,32;;,0,160;_sigfault:(50,10)=s4si_addr:(0,19),0,32;;,0,32;_sigpoll:(50,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(50,12)=(50,3) :T(50,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(50,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(50,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(50,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(50,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(50,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(50,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(50,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(50,21)=s64sigev_value:(50,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(50,22)=u52_pad:(50,23)=ar(7,33);0;12;(0,1),0,416;_sigev_thread:(50,24)=s8_function:(50,25)=*(50,26)=f(0,20),0,32;_attribute:(50,27)=*(10,5),32,32;;,0,64;;,96,416;;sigevent_t:t(50,28)=(50,21) :T(50,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(52,1)=s140__sigaction_handler:(52,2)=u4sa_handler:(44,2),0,32;sa_sigaction:(52,3)=*(52,4)=f(0,20),0,32;;,0,32;sa_mask:(37,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(52,5)=*(52,6)=f(0,20),1088,32;;sigvec:T(44,6)=s12sv_handler:(44,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/include/asm/sigcontext.h_fpreg:T(54,1)=s10significand:(54,2)=ar(7,33);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(54,3)=s16significand:(54,2),0,64;exponent:(0,9),64,16;padding:(54,4)=ar(7,33);0;2;(0,9),80,48;;_xmmreg:T(54,5)=s16element:(54,6)=ar(7,33);0;3;(0,5),0,128;;_fpstate:T(54,7)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(54,8)=ar(7,33);0;7;(54,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(54,9)=ar(7,33);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(54,10)=ar(7,33);0;7;(54,3),1152,1024;_xmm:(54,11)=ar(7,33);0;7;(54,5),2176,1024;padding:(54,12)=ar(7,33);0;55;(0,5),3200,1792;;sigcontext:T(54,13)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(54,14)=*(54,7),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(55,1)=s8ss_sp:(0,19),0,32;ss_onstack:(0,1),32,32;; :T(55,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(55,3)=s12ss_sp:(0,19),0,32;ss_flags:(0,1),32,32;ss_size:(9,1),64,32;;stack_t:t(55,4)=(55,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(59,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(59,2)=(7,27)rlimit:T(59,3)=s8rlim_cur:(59,2),0,32;rlim_max:(59,2),32,32;;__rusage_who:T(59,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(59,5)=s72ru_utime:(39,1),0,64;ru_stime:(39,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(59,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(57,1)=(0,1)__rusage_who_t:t(57,2)=(0,1)__priority_which_t:t(57,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(42,1)=(42,2)=u4__uptr:(42,3)=*(42,4)=xuwait:,0,32;__iptr:(42,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(42,4)=u4w_status:(0,1),0,32;__wait_terminated:(63,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(63,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(42,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(42,7)=(42,6)div_t:t(139,1)=(139,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(139,3)=(139,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;random_data:T(139,5)=s28fptr:(139,6)=*(25,26),0,32;rptr:(139,6),32,32;state:(139,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(139,6),192,32;;drand48_data:T(139,7)=s24__x:(54,4),0,48;__old_x:(54,4),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;__compar_fn_t:t(139,8)=(139,9)=*(139,10)=f(0,1) :T(67,1)=eBASEDOCTYPE:0,TXT:1,HTML:2,XML:3,WML:4,XML2:5,HTML2:6,TXT2:7,;propEntry:T(67,2)=s8propLen:(0,4),0,32;propValue:(67,3)=ar(7,33);0;0;(0,11),32,8;;propEntry:t(67,4)=(67,2)docProperties:T(67,5)=s8n:(0,1),0,32;propEntry:(67,6)=ar(7,33);0;0;(67,7)=*(67,2),32,32;;docProperties:t(67,8)=(67,5)metaEntry:T(67,9)=s48metaName:(7,36),0,32;metaID:(0,1),32,32;metaType:(0,1),64,32;inPropRange:(42,5),96,32;in_tag:(0,1),128,32;max_len:(0,1),160,32;extractpath_default:(7,36),192,32;loPropRange:(67,10)=*(67,4),224,32;hiPropRange:(67,10),256,32;alias:(0,1),288,32;rank_bias:(0,1),320,32;sorted_data:(42,5),352,32;;PROP_LOCATION:t(67,11)=(67,12)=s8length:(0,3),0,32;seek:(0,3),32,32;;PROP_INDEX:t(67,13)=(67,14)=s8prop_position:(67,15)=ar(7,33);0;0;(67,11),0,64;;FileRec:t(67,16)=(67,17)=s12filenum:(0,1),0,32;docProperties:(67,18)=*(67,8),32,32;prop_index:(67,19)=*(67,13),64,32;;FileProp:t(67,20)=(67,21)=s56fp:(67,22)=*(68,1),0,32;real_path:(7,36),32,32;orig_path:(7,36),64,32;work_path:(7,36),96,32;real_filename:(7,36),128,32;fsize:(0,3),160,32;bytes_read:(0,3),192,32;done:(0,1),224,32;external_program:(0,1),256,32;mtime:(15,2),288,32;doctype:(0,1),320,32;index_no_content:(0,1),352,32;stordesc:(67,23)=*(67,24)=xsStoreDescription:,384,32;hasfilter:(67,25)=*(67,26)=xsFilterList:,416,32;;LOCATION:T(67,27)=s20next:(67,28)=*(67,27),0,32;metaID:(0,1),32,32;filenum:(0,1),64,32;frequency:(0,1),96,32;posdata:(67,29)=ar(7,33);0;0;(0,1),128,32;;LOCATION:t(67,30)=(67,27)ENTRY:T(67,31)=s32next:(67,32)=*(67,31),0,32;tfrequency:(0,1),32,32;currentChunkLocationList:(67,33)=*(67,30),64,32;currentlocation:(67,33),96,32;allLocationList:(67,33),128,32;u1:(67,34)=s8wordID:(0,3),0,32;last_filenum:(0,1),32,32;;,160,64;word:(72,6),224,8;;ENTRY:t(67,35)=(67,31)swline:T(67,36)=s12next:(67,37)=*(67,36),0,32;nodep:(67,37),32,32;line:(7,36),64,32;; :T(67,38)=eFUZZY_NONE:0,FUZZY_STEMMING:1,FUZZY_SOUNDEX:2,FUZZY_METAPHONE:3,FUZZY_DOUBLE_METAPHONE:4,;FuzzyIndexType:t(67,39)=(67,38)INDEXDATAHEADER:t(67,40)=(67,41)=s20480lenwordchars:(0,1),0,32;wordchars:(7,36),32,32;lenbeginchars:(0,1),64,32;beginchars:(7,36),96,32;lenendchars:(0,1),128,32;endchars:(7,36),160,32;lenignorelastchar:(0,1),192,32;ignorelastchar:(7,36),224,32;lenignorefirstchar:(0,1),256,32;ignorefirstchar:(7,36),288,32;lenbumpposchars:(0,1),320,32;bumpposchars:(7,36),352,32;savedasheader:(7,36),384,32;lensavedasheader:(0,1),416,32;lennumberchars:(0,1),448,32;numberchars:(7,36),480,32;numberchars_used_flag:(0,1),512,32;lenindexedon:(0,1),544,32;indexedon:(7,36),576,32;lenindexn:(0,1),608,32;indexn:(7,36),640,32;lenindexd:(0,1),672,32;indexd:(7,36),704,32;lenindexp:(0,1),736,32;indexp:(7,36),768,32;lenindexa:(0,1),800,32;indexa:(7,36),832,32;minwordlimit:(0,1),864,32;maxwordlimit:(0,1),896,32;fuzzy_mode:(67,39),928,32;totalwords:(0,1),960,32;totalfiles:(0,1),992,32;ignoreTotalWordCountWhenRanking:(0,1),1024,32;TotalWordsPerFile:(42,5),1056,32;TotalWordsPerFileMax:(0,1),1088,32;wordcharslookuptable:(67,42)=ar(7,33);0;255;(0,1),1120,8192;begincharslookuptable:(67,42),9312,8192;endcharslookuptable:(67,42),17504,8192;ignorefirstcharlookuptable:(67,42),25696,8192;ignorelastcharlookuptable:(67,42),33888,8192;bumpposcharslookuptable:(67,42),42080,8192;translatecharslookuptable:(67,42),50272,8192;numbercharslookuptable:(67,42),58464,8192;hashstoplist:(67,43)=ar(7,33);0;1008;(67,37),66656,32288;stopList:(67,44)=*(7,36),98944,32;stopMaxSize:(0,1),98976,32;stopPos:(0,1),99008,32;propIDX_to_metaID:(42,5),99040,32;metaID_to_PropIDX:(42,5),99072,32;property_count:(0,1),99104,32;buzzwords_used_flag:(0,1),99136,32;hashbuzzwordlist:(67,43),99168,32288;is_use_words_flag:(0,1),131456,32;hashuselist:(67,43),131488,32288;metaEntryArray:(67,45)=*(67,46)=*(67,9),163776,32;metaCounter:(0,1),163808,32;;IndexFILE:T(67,47)=s21572next:(67,48)=*(67,47),0,32;nodep:(67,48),32,32;line:(7,36),64,32;total_bytes:(0,5),96,32;total_word_positions:(0,5),128,32;prop_string_cache:(67,44),160,32;DB:(0,19),192,32;header:(67,40),224,163840;keywords:(67,49)=ar(7,33);0;255;(7,36),164064,8192;propIDToDisplay:(42,5),172256,32;propIDToSort:(42,5),172288,32;meta_map:(42,5),172320,32;path_order:(42,5),172352,32;current_file:(0,1),172384,32;path_meta:(67,46),172416,32;modified_meta:(67,46),172448,32;cur_prop:(67,10),172480,32;filenum:(0,1),172512,32;merge_file_num_map:(42,5),172544,32;;IndexFILE:t(67,50)=(67,47)RESULT_LIST:T(67,51)=s12head:(67,52)=*(67,53)=xsRESULT:,0,32;tail:(67,52),32,32;sw:(67,54)=*(67,55)=xsSWISH:,64,32;;RESULT_LIST:t(67,56)=(67,51)RESULT:T(67,53)=s56next:(67,52),0,32;count:(0,1),32,32;filenum:(0,1),64,32;fi:(67,16),96,96;rank:(0,1),192,32;frequency:(0,1),224,32;tfrequency:(0,1),256,32;PropSort:(67,44),288,32;iPropSort:(42,5),320,32;indexf:(67,57)=*(67,50),352,32;reslist:(67,58)=*(67,56),384,32;posdata:(67,29),416,32;;RESULT:t(67,59)=(67,53)multiswline:T(67,60)=s8next:(67,61)=*(67,60),0,32;list:(67,37),32,32;;ENTRYARRAY:t(67,62)=(67,63)=s8numWords:(0,1),0,32;elist:(67,64)=*(67,65)=*(67,35),32,32;;url_info:T(67,66)=s8next:(67,67)=*(67,66),0,32;url:(7,36),32,32;;IndexContents:T(67,68)=s12next:(67,69)=*(67,68),0,32;DocType:(0,1),32,32;patt:(67,37),64,32;;StoreDescription:T(67,24)=s16next:(67,23),0,32;DocType:(0,1),32,32;field:(7,36),64,32;size:(0,1),96,32;;int_st:T(67,70)=s12next:(67,71)=*(67,70),0,32;index:(0,1),32,32;val:(67,29),64,32;;int_lookup_st:T(67,72)=s4044n_entries:(0,1),0,32;hash_entries:(67,73)=ar(7,33);0;1008;(67,71),32,32288;all_entries:(67,74)=ar(7,33);0;0;(67,71),32320,32;;char_st:T(67,75)=s12next:(67,76)=*(67,75),0,32;index:(0,1),32,32;val:(7,36),64,32;;char_lookup_st:T(67,77)=s4044n_entries:(0,1),0,32;hash_entries:(67,78)=ar(7,33);0;1008;(67,76),32,32288;all_entries:(67,79)=ar(7,33);0;0;(67,76),32320,32;;regex_list:T(67,80)=s60next:(67,81)=*(67,80),0,32;re:(137,7),32,256;replace:(7,36),288,32;replace_count:(0,1),320,32;replace_length:(0,1),352,32;global:(0,1),384,32;negate:(0,1),416,32;pattern:(7,36),448,32;;regex_list:t(67,82)=(67,80)path_extract_list:T(67,83)=s12next:(67,84)=*(67,83),0,32;meta_entry:(67,46),32,32;regex:(67,85)=*(67,82),64,32;;path_extract_list:t(67,86)=(67,83) :T(67,87)=ePROP_UNDEFINED:-1,PROP_UNKNOWN:0,PROP_STRING:1,PROP_INTEGER:2,PROP_FLOAT:3,PROP_DATE:4,PROP_ULONG:5,;PropType:t(67,88)=(67,87) :T(67,89)=eUNDEF_META_DISABLE:0,UNDEF_META_INDEX:1,UNDEF_META_AUTO:2,UNDEF_META_ERROR:3,UNDEF_META_IGNORE:4,;UndefMetaFlag:t(67,90)=(67,89)u_PropValue1:t(67,91)=(67,92)=u8v_str:(7,36),0,32;v_int:(0,1),0,32;v_date:(15,2),0,32;v_float:(0,13),0,64;v_ulong:(0,5),0,32;;PropValue:t(67,93)=(67,94)=s16datatype:(67,88),0,32;value:(67,91),32,64;destroy:(0,1),96,32;;DB_RESULTS:T(67,95)=s16next:(67,96)=*(67,95),0,32;resultlist:(67,58),32,32;sortresultlist:(67,97)=*(67,59),64,32;currentresult:(67,97),96,32;;SWISH:T(67,55)=s1712SearchAlt:(67,98)=*(67,99)=xsMOD_SearchAlt:,0,32;ResultOutput:(67,100)=*(67,101)=xsMOD_ResultOutput:,32,32;Filter:(67,102)=*(67,103)=xsMOD_Filter:,64,32;ResultSort:(67,104)=*(67,105)=xsMOD_ResultSort:,96,32;Entities:(67,106)=*(67,107)=xsMOD_Entities:,128,32;Db:(67,108)=*(67,109)=xsMOD_DB:,160,32;Search:(67,110)=*(67,111)=xsMOD_Search:,192,32;Index:(67,112)=*(67,113)=xsMOD_Index:,224,32;FS:(67,114)=*(67,115)=xsMOD_FS:,256,32;HTTP:(67,116)=*(67,117)=xsMOD_HTTP:,288,32;SwishWords:(67,118)=*(67,119)=xsMOD_Swish_Words:,320,32;Prog:(67,120)=*(67,121)=xsMOD_Prog:,352,32;PropLimit:(67,122)=*(67,123)=xsMOD_PropLimit:,384,32;indexlist:(67,57),416,32;Prop_IO_Buf:(79,33),448,32;PropIO_allocated:(0,5),480,32;PropCompressionLevel:(0,1),512,32;TotalWords:(0,1),544,32;TotalFiles:(0,1),576,32;verbose:(0,1),608,32;commonerror:(0,1),640,32;lasterror:(0,1),672,32;lasterrorstr:(67,124)=ar(7,33);0;500;(0,2),704,4008;isvowellookuptable:(67,42),4736,8192;dirlist:(67,37),12928,32;suffixlist:(67,37),12960,32;mtime_limit:(15,2),12992,32;truncateDocSize:(0,3),13024,32;replaceRegexps:(67,85),13056,32;pathExtractList:(67,125)=*(67,86),13088,32;nocontentslist:(67,37),13120,32;DefaultDocType:(0,1),13152,32;indexcontents:(67,69),13184,32;indexComments:(0,1),13216,32;storedescription:(67,23),13248,32;ignoremetalist:(67,37),13280,32;dontbumpstarttagslist:(67,37),13312,32;dontbumpendtagslist:(67,37),13344,32;UndefinedMetaTags:(67,90),13376,32;UndefinedXMLAttributes:(67,90),13408,32;parser_warn_level:(0,1),13440,32;obeyRobotsNoIndex:(0,1),13472,32;links_meta:(67,46),13504,32;images_meta:(67,46),13536,32;IndexAltTag:(0,1),13568,32;IndexAltTagMeta:(7,36),13600,32;AbsoluteLinks:(0,1),13632,32;XMLClassAttributes:(67,37),13664,32;;SWISH:t(67,126)=(67,55)StringList:t(67,127)=(67,128)=s8n:(0,1),0,32;word:(67,44),32,32;;_indexing_data_source_def:T(67,129)=s16IndexingDataSourceName:(15,7),0,32;IndexingDataSourceId:(15,7),32,32;indexpath_fn:(67,130)=*(67,131)=f(0,20),64,32;parseconfline_fn:(67,132)=*(67,133)=f(0,1),96,32;;dev_ino:T(156,1)=s16dev:(25,10),0,64;ino:(25,9),64,32;next:(156,2)=*(156,1),96,32;;IgnoreLimitPositions:T(156,3)=s8n:(0,1),0,32;pos:(42,5),32,32;;METAIDTABLE:t(156,4)=(156,5)=s16array:(42,5),0,32;max:(0,1),32,32;num:(0,1),64,32;defaultID:(0,1),96,32;;MOD_Index:T(67,113)=s544684metaIDtable:(156,4),0,128;entryArray:(156,6)=*(67,62),128,32;hashentries:(156,7)=ar(7,33);0;100002;(67,65),160,3200096;hashentriesdirty:(156,8)=ar(7,33);0;100002;(0,2),3200256,800024;compression_buffer:(79,33),4000288,32;len_compression_buffer:(0,1),4000320,32;worddata_buffer:(79,33),4000352,32;len_worddata_buffer:(0,1),4000384,32;sz_worddata_buffer:(0,1),4000416,32;filenum:(0,1),4000448,32;tmpdir:(7,36),4000480,32;swap_location_name:(156,9)=ar(7,33);0;376;(7,36),4000512,12064;fp_loc_write:(156,10)=ar(7,33);0;376;(67,22),4012576,12064;fp_loc_read:(156,10),4024640,12064;inode_hash:(156,11)=ar(7,33);0;10000;(156,2),4036704,320032;lenswishword:(0,1),4356736,32;swishword:(7,36),4356768,32;lenword:(0,1),4356800,32;word:(7,36),4356832,32;swap_locdata:(0,1),4356864,32;swap_tell:(156,12)=*(156,13)=f(0,3),4356896,32;swap_write:(156,14)=*(156,15)=f(9,1),4356928,32;swap_seek:(156,16)=*(156,17)=f(0,1),4356960,32;swap_read:(156,18)=*(156,19)=f(9,1),4356992,32;swap_close:(156,20)=*(156,21)=f(0,1),4357024,32;swap_putc:(156,22)=*(156,23)=f(0,1),4357056,32;swap_getc:(156,20),4357088,32;plimit:(0,1),4357120,32;flimit:(0,1),4357152,32;nIgnoreLimitWords:(0,1),4357184,32;IgnoreLimitPositionsArray:(156,24)=*(156,25)=*(156,3),4357216,32;chunk_size:(0,1),4357248,32;optimalChunkLocZoneSize:(0,1),4357280,32;freeLocMemChain:(67,33),4357312,32;perDocTmpZone:(156,26)=*(151,4),4357344,32;currentChunkLocZone:(156,26),4357376,32;totalLocZone:(156,26),4357408,32;entryZone:(156,26),4357440,32;;MOD_HTTP:T(67,117)=s40024lenspiderdirectory:(0,1),0,32;spiderdirectory:(7,36),32,32;maxdepth:(0,1),64,32;delay:(0,1),96,32;equivalentservers:(67,61),128,32;url_hash:(161,1)=ar(7,33);0;10000;(67,67),160,320032;;httpserver.hhttpserverinfo:T(162,1)=s20baseurl:(7,36),0,32;lastretrieval:(15,2),32,32;useragent:(7,36),64,32;robotrules:(162,2)=*(162,3)=xsrobotrules:,96,32;next:(162,4)=*(162,1),128,32;;httpserverinfo:t(162,5)=(162,1)robotrules:T(162,3)=s8disallow:(7,36),0,32;next:(162,2),32,32;;robotrules:t(162,6)=(162,3)initModule_HTTP:F(0,20)sw:p(0,21)=*(67,126)http:r(67,116)freeModule_HTTP:F(0,20)configModule_HTTP:F(0,1)sl:p(0,22)=*(67,127)list:r(67,61)slist:r(67,37)urldepth:T(0,23)=s12url:(7,36),0,32;depth:(0,1),32,32;next:(0,24)=*(0,23),64,32;;urldepth:t(0,25)=(0,23)add_url:F(0,26)=*(0,25)list:p(0,26)url:p(7,36)depth:p(0,1)baseurl:p(7,36)url:r(7,36)item:r(0,26)walk:r(0,26)http_already_indexed:F(0,1)p:r(67,67)http:(67,116)url_method:F(7,36)plen:p(42,5)plen:r(42,5)url_serverport:F(7,36)methodlen:(0,1)serverstart:r(7,36)serverend:r(7,36)url_uri:F(7,36)run_program:f(0,20)prog:p(7,36)args:p(67,44)prog:r(7,36)pid:r(25,16)status:(0,1)get:F(0,1)contenttype_or_redirect:p(7,36)last_modified:p(0,27)=*