/[MITgcm]/MITgcm/verification/global_ocean.cs32x15/results/output.txt
ViewVC logotype

Contents of /MITgcm/verification/global_ocean.cs32x15/results/output.txt

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph


Revision 1.24 - (show annotations) (download)
Thu Oct 13 01:19:41 2005 UTC (15 years, 11 months ago) by jmc
Branch: MAIN
CVS Tags: checkpoint58l_post, checkpoint58e_post, checkpoint57v_post, checkpoint58r_post, checkpoint57y_post, checkpoint58n_post, checkpoint58h_post, checkpoint57y_pre, checkpoint58q_post, checkpoint58j_post, checkpoint58, checkpoint58f_post, checkpoint57x_post, checkpoint58d_post, checkpoint58c_post, checkpoint57w_post, checkpoint58a_post, checkpoint58i_post, checkpoint58g_post, checkpoint58o_post, checkpoint57z_post, checkpoint58k_post, checkpoint58p_post, checkpoint58b_post, checkpoint58m_post
Changes since 1.23: +366 -354 lines
File MIME type: text/plain
using new version of sidedrag changes output @ truncation level. updated.

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint57s_post
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: faulks
11 (PID.TID 0000.0001) // Build date: Sat Oct 1 17:36:23 EDT 2005
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx - No. threads per process in X
19 (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20 (PID.TID 0000.0001) > &EEPARMS
21 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
22 (PID.TID 0000.0001) > nTx=1,nTy=1
23 (PID.TID 0000.0001) > &
24 (PID.TID 0000.0001) ># Note: Some systems use & as the
25 (PID.TID 0000.0001) ># namelist terminator. Other systems
26 (PID.TID 0000.0001) ># use a / character (as shown here).
27 (PID.TID 0000.0001)
28 (PID.TID 0000.0001) // =======================================================
29 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
30 (PID.TID 0000.0001) // ( and "eedata" )
31 (PID.TID 0000.0001) // =======================================================
32 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
33 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
34 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
35 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
36 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
37 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
38 (PID.TID 0000.0001) OLx = 3 ; /* Tile overlap distance in X */
39 (PID.TID 0000.0001) OLy = 3 ; /* Tile overlap distance in Y */
40 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
41 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
42 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
43 (PID.TID 0000.0001) nX = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
44 (PID.TID 0000.0001) nY = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
45 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
46 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
47 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
48 (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
49 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
50 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
51 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
52 (PID.TID 0000.0001) useCoupler= F ; /* Flag used to control communications with */
53 (PID.TID 0000.0001) /* other model components, through a coupler */
54 (PID.TID 0000.0001)
55 (PID.TID 0000.0001) // ======================================================
56 (PID.TID 0000.0001) // Mapping of tiles to threads
57 (PID.TID 0000.0001) // ======================================================
58 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
59 (PID.TID 0000.0001)
60 (PID.TID 0000.0001) // ======================================================
61 (PID.TID 0000.0001) // Tile <-> Tile connectvity table
62 (PID.TID 0000.0001) // ======================================================
63 (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000001)
64 (PID.TID 0000.0001) // WEST: Tile = 000006, Process = 000001, Comm = put
65 (PID.TID 0000.0001) // bi = 000006, bj = 000001
66 (PID.TID 0000.0001) // EAST: Tile = 000002, Process = 000001, Comm = put
67 (PID.TID 0000.0001) // bi = 000002, bj = 000001
68 (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000001, Comm = put
69 (PID.TID 0000.0001) // bi = 000001, bj = 000001
70 (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000001, Comm = put
71 (PID.TID 0000.0001) // bi = 000001, bj = 000001
72 (PID.TID 0000.0001) // Tile number: 000002 (process no. = 000001)
73 (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000001, Comm = put
74 (PID.TID 0000.0001) // bi = 000001, bj = 000001
75 (PID.TID 0000.0001) // EAST: Tile = 000003, Process = 000001, Comm = put
76 (PID.TID 0000.0001) // bi = 000003, bj = 000001
77 (PID.TID 0000.0001) // SOUTH: Tile = 000002, Process = 000001, Comm = put
78 (PID.TID 0000.0001) // bi = 000002, bj = 000001
79 (PID.TID 0000.0001) // NORTH: Tile = 000002, Process = 000001, Comm = put
80 (PID.TID 0000.0001) // bi = 000002, bj = 000001
81 (PID.TID 0000.0001) // Tile number: 000003 (process no. = 000001)
82 (PID.TID 0000.0001) // WEST: Tile = 000002, Process = 000001, Comm = put
83 (PID.TID 0000.0001) // bi = 000002, bj = 000001
84 (PID.TID 0000.0001) // EAST: Tile = 000004, Process = 000001, Comm = put
85 (PID.TID 0000.0001) // bi = 000004, bj = 000001
86 (PID.TID 0000.0001) // SOUTH: Tile = 000003, Process = 000001, Comm = put
87 (PID.TID 0000.0001) // bi = 000003, bj = 000001
88 (PID.TID 0000.0001) // NORTH: Tile = 000003, Process = 000001, Comm = put
89 (PID.TID 0000.0001) // bi = 000003, bj = 000001
90 (PID.TID 0000.0001) // Tile number: 000004 (process no. = 000001)
91 (PID.TID 0000.0001) // WEST: Tile = 000003, Process = 000001, Comm = put
92 (PID.TID 0000.0001) // bi = 000003, bj = 000001
93 (PID.TID 0000.0001) // EAST: Tile = 000005, Process = 000001, Comm = put
94 (PID.TID 0000.0001) // bi = 000005, bj = 000001
95 (PID.TID 0000.0001) // SOUTH: Tile = 000004, Process = 000001, Comm = put
96 (PID.TID 0000.0001) // bi = 000004, bj = 000001
97 (PID.TID 0000.0001) // NORTH: Tile = 000004, Process = 000001, Comm = put
98 (PID.TID 0000.0001) // bi = 000004, bj = 000001
99 (PID.TID 0000.0001) // Tile number: 000005 (process no. = 000001)
100 (PID.TID 0000.0001) // WEST: Tile = 000004, Process = 000001, Comm = put
101 (PID.TID 0000.0001) // bi = 000004, bj = 000001
102 (PID.TID 0000.0001) // EAST: Tile = 000006, Process = 000001, Comm = put
103 (PID.TID 0000.0001) // bi = 000006, bj = 000001
104 (PID.TID 0000.0001) // SOUTH: Tile = 000005, Process = 000001, Comm = put
105 (PID.TID 0000.0001) // bi = 000005, bj = 000001
106 (PID.TID 0000.0001) // NORTH: Tile = 000005, Process = 000001, Comm = put
107 (PID.TID 0000.0001) // bi = 000005, bj = 000001
108 (PID.TID 0000.0001) // Tile number: 000006 (process no. = 000001)
109 (PID.TID 0000.0001) // WEST: Tile = 000005, Process = 000001, Comm = put
110 (PID.TID 0000.0001) // bi = 000005, bj = 000001
111 (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000001, Comm = put
112 (PID.TID 0000.0001) // bi = 000001, bj = 000001
113 (PID.TID 0000.0001) // SOUTH: Tile = 000006, Process = 000001, Comm = put
114 (PID.TID 0000.0001) // bi = 000006, bj = 000001
115 (PID.TID 0000.0001) // NORTH: Tile = 000006, Process = 000001, Comm = put
116 (PID.TID 0000.0001) // bi = 000006, bj = 000001
117 (PID.TID 0000.0001)
118 (PID.TID 0000.0001) ===== W2 TILE TOPLOGY =====
119 (PID.TID 0000.0001) TILE: 1
120 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
121 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
122 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
123 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
124 (PID.TID 0000.0001) TILE: 2
125 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
126 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
127 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
128 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
129 (PID.TID 0000.0001) TILE: 3
130 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
131 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
132 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
133 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
134 (PID.TID 0000.0001) TILE: 4
135 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
136 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
137 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
138 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
139 (PID.TID 0000.0001) TILE: 5
140 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
141 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
142 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
143 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
144 (PID.TID 0000.0001) TILE: 6
145 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
146 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
147 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
148 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
149 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 35: -2, j= 30: 32
150 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 3(proc = 1)
151 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= -2: 35, j= 1: 3
152 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 6(proc = 1)
153 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 30: 32, j= -2: 35
154 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 2(proc = 1)
155 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 1: 3, j= 35: -2
156 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 5(proc = 1)
157 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= -2: 35, j= 30: 32
158 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 3(proc = 1)
159 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 35: -2, j= 1: 3
160 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 6(proc = 1)
161 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 30: 32, j= 35: -2
162 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 4(proc = 1)
163 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 1: 3, j= -2: 35
164 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 1(proc = 1)
165 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 35: -2, j= 30: 32
166 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 5(proc = 1)
167 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= -2: 35, j= 1: 3
168 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 2(proc = 1)
169 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 30: 32, j= -2: 35
170 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 4(proc = 1)
171 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 1: 3, j= 35: -2
172 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 1(proc = 1)
173 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= -2: 35, j= 30: 32
174 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 5(proc = 1)
175 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 35: -2, j= 1: 3
176 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 2(proc = 1)
177 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 30: 32, j= 35: -2
178 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 6(proc = 1)
179 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 1: 3, j= -2: 35
180 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 3(proc = 1)
181 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 35: -2, j= 30: 32
182 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 1(proc = 1)
183 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= -2: 35, j= 1: 3
184 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 4(proc = 1)
185 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 30: 32, j= -2: 35
186 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 6(proc = 1)
187 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 1: 3, j= 35: -2
188 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 3(proc = 1)
189 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= -2: 35, j= 30: 32
190 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 1(proc = 1)
191 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 35: -2, j= 1: 3
192 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 4(proc = 1)
193 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 30: 32, j= 35: -2
194 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 2(proc = 1)
195 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 1: 3, j= -2: 35
196 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 5(proc = 1)
197 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
198 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
199 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
200 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
201 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
202 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
203 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
204 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
205 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
206 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
207 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
208 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
209 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
210 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
211 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
212 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
213 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
214 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
215 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
216 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
217 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
218 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
219 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
220 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
221 (PID.TID 0000.0001) // =======================================================
222 (PID.TID 0000.0001) // Model parameter file "data"
223 (PID.TID 0000.0001) // =======================================================
224 (PID.TID 0000.0001) ># ====================
225 (PID.TID 0000.0001) ># | Model parameters |
226 (PID.TID 0000.0001) ># ====================
227 (PID.TID 0000.0001) >#
228 (PID.TID 0000.0001) ># Continuous equation parameters
229 (PID.TID 0000.0001) > &PARM01
230 (PID.TID 0000.0001) > tRef=15*20.,
231 (PID.TID 0000.0001) > sRef=15*35.,
232 (PID.TID 0000.0001) > viscAh =3.E5,
233 (PID.TID 0000.0001) >#- biharmonic Viscosity: this is close to the stability limit with deltaTmom=20mn
234 (PID.TID 0000.0001) >#viscA4 =3.E15,
235 (PID.TID 0000.0001) > viscAr =1.E-3,
236 (PID.TID 0000.0001) > diffKhT=0.,
237 (PID.TID 0000.0001) > diffK4T=0.,
238 (PID.TID 0000.0001) > diffKrT=3.E-5,
239 (PID.TID 0000.0001) > diffKhS=0.,
240 (PID.TID 0000.0001) > diffK4S=0.,
241 (PID.TID 0000.0001) > diffKrS=3.E-5,
242 (PID.TID 0000.0001) > ivdc_kappa=10.,
243 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
244 (PID.TID 0000.0001) > gravity=9.81,
245 (PID.TID 0000.0001) > rhonil=1035.,
246 (PID.TID 0000.0001) > rhoConstFresh=1000.,
247 (PID.TID 0000.0001) > eosType='JMD95Z',
248 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
249 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
250 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
251 (PID.TID 0000.0001) > exactConserv=.TRUE.,
252 (PID.TID 0000.0001) > select_rStar=2,
253 (PID.TID 0000.0001) > nonlinFreeSurf=4,
254 (PID.TID 0000.0001) > hFacInf=0.2,
255 (PID.TID 0000.0001) > hFacSup=2.0,
256 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
257 (PID.TID 0000.0001) > allowFreezing=.TRUE.,
258 (PID.TID 0000.0001) > hFacMin=.1,
259 (PID.TID 0000.0001) > hFacMinDr=20.,
260 (PID.TID 0000.0001) > readBinaryPrec=64,
261 (PID.TID 0000.0001) > &
262 (PID.TID 0000.0001) >
263 (PID.TID 0000.0001) ># Elliptic solver parameters
264 (PID.TID 0000.0001) > &PARM02
265 (PID.TID 0000.0001) > cg2dMaxIters=200,
266 (PID.TID 0000.0001) >#cg2dTargetResidual=1.E-9,
267 (PID.TID 0000.0001) > cg2dTargetResWunit=1.E-14,
268 (PID.TID 0000.0001) > &
269 (PID.TID 0000.0001) >
270 (PID.TID 0000.0001) ># Time stepping parameters
271 (PID.TID 0000.0001) > &PARM03
272 (PID.TID 0000.0001) > nIter0=72000,
273 (PID.TID 0000.0001) > nTimeSteps=20,
274 (PID.TID 0000.0001) > deltaTmom =1200.,
275 (PID.TID 0000.0001) > deltaTtracer=86400.,
276 (PID.TID 0000.0001) > deltaTfreesurf=86400.,
277 (PID.TID 0000.0001) > deltaTClock =86400.,
278 (PID.TID 0000.0001) > abEps = 0.1,
279 (PID.TID 0000.0001) > forcing_In_AB=.FALSE.,
280 (PID.TID 0000.0001) > pChkptFreq =1728000.,
281 (PID.TID 0000.0001) >#chkptFreq =311040000.,
282 (PID.TID 0000.0001) > taveFreq =1244160000.,
283 (PID.TID 0000.0001) > dumpFreq =622080000.,
284 (PID.TID 0000.0001) > monitorFreq =31104000.,
285 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
286 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
287 (PID.TID 0000.0001) > externForcingCycle=31104000.,
288 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
289 (PID.TID 0000.0001) > tauThetaClimRelax = 5184000.,
290 (PID.TID 0000.0001) ># 2yrs restoring timescale for salinity
291 (PID.TID 0000.0001) > tauSaltClimRelax = 62208000.,
292 (PID.TID 0000.0001) > monitorFreq =1.,
293 (PID.TID 0000.0001) > &
294 (PID.TID 0000.0001) >
295 (PID.TID 0000.0001) ># Gridding parameters
296 (PID.TID 0000.0001) > &PARM04
297 (PID.TID 0000.0001) > usingCartesianGrid=.FALSE.,
298 (PID.TID 0000.0001) > usingSphericalPolarGrid=.FALSE.,
299 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
300 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
301 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
302 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
303 (PID.TID 0000.0001) > &
304 (PID.TID 0000.0001) >
305 (PID.TID 0000.0001) ># Input datasets
306 (PID.TID 0000.0001) > &PARM05
307 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
308 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
309 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
310 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
311 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
312 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
313 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
314 (PID.TID 0000.0001) > surfQFile ='shiQnet_cs32.bin',
315 (PID.TID 0000.0001) > EmPmRFile ='shiEmPR_cs32.bin',
316 (PID.TID 0000.0001) > &
317 (PID.TID 0000.0001)
318 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM01
319 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM01 : OK
320 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM02
321 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM02 : OK
322 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM03
323 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM03 : OK
324 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM04
325 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM04 : OK
326 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM05
327 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM05 : OK
328 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
329 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
330 (PID.TID 0000.0001) // =======================================================
331 (PID.TID 0000.0001) // Parameter file "data.pkg"
332 (PID.TID 0000.0001) // =======================================================
333 (PID.TID 0000.0001) ># Packages
334 (PID.TID 0000.0001) > &PACKAGES
335 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
336 (PID.TID 0000.0001) >#useDiagnostics=.TRUE.,
337 (PID.TID 0000.0001) >#useMNC=.TRUE.,
338 (PID.TID 0000.0001) >#useBulkforce=.TRUE.,
339 (PID.TID 0000.0001) >#useThermSeaIce=.TRUE.,
340 (PID.TID 0000.0001) > &
341 (PID.TID 0000.0001)
342 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
343 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
344 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
345 (PID.TID 0000.0001) // =======================================================
346 (PID.TID 0000.0001) // Parameter file "data.gmredi"
347 (PID.TID 0000.0001) // =======================================================
348 (PID.TID 0000.0001) ># GM+Redi package parameters:
349 (PID.TID 0000.0001) >
350 (PID.TID 0000.0001) >#-from MOM :
351 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
352 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
353 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
354 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
355 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
356 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
357 (PID.TID 0000.0001) >
358 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
359 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
360 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
361 (PID.TID 0000.0001) >
362 (PID.TID 0000.0001) > &GM_PARM01
363 (PID.TID 0000.0001) > GM_background_K = 800.,
364 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
365 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
366 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
367 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
368 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
369 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
370 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
371 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
372 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
373 (PID.TID 0000.0001) > &end
374 (PID.TID 0000.0001) >
375 (PID.TID 0000.0001) >
376 (PID.TID 0000.0001)
377 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
378 (PID.TID 0000.0001) tile: 1 ; Read from file tile001.mitgrid
379 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
380 (PID.TID 0000.0001) tile: 2 ; Read from file tile002.mitgrid
381 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
382 (PID.TID 0000.0001) tile: 3 ; Read from file tile003.mitgrid
383 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
384 (PID.TID 0000.0001) tile: 4 ; Read from file tile004.mitgrid
385 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
386 (PID.TID 0000.0001) tile: 5 ; Read from file tile005.mitgrid
387 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
388 (PID.TID 0000.0001) tile: 6 ; Read from file tile006.mitgrid
389 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
390 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
391 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
392 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
393 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
394 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
395 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
396 (PID.TID 0000.0001) %MON XG_mean = 1.8796250616675E+00
397 (PID.TID 0000.0001) %MON XG_sd = 1.0410625309932E+02
398 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
399 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
400 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
401 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
402 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
403 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
404 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
405 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
406 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
407 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
408 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
409 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
410 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
411 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
412 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
413 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
414 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
415 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
416 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
417 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
418 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
419 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
420 (PID.TID 0000.0001) %MON YG_mean = -1.2094344438470E-15
421 (PID.TID 0000.0001) %MON YG_sd = 3.9086186579984E+01
422 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
423 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
424 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
425 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
426 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
427 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
428 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
429 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
430 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
431 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
432 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
433 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
434 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
435 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
436 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
437 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
438 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
439 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
440 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
441 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
442 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
443 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
444 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
445 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
446 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
447 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
448 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
449 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
450 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
451 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
452 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
453 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
454 (PID.TID 0000.0001) %MON AngleCS_max = 1.0000000000000E+00
455 (PID.TID 0000.0001) %MON AngleCS_min = 1.0000000000000E+00
456 (PID.TID 0000.0001) %MON AngleCS_mean = 1.0000000000000E+00
457 (PID.TID 0000.0001) %MON AngleCS_sd = 0.0000000000000E+00
458 (PID.TID 0000.0001) %MON AngleSN_max = 0.0000000000000E+00
459 (PID.TID 0000.0001) %MON AngleSN_min = 0.0000000000000E+00
460 (PID.TID 0000.0001) %MON AngleSN_mean = 0.0000000000000E+00
461 (PID.TID 0000.0001) %MON AngleSN_sd = 0.0000000000000E+00
462 (PID.TID 0000.0001) MDSREADFIELD: opening global file: bathy_Hmin50.bin
463 (PID.TID 0000.0001) // =======================================================
464 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc) at iteration 1
465 (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
466 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
467 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
468 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
469 (PID.TID 0000.0001) // 0.0: .
470 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
471 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
472 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
473 (PID.TID 0000.0001) // =======================================================
474 (PID.TID 0000.0001) K = 1
475 (PID.TID 0000.0001) // I=7 I=17 I=27 I=31 I=41 I=51 I=61 I=65 I=75 I=85 I=95 I=99 I=109 I=119 I=129 I=133 I=143 I=153 I=163 I=167 I=177 I=187
476 (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123450|234567890|234567890|234567890|234567234|678901234|678901234|678901234|678945678|012345678|012345678|012345678|016789012|456789012|456789012|456789012|890123456|890123456|890123456|89012345
477 (PID.TID 0000.0001) // 35 cac--cbbeefjkfefw+..........zpu......................................kqnzrqq-b-da----bbbbfu..............fdddccaaddccaadcdddcbbbbcdddcccdffffghgffffddefligfiljfba---aafddehy...pwvlhfffcbagfccbagfcceeffffjlkjgaa---bfvheeln-aesaaa
478 (PID.TID 0000.0001) // 34 --ba-abcehjnldcclz+........spps.....................................vkqn+xnnabbcbba--aabfu+..............hcbaaaaacaaaaaccdccbaaabbddddccdffffghfeeeeedefiffefilhfcaaaacgceei.......zomggfcaecbfcaecbbccddefilihecbaacbaajfega-aesfee
479 (PID.TID 0000.0001) // 33 -abbbccceiomkfdbbc+.......+s........................................xsrxzz+zdcddb-----adu+...............hcbaa--acaa--accddba--bbbddddccdfffhhgfeeddccedfeddfgikhfffdfgccffw........zohhgebbaagebbaaaaaccdfhlhfefdcccaabjefbaaafooss
480 (PID.TID 0000.0001) // 32 -bddefhhkqqlgfaakqz..v.+..+.......................................++..u+....gfdba----adu+................kdcaaa-acaaa-accdcb---bbbcdddddefffggfeeedccccccbbdcdfgghhiihcbeiw.........+ynjgebaaagebaaaa-aacccfikkhecccbbbaaabaadfklnqp
481 (PID.TID 0000.0001) // 31 bbcffijnpnqneaaat..umrr+s.z.......................................+++++.ztsvifeb--dfdfu+................+lkdca--abca--abcccb---bbbbddddeffflhfeeeecbbbbaa-abbacbcdceffbbfw+..........++ujfbaaajfbaaa----aacffiljgfffcca--adfikkiihhh
482 (PID.TID 0000.0001) // 30 -adgillkkkifcadcx.ymmqzqikvnnps...................................+++++wmegtlifcacdlqx+++...............mligea---aea---abbbb---abaaddddeedkmeddefdbbbaaac---b--aaaaabaabm..............+viba--viba-------acdefinmlgiieb-chnnnmlmlgff
483 (PID.TID 0000.0001) // 29 -cfiljigfjd--efdozy...+ximpnnuz....................................+++yqddhpljhcbbchz+......++.........+mmhffc----fc----aaba------acdddcbcineddgdbaaa---dd--a------aa-bfz...............+qe---+qe---aa---aedeegknmlgiigcdfhpokkimlfd
484 (PID.TID 0000.0001) // 28 abgkhfcccea-bdei........t..........................................++zwgfcfkknhccbbhwwy.....+++........+njfeed----ed-----aa-------abddcabcnfddegcaaa----lf------------dk+................+ja--.+ja------bffdddehfd--bedaacfhpnligiih
485 (PID.TID 0000.0001) // 27 acghfbaaaa-achmy............................+++....................++vnbbbclkpkeeecflmqxy....++........+lhfeecc---ecc------------aaadcbabcfhddccba------qd-----------irw.................++e--.++e-----mhmijddda--------ahhfiokhedeg
486 (PID.TID 0000.0001) // 26 adhfca-----bfiv.............................++sy...................+tq-fdbblknqiheddefhiksz++++........zkhfdccb---ccb------------aabdcaaaacfddbca-------xfa-abb-----vvv...................+wa-..+wa---mlmkijhc----------cjjffiheb-aa
487 (PID.TID 0000.0001) // 25 achfa------ch+..................w.....w.......njo+................+x-----bcgiqqojfefiiiijmy.++.........zkhfdbaa---baa-------daa---acccaaaacccca--------a+udaabbb----tei...................++qd..++qdeqnghiljcaaaaidaa----beedeeca--b
488 (PID.TID 0000.0001) // 24 aeifa--acbcei...................w.....w.......likn+.....++.....++znpa----bbdfnlmnjhinlksssw............qhfeca-----a--------addc--aeffaaaaaaccb-a----a--b++udbbaba---ven....................++x...++xywnfgllcbbabegkecba----ddddcaacd
489 (PID.TID 0000.0001) // 23 bfida-aabchjk...................zz....zz.....nhhijz....tqq.....+ujgzgd---abccegklkkknols..xuu..........zgfdba-----a--------bcd---affaaadffabbb-----aa-bc+.+ufb-----l.gx...........s.........++....++zzkfilfccccoz..ulkcd---bccnfdddd
490 (PID.TID 0000.0001) // 22 afhfaa---bfgi....................zz..r.zz..rnjffggm...nlmn+....+sffzya--aabcaaffdfhimrmp...yuu.++.......zudba-----a--------adc---dda-adffe-aa--------aaa...+ufc-baaqvhh..........dcfeeh......+.....++zggqvifefhz......zobbaccfwuffee
491 (PID.TID 0000.0001) // 21 abcgca----abe.....................ysst..ysstlgeeeeoz..ijklt+....lfjzzf---adfdaadcehllotq....yy+++zzs.....+zcba----ba-------cdd--aaa----df------------aaa....+upjdcy.vohq.......+idcdfeeefwz...fwz....+hhn.vklox.........gdccfjwrigff
492 (PID.TID 0000.0001) // 20 bbbcgfcaa-aae+.......................l.....lcgfdddhq.+hiilnz++.+oquxyz--adgkcaabcfmtooyxz......+yuiiy....++gb-----b--------ddcca-a-----acbaa------bbaaaa.......ywxy.lulo.lv...kcdgddffefffilyxffilyx+fffk.+xyyy.........mgeimvskjkll
493 (PID.TID 0000.0001) // 19 mfeccdghfeegcbt......................a.....aafifccgnrzgghjry.+++sr+lq.--edfkxtkblwnnsp.vv......skhggt...+++t---------------bdaf---------edd-------adlaaa..........vnhzy.tllqiedccdhggfggffiiggffiiggfcbdgy..yz..........xigqophijkki
494 (PID.TID 0000.0001) // 18 .wifedfkhfegbbcivlqfoz..............ja....jaacfihggokeeffgt..++++..hhlfdeddk..qcz+.zwxtsttz..ysrkhot++++++zig-----g--------b--f---------egqqqaa----frb--........+kkrhw.vqmlnieddcdehgggffgigedfgigedbaaceiy.............zilrddefikkh
495 (PID.TID 0000.0001) // 17 .+wfeefikhgcbbccaaacgn.............ica...icaaccfihfoedddeedy..++...nnqwgfeeky.z++..+zsjjllllljllpjos+++.+zhhi-----i-----e-----ea--------foqqoqqo--hlwgea........+nk+..xiioonhfefddegihhghigfdbhigfdbaaabdgx..............nheddefiklh
496 (PID.TID 0000.0001) // 16 ...wiheddeccdfhfbabdfl............jdba..jdbaddddgifkccccdccd+.++..++ynvz.tkkmu....++zyslllllkhggkmpy++...ihhi-----i-----ea---feb-----a-acnoohfghknvmwnuc.........qhu..hhhkojgffgeefghihhiieedbiieedbaaabcdy..............ygddeghiljg
497 (PID.TID 0000.0001) // 15 .....ylea--acfihebcbbes..........sfcbb.sfcbbngfffigcaaabdbcac+.+++++zgmpx...mm....++..zslwz.yhhhhnz+++...rhgc----ac----ab----ige----acaaalllkddfiy..yswx.........thk.xgghiligfghfefhhhhiiheedciheedcdbbabdmz.............zfdeghikkif
498 (PID.TID 0000.0001) // 14 .......c---acgkhdcc--di..........ofddc.ofddchohffikaaaaabaaa-aw+.+ysnggox++.qrv..........yzzzzrjil+++....qhgd-----d-----a-----i---cccdeabkklldinqssy..xx..........+y.uhghikihgfghefgihhhgeeeeegeeeeeddbaadhw.............nedeghjjhfe
499 (PID.TID 0000.0001) // 13 ......+b----cfkhec---afz.........nhfdf.nhfdffholghkaaaaaba-a---flkkuswyy++++zr...........zzzzz++ry++......yd--------------------aeecdeidfkkqnqlmqquukqqm.............iihiijjhfefgefhjihiffgggfffgggffecaabelx...........zjecehijhfec
500 (PID.TID 0000.0001) // 12 ......ec----chjhec---ag..........skiqd.skiqddeiiiifaaabae--a---dd--iu+++.+++q++..........+z+++++.+++....++.s------------------a-ceccdejhlllkqlkklssiccde............wjkkkjjjigeefffgjiiighiiihghiiihhhdaabdffghtxx......mfccehjiffdb
501 (PID.TID 0000.0001) // 11 .....pdca--achlheba--ai..........nkn.f.nkn.fdemijidaaaabi-------a--q+....++.is...........+++++..........+yyza----ba----b-----a--ccccddkhieekkossssfbbbbc...........njjijhhihijhgggggjjjjijkkkkijkkkkjjhcaacddeegpy.....xfdccdhjgfdda
502 (PID.TID 0000.0001) // 10 .....wfdb--achlhea---an.........uos..duos..dcemikkfdcaabi-------equ+........k...........................zyvuq----cq----cc----a---dcfhkopqjeissrnpfbbcccd.........zslihhigghgijjihhhhkllkkkkkkjkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddca
503 (PID.TID 0000.0001) // 9 .....vgec---bfikca--cjl+.......+nnv.+cnnv.+ccffhkkiddaadha-----as++.........vz++........................zxuuk-----k------a---a----djmqrrnlllsoiddcccccdj........+zjijhfgfggffhjkkkiillljihhghgihhghgihighdeeffgghimnnjgecbbcdgfeccba
504 (PID.TID 0000.0001) // 8 ....zleca---afjfca--hdfz.......vkky.jckky.jceddefijffdddhb--a-afv...........n..ss.........................+yku----ku--------------ejnpqqnninnritqdccchkm.......wihgghgeffffeefhijkjkljiigeeffegeeffefffhjhhikkklljklmhffeeeggfdcbaay
505 (PID.TID 0000.0001) // 7 ..+zohec--abcfkhecbchbdx.......qiht.faiht.faaaabdgijgfededcdcb-f+...........n...pz.........................+zu----zu--------------edefqgqddsz+......+yudm+....tiggfggfeeeefeeefiiiijkiihheddddheddddddddjjllliijhfkmmkkjjhijgdcba--q
506 (PID.TID 0000.0001) // 6 .+yomfddcaabefkifdchaadt......uqdeisc-deisc----dfefgifffkklldc--v...........p...pp.........................v.x----.x---------a----fbbpqgzenx+........zdbllkhhfffffffgfeeeeeeeefhhhhijihhffddcbffddcbbbbdhhiihedddb-cfhhhjjjieca----+
507 (PID.TID 0000.0001) // 5 .+nhgffkghccfhkhffgdaackz....uoibcimlabcimlaaacfbddfjjhijeehf-a-c...........s...su.........................qk.yi--k.yi-------gha-fjddqs+xkrz.........q-bikdccdeeeeeeedddedddddgghhhhjhhgffcbbaffcbbaaaaddfegecca----dfeefhfgdb-----+
508 (PID.TID 0000.0001) // 4 +ujhgfllfhdffhkfffca-aady...llnabdopfcbdopfcbdgdbcdehlihgfddc--ms..........................................okn.zd-kn.zd---eciiiicfkeeqy.ysz..........n-agdcbbdeddedcdcccdddcddffggghiggfffdbaaffdbaa---acdcccba--abvfedeffdcca----b+
509 (PID.TID 0000.0001) // 3 vjggfcceeffffjlkjgaa---bfvheeln-aesphfaesphfdhgabddeflihhgfecbaaayq+++++...................................kqnz.vtqnz.vtpkllgdccfkkkkk..++..........+g--ecaaadcdddcbbbbcdddcccdffffghgffffdcaaffdcaa----abcaaaa-acxxmecdjmdbba----r+
510 (PID.TID 0000.0001) // 2 ifeecbbccddefilihecbaacbaajfega-aesqhfaesqhffiea-cdeflkkljifeddcba---bry+.................................vkqn+.sgqn+.sghfcbcbbbdgfdek.++++.........+l--aaaaaccdccbaaabbddddccdffffghfeeeeecbaeeecba------baaaa-euwxqdbcdkud-----sy+
511 (PID.TID 0000.0001) // 1 bbbbaaaaaccdfhlhfefdcccaabjefbaaafonhgafonhglid--adfgkkkklkhffddca-----s++++..............................xsrxz.terxz.tedcbbbbaaadddet.++++.........+l----a-accddba--bbbddddccdfffhhgfeeddccbaddccba-------aaaabgns.qcbcchyzqngll++.
512 (PID.TID 0000.0001) // 0 aaaaaaa-aacccfikkhecccbbbaaabaadfkllilfkllilmgebaadfijjiiikjhffdcba-----lllg............................++..u+..zmu+..zmdfbd---a-aeef.xx+..........+++s-----accdcb---bbbcdddddefffggfeeedcccbbdcccbba----aa--alrwwy.kcbccc+...++++..
513 (PID.TID 0000.0001) // -1 -aaaaa----aacffiljgfffcca--adfikkiikimkiikimiiheccfurkiffhijjigfecb-----l---............................+++++.z+.w+.z+.wqgbf-------dgzpoy+........+ys+yr-aa-abcccb---bbbbddddeffflhfeeeecbbcbbcbbcbbaa----a--bdflm.yuibbcc.......+..
514 (PID.TID 0000.0001) // -2 -aaa-------acdefinmlgiieb-chnnnmlmlfkllmlfklklkhednwwsheeghhijjgfdca----g---............................+++++wmu+++wmu++ywn--------fwvmgy+........+r-.++abc--abbbb---abaaddddeedkmeddefdbbbdcbbbbdcbaa-------ba-hv.susfbcc.......+..
515 (PID.TID 0000.0001) // =======================================================
516 (PID.TID 0000.0001) // END OF FIELD =
517 (PID.TID 0000.0001) // =======================================================
518 (PID.TID 0000.0001)
519 (PID.TID 0000.0001) // =======================================================
520 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc) at iteration 1
521 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
522 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
523 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
524 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
525 (PID.TID 0000.0001) // 0.0: .
526 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
527 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
528 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
529 (PID.TID 0000.0001) // =======================================================
530 (PID.TID 0000.0001) // =======================================================
531 (PID.TID 0000.0001) // END OF FIELD =
532 (PID.TID 0000.0001) // =======================================================
533 (PID.TID 0000.0001)
534 (PID.TID 0000.0001) // =======================================================
535 (PID.TID 0000.0001) // Field hFacC at iteration 1
536 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
537 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
538 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
539 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
540 (PID.TID 0000.0001) // 0.0: .
541 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
542 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
543 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
544 (PID.TID 0000.0001) // =======================================================
545 (PID.TID 0000.0001) // =======================================================
546 (PID.TID 0000.0001) // END OF FIELD =
547 (PID.TID 0000.0001) // =======================================================
548 (PID.TID 0000.0001)
549 (PID.TID 0000.0001) // =======================================================
550 (PID.TID 0000.0001) // Field hFacW at iteration 1
551 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
552 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
553 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
554 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
555 (PID.TID 0000.0001) // 0.0: .
556 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
557 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
558 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
559 (PID.TID 0000.0001) // =======================================================
560 (PID.TID 0000.0001) // =======================================================
561 (PID.TID 0000.0001) // END OF FIELD =
562 (PID.TID 0000.0001) // =======================================================
563 (PID.TID 0000.0001)
564 (PID.TID 0000.0001) // =======================================================
565 (PID.TID 0000.0001) // Field hFacS at iteration 1
566 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
567 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
568 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
569 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
570 (PID.TID 0000.0001) // 0.0: .
571 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
572 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
573 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
574 (PID.TID 0000.0001) // =======================================================
575 (PID.TID 0000.0001) // =======================================================
576 (PID.TID 0000.0001) // END OF FIELD =
577 (PID.TID 0000.0001) // =======================================================
578 (PID.TID 0000.0001)
579 (PID.TID 0000.0001)
580 (PID.TID 0000.0001) // ===================================
581 (PID.TID 0000.0001) // GAD parameters :
582 (PID.TID 0000.0001) // ===================================
583 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
584 (PID.TID 0000.0001) 2
585 (PID.TID 0000.0001) ;
586 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
587 (PID.TID 0000.0001) 2
588 (PID.TID 0000.0001) ;
589 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
590 (PID.TID 0000.0001) F
591 (PID.TID 0000.0001) ;
592 (PID.TID 0000.0001) tempAdamsBashforth = /* use Adams-Bashforth time-stepping for Temp */
593 (PID.TID 0000.0001) T
594 (PID.TID 0000.0001) ;
595 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
596 (PID.TID 0000.0001) 2
597 (PID.TID 0000.0001) ;
598 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
599 (PID.TID 0000.0001) 2
600 (PID.TID 0000.0001) ;
601 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
602 (PID.TID 0000.0001) F
603 (PID.TID 0000.0001) ;
604 (PID.TID 0000.0001) saltAdamsBashforth = /* use Adams-Bashforth time-stepping for Salt */
605 (PID.TID 0000.0001) T
606 (PID.TID 0000.0001) ;
607 (PID.TID 0000.0001) // ===================================
608 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
609 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
610 (PID.TID 0000.0001) F
611 (PID.TID 0000.0001) ;
612 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
613 (PID.TID 0000.0001) F
614 (PID.TID 0000.0001) ;
615 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
616 (PID.TID 0000.0001) F
617 (PID.TID 0000.0001) ;
618 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity ( m^2/s ) */
619 (PID.TID 0000.0001) 8.000000000000000E+02
620 (PID.TID 0000.0001) ;
621 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity ( m^2/s ) */
622 (PID.TID 0000.0001) 8.000000000000000E+02
623 (PID.TID 0000.0001) ;
624 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity ( m^2/s ) */
625 (PID.TID 0000.0001) 0.000000000000000E+00
626 (PID.TID 0000.0001) ;
627 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. ( ) */
628 (PID.TID 0000.0001) 0.000000000000000E+00
629 (PID.TID 0000.0001) ;
630 (PID.TID 0000.0001) Tapering/Cliping : gkw91
631 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
632 (PID.TID 0000.0001) 1.000000000000000E-12
633 (PID.TID 0000.0001) ;
634 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
635 (PID.TID 0000.0001) 1.000000000000000E+48
636 (PID.TID 0000.0001) ;
637 (PID.TID 0000.0001) %MON fCori_max = 1.4535016908525E-04
638 (PID.TID 0000.0001) %MON fCori_min = -1.4535016908525E-04
639 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
640 (PID.TID 0000.0001) %MON fCori_sd = 8.3972192788621E-05
641 (PID.TID 0000.0001) %MON fCoriG_max = 1.4544410433286E-04
642 (PID.TID 0000.0001) %MON fCoriG_min = -1.4544410433286E-04
643 (PID.TID 0000.0001) %MON fCoriG_mean = 0.0000000000000E+00
644 (PID.TID 0000.0001) %MON fCoriG_sd = 8.4860812167727E-05
645 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4540341538469E-04
646 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2264550201501E-06
647 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1482595466044E-04
648 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0292878037194E-05
649 (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
650 (PID.TID 0000.0001) INI_CG2D: cg2dTolerance = 5.809016360175293E-07 (Area=3.6388673751E+14)
651 (PID.TID 0000.0001)
652 (PID.TID 0000.0001) CONFIG_CHECK: OK
653 (PID.TID 0000.0001) // =======================================================
654 (PID.TID 0000.0001) // Model configuration
655 (PID.TID 0000.0001) // =======================================================
656 (PID.TID 0000.0001) //
657 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
658 (PID.TID 0000.0001) //
659 (PID.TID 0000.0001) buoyancyRelation = OCEANIC
660 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
661 (PID.TID 0000.0001) F
662 (PID.TID 0000.0001) ;
663 (PID.TID 0000.0001) fluidIsWater= /* fuild major constituent is Water */
664 (PID.TID 0000.0001) T
665 (PID.TID 0000.0001) ;
666 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
667 (PID.TID 0000.0001) F
668 (PID.TID 0000.0001) ;
669 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
670 (PID.TID 0000.0001) T
671 (PID.TID 0000.0001) ;
672 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or oK ) */
673 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
674 (PID.TID 0000.0001) ;
675 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( ppt ) */
676 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
677 (PID.TID 0000.0001) ;
678 (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
679 (PID.TID 0000.0001) 3.000000000000000E+05
680 (PID.TID 0000.0001) ;
681 (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
682 (PID.TID 0000.0001) 1.000000000000000E+21
683 (PID.TID 0000.0001) ;
684 (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
685 (PID.TID 0000.0001) 0.000000000000000E+00
686 (PID.TID 0000.0001) ;
687 (PID.TID 0000.0001) useFullLeith = /* Use Full Form of Leith Viscosity on/off flag*/
688 (PID.TID 0000.0001) F
689 (PID.TID 0000.0001) ;
690 (PID.TID 0000.0001) useStrainTensionVisc = /* Use StrainTension Form of Viscous Operator on/off flag*/
691 (PID.TID 0000.0001) F
692 (PID.TID 0000.0001) ;
693 (PID.TID 0000.0001) useAreaViscLength = /* Use area for visc length instead of geom. mean*/
694 (PID.TID 0000.0001) F
695 (PID.TID 0000.0001) ;
696 (PID.TID 0000.0001) viscC2leith = /* Leith harmonic visc. factor (on grad(vort),non-dim.) */
697 (PID.TID 0000.0001) 0.000000000000000E+00
698 (PID.TID 0000.0001) ;
699 (PID.TID 0000.0001) viscC2leithD = /* Leith harmonic viscosity factor (on grad(div),non-dim.) */
700 (PID.TID 0000.0001) 0.000000000000000E+00
701 (PID.TID 0000.0001) ;
702 (PID.TID 0000.0001) viscC2smag = /* Smagorinsky harmonic viscosity factor (non-dim.) */
703 (PID.TID 0000.0001) 0.000000000000000E+00
704 (PID.TID 0000.0001) ;
705 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
706 (PID.TID 0000.0001) 0.000000000000000E+00
707 (PID.TID 0000.0001) ;
708 (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
709 (PID.TID 0000.0001) 1.000000000000000E+21
710 (PID.TID 0000.0001) ;
711 (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
712 (PID.TID 0000.0001) 0.000000000000000E+00
713 (PID.TID 0000.0001) ;
714 (PID.TID 0000.0001) viscC4leith = /* Leith biharm viscosity factor (on grad(vort), non-dim.) */
715 (PID.TID 0000.0001) 0.000000000000000E+00
716 (PID.TID 0000.0001) ;
717 (PID.TID 0000.0001) viscC4leithD = /* Leith biharm viscosity factor (on grad(div), non-dim.) */
718 (PID.TID 0000.0001) 0.000000000000000E+00
719 (PID.TID 0000.0001) ;
720 (PID.TID 0000.0001) viscC4Smag = /* Smagorinsky biharm viscosity factor (non-dim) */
721 (PID.TID 0000.0001) 0.000000000000000E+00
722 (PID.TID 0000.0001) ;
723 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
724 (PID.TID 0000.0001) T
725 (PID.TID 0000.0001) ;
726 (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
727 (PID.TID 0000.0001) 2.000000000000000E+00
728 (PID.TID 0000.0001) ;
729 (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
730 (PID.TID 0000.0001) 1.000000000000000E-03
731 (PID.TID 0000.0001) ;
732 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
733 (PID.TID 0000.0001) T
734 (PID.TID 0000.0001) ;
735 (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( 1/s ) */
736 (PID.TID 0000.0001) 0.000000000000000E+00
737 (PID.TID 0000.0001) ;
738 (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coeff. ( 1/m ) */
739 (PID.TID 0000.0001) 0.000000000000000E+00
740 (PID.TID 0000.0001) ;
741 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
742 (PID.TID 0000.0001) 0.000000000000000E+00
743 (PID.TID 0000.0001) ;
744 (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
745 (PID.TID 0000.0001) 0.000000000000000E+00
746 (PID.TID 0000.0001) ;
747 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
748 (PID.TID 0000.0001) 0.000000000000000E+00
749 (PID.TID 0000.0001) ;
750 (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
751 (PID.TID 0000.0001) 0.000000000000000E+00
752 (PID.TID 0000.0001) ;
753 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
754 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
755 (PID.TID 0000.0001) ;
756 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
757 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
758 (PID.TID 0000.0001) ;
759 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 1979 ( m^2/s ) */
760 (PID.TID 0000.0001) 0.000000000000000E+00
761 (PID.TID 0000.0001) ;
762 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
763 (PID.TID 0000.0001) 0.000000000000000E+00
764 (PID.TID 0000.0001) ;
765 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
766 (PID.TID 0000.0001) 2.000000000000000E+02
767 (PID.TID 0000.0001) ;
768 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
769 (PID.TID 0000.0001) -2.000000000000000E+03
770 (PID.TID 0000.0001) ;
771 (PID.TID 0000.0001) Equation of State : eosType = JMD95Z
772 (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/degree ) */
773 (PID.TID 0000.0001) 1.234567000000000E+05
774 (PID.TID 0000.0001) ;
775 (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/ppt ) */
776 (PID.TID 0000.0001) 1.234567000000000E+05
777 (PID.TID 0000.0001) ;
778 (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
779 (PID.TID 0000.0001) 1.035000000000000E+03
780 (PID.TID 0000.0001) ;
781 (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
782 (PID.TID 0000.0001) 1.035000000000000E+03
783 (PID.TID 0000.0001) ;
784 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
785 (PID.TID 0000.0001) 1.000000000000000E+03
786 (PID.TID 0000.0001) ;
787 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
788 (PID.TID 0000.0001) 9.810000000000000E+00
789 (PID.TID 0000.0001) ;
790 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
791 (PID.TID 0000.0001) 9.810000000000000E+00
792 (PID.TID 0000.0001) ;
793 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
794 (PID.TID 0000.0001) 8.640000000000000E+04
795 (PID.TID 0000.0001) ;
796 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
797 (PID.TID 0000.0001) 7.272205216643040E-05
798 (PID.TID 0000.0001) ;
799 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
800 (PID.TID 0000.0001) 1.000000000000000E-04
801 (PID.TID 0000.0001) ;
802 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
803 (PID.TID 0000.0001) 9.999999999999999E-12
804 (PID.TID 0000.0001) ;
805 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
806 (PID.TID 0000.0001) 1.000000000000000E+00
807 (PID.TID 0000.0001) ;
808 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
809 (PID.TID 0000.0001) T
810 (PID.TID 0000.0001) ;
811 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
812 (PID.TID 0000.0001) F
813 (PID.TID 0000.0001) ;
814 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
815 (PID.TID 0000.0001) 1.000000000000000E+00
816 (PID.TID 0000.0001) ;
817 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
818 (PID.TID 0000.0001) 1.000000000000000E+00
819 (PID.TID 0000.0001) ;
820 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
821 (PID.TID 0000.0001) T
822 (PID.TID 0000.0001) ;
823 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
824 (PID.TID 0000.0001) T
825 (PID.TID 0000.0001) ;
826 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
827 (PID.TID 0000.0001) 4
828 (PID.TID 0000.0001) ;
829 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
830 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
831 (PID.TID 0000.0001) 2.000000000000000E-01
832 (PID.TID 0000.0001) ;
833 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
834 (PID.TID 0000.0001) 2.000000000000000E+00
835 (PID.TID 0000.0001) ;
836 (PID.TID 0000.0001) select_rStar = /* r* Coordinate options (not yet implemented)*/
837 (PID.TID 0000.0001) 2
838 (PID.TID 0000.0001) ;
839 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
840 (PID.TID 0000.0001) T
841 (PID.TID 0000.0001) ;
842 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
843 (PID.TID 0000.0001) 1.234567000000000E+05
844 (PID.TID 0000.0001) ;
845 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(ppt)*/
846 (PID.TID 0000.0001) 0.000000000000000E+00
847 (PID.TID 0000.0001) ;
848 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
849 (PID.TID 0000.0001) F
850 (PID.TID 0000.0001) ;
851 (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
852 (PID.TID 0000.0001) 1.000000000000000E+00
853 (PID.TID 0000.0001) ;
854 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
855 (PID.TID 0000.0001) T
856 (PID.TID 0000.0001) ;
857 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
858 (PID.TID 0000.0001) T
859 (PID.TID 0000.0001) ;
860 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
861 (PID.TID 0000.0001) T
862 (PID.TID 0000.0001) ;
863 (PID.TID 0000.0001) momImplVertAdv =/* Momentum implicit vert. advection on/off*/
864 (PID.TID 0000.0001) F
865 (PID.TID 0000.0001) ;
866 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
867 (PID.TID 0000.0001) F
868 (PID.TID 0000.0001) ;
869 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
870 (PID.TID 0000.0001) T
871 (PID.TID 0000.0001) ;
872 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
873 (PID.TID 0000.0001) F
874 (PID.TID 0000.0001) ;
875 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
876 (PID.TID 0000.0001) F
877 (PID.TID 0000.0001) ;
878 (PID.TID 0000.0001) useJamartMomAdv= /* V.I. Non-linear terms Jamart flag */
879 (PID.TID 0000.0001) F
880 (PID.TID 0000.0001) ;
881 (PID.TID 0000.0001) SadournyCoriolis= /* Sadourny Coriolis discr. flag */
882 (PID.TID 0000.0001) F
883 (PID.TID 0000.0001) ;
884 (PID.TID 0000.0001) upwindVorticity= /* Upwind bias vorticity flag */
885 (PID.TID 0000.0001) F
886 (PID.TID 0000.0001) ;
887 (PID.TID 0000.0001) useAbsVorticity= /* Work with f+zeta in Coriolis */
888 (PID.TID 0000.0001) F
889 (PID.TID 0000.0001) ;
890 (PID.TID 0000.0001) highOrderVorticity= /* High order interp. of vort. flag */
891 (PID.TID 0000.0001) F
892 (PID.TID 0000.0001) ;
893 (PID.TID 0000.0001) upwindShear= /* Upwind vertical Shear advection flag */
894 (PID.TID 0000.0001) F
895 (PID.TID 0000.0001) ;
896 (PID.TID 0000.0001) selectKEscheme= /* Kinetic Energy scheme selector */
897 (PID.TID 0000.0001) 0
898 (PID.TID 0000.0001) ;
899 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
900 (PID.TID 0000.0001) T
901 (PID.TID 0000.0001) ;
902 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
903 (PID.TID 0000.0001) T
904 (PID.TID 0000.0001) ;
905 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
906 (PID.TID 0000.0001) T
907 (PID.TID 0000.0001) ;
908 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
909 (PID.TID 0000.0001) T
910 (PID.TID 0000.0001) ;
911 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
912 (PID.TID 0000.0001) F
913 (PID.TID 0000.0001) ;
914 (PID.TID 0000.0001) implicitDiffusion =/* Implicit Diffusion on/off flag */
915 (PID.TID 0000.0001) T
916 (PID.TID 0000.0001) ;
917 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
918 (PID.TID 0000.0001) T
919 (PID.TID 0000.0001) ;
920 (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
921 (PID.TID 0000.0001) T
922 (PID.TID 0000.0001) ;
923 (PID.TID 0000.0001) tempImplVertAdv =/* Temp. implicit vert. advection on/off */
924 (PID.TID 0000.0001) F
925 (PID.TID 0000.0001) ;
926 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
927 (PID.TID 0000.0001) T
928 (PID.TID 0000.0001) ;
929 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
930 (PID.TID 0000.0001) T
931 (PID.TID 0000.0001) ;
932 (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
933 (PID.TID 0000.0001) T
934 (PID.TID 0000.0001) ;
935 (PID.TID 0000.0001) saltImplVertAdv =/* Sali. implicit vert. advection on/off */
936 (PID.TID 0000.0001) F
937 (PID.TID 0000.0001) ;
938 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
939 (PID.TID 0000.0001) T
940 (PID.TID 0000.0001) ;
941 (PID.TID 0000.0001) debugMode = /* Debug Mode on/off flag */
942 (PID.TID 0000.0001) F
943 (PID.TID 0000.0001) ;
944 (PID.TID 0000.0001) debLevA = /* 1rst level of debugging */
945 (PID.TID 0000.0001) 1
946 (PID.TID 0000.0001) ;
947 (PID.TID 0000.0001) debLevB = /* 2nd level of debugging */
948 (PID.TID 0000.0001) 2
949 (PID.TID 0000.0001) ;
950 (PID.TID 0000.0001) debugLevel = /* select debugging level */
951 (PID.TID 0000.0001) 1
952 (PID.TID 0000.0001) ;
953 (PID.TID 0000.0001) //
954 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
955 (PID.TID 0000.0001) //
956 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
957 (PID.TID 0000.0001) 200
958 (PID.TID 0000.0001) ;
959 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
960 (PID.TID 0000.0001) 1
961 (PID.TID 0000.0001) ;
962 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
963 (PID.TID 0000.0001) 1.000000000000000E-07
964 (PID.TID 0000.0001) ;
965 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
966 (PID.TID 0000.0001) 1.000000000000000E-14
967 (PID.TID 0000.0001) ;
968 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
969 (PID.TID 0000.0001) 1
970 (PID.TID 0000.0001) ;
971 (PID.TID 0000.0001) //
972 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
973 (PID.TID 0000.0001) //
974 (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
975 (PID.TID 0000.0001) 72000
976 (PID.TID 0000.0001) ;
977 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
978 (PID.TID 0000.0001) 20
979 (PID.TID 0000.0001) ;
980 (PID.TID 0000.0001) deltatTmom = /* Momentum equation timestep ( s ) */
981 (PID.TID 0000.0001) 1.200000000000000E+03
982 (PID.TID 0000.0001) ;
983 (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
984 (PID.TID 0000.0001) 8.640000000000000E+04
985 (PID.TID 0000.0001) ;
986 (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
987 (PID.TID 0000.0001) 15 @ 8.640000000000000E+04 /* K = 1: 15 */
988 (PID.TID 0000.0001) ;
989 (PID.TID 0000.0001) deltatTClock = /* Model clock timestep ( s ) */
990 (PID.TID 0000.0001) 8.640000000000000E+04
991 (PID.TID 0000.0001) ;
992 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
993 (PID.TID 0000.0001) 0.000000000000000E+00
994 (PID.TID 0000.0001) ;
995 (PID.TID 0000.0001) forcing_In_AB = /* put T,S Forcing in Adams-Bash. stepping */
996 (PID.TID 0000.0001) F
997 (PID.TID 0000.0001) ;
998 (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
999 (PID.TID 0000.0001) 1.000000000000000E-01
1000 (PID.TID 0000.0001) ;
1001 (PID.TID 0000.0001) baseTime = /* Model base time ( s ). */
1002 (PID.TID 0000.0001) 0.000000000000000E+00
1003 (PID.TID 0000.0001) ;
1004 (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
1005 (PID.TID 0000.0001) 6.220800000000000E+09
1006 (PID.TID 0000.0001) ;
1007 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
1008 (PID.TID 0000.0001) 6.222528000000000E+09
1009 (PID.TID 0000.0001) ;
1010 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
1011 (PID.TID 0000.0001) 1.728000000000000E+06
1012 (PID.TID 0000.0001) ;
1013 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
1014 (PID.TID 0000.0001) 0.000000000000000E+00
1015 (PID.TID 0000.0001) ;
1016 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1017 (PID.TID 0000.0001) T
1018 (PID.TID 0000.0001) ;
1019 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1020 (PID.TID 0000.0001) T
1021 (PID.TID 0000.0001) ;
1022 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1023 (PID.TID 0000.0001) F
1024 (PID.TID 0000.0001) ;
1025 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1026 (PID.TID 0000.0001) 6.220800000000000E+08
1027 (PID.TID 0000.0001) ;
1028 (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1029 (PID.TID 0000.0001) T
1030 (PID.TID 0000.0001) ;
1031 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1032 (PID.TID 0000.0001) T
1033 (PID.TID 0000.0001) ;
1034 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1035 (PID.TID 0000.0001) 1.000000000000000E+00
1036 (PID.TID 0000.0001) ;
1037 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1038 (PID.TID 0000.0001) T
1039 (PID.TID 0000.0001) ;
1040 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1041 (PID.TID 0000.0001) 2.592000000000000E+06
1042 (PID.TID 0000.0001) ;
1043 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1044 (PID.TID 0000.0001) 3.110400000000000E+07
1045 (PID.TID 0000.0001) ;
1046 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1047 (PID.TID 0000.0001) 5.184000000000000E+06
1048 (PID.TID 0000.0001) ;
1049 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1050 (PID.TID 0000.0001) 6.220800000000000E+07
1051 (PID.TID 0000.0001) ;
1052 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1053 (PID.TID 0000.0001) 1.800000000000000E+02
1054 (PID.TID 0000.0001) ;
1055 (PID.TID 0000.0001) //
1056 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1057 (PID.TID 0000.0001) //
1058 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True / False ) */
1059 (PID.TID 0000.0001) F
1060 (PID.TID 0000.0001) ;
1061 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True / False ) */
1062 (PID.TID 0000.0001) F
1063 (PID.TID 0000.0001) ;
1064 (PID.TID 0000.0001) usingCylindricalGrid = /* Spherical coordinates flag ( True / False ) */
1065 (PID.TID 0000.0001) F
1066 (PID.TID 0000.0001) ;
1067 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r ) */
1068 (PID.TID 0000.0001) 0.000000000000000E+00
1069 (PID.TID 0000.0001) ;
1070 (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1071 (PID.TID 0000.0001) -1.000000000000000E+00
1072 (PID.TID 0000.0001) ;
1073 (PID.TID 0000.0001) horiVertRatio = /* Ratio on units : Horiz - Vertical */
1074 (PID.TID 0000.0001) 1.000000000000000E+00
1075 (PID.TID 0000.0001) ;
1076 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1077 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1078 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1079 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1080 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1081 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1082 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1083 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1084 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1085 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1086 (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1087 (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1088 (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1089 (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1090 (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1091 (PID.TID 0000.0001) 6.650000000000000E+02 /* K = 15 */
1092 (PID.TID 0000.0001) ;
1093 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1094 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1095 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1096 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1097 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1098 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1099 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1100 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1101 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1102 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1103 (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1104 (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1105 (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1106 (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1107 (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1108 (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1109 (PID.TID 0000.0001) ;
1110 (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
1111 (PID.TID 0000.0001) 192 @ 1.234567000000000E+05 /* I = 1:192 */
1112 (PID.TID 0000.0001) ;
1113 (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
1114 (PID.TID 0000.0001) 32 @ 1.234567000000000E+05 /* J = 1: 32 */
1115 (PID.TID 0000.0001) ;
1116 (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
1117 (PID.TID 0000.0001) 0.000000000000000E+00
1118 (PID.TID 0000.0001) ;
1119 (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
1120 (PID.TID 0000.0001) 0.000000000000000E+00
1121 (PID.TID 0000.0001) ;
1122 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1123 (PID.TID 0000.0001) 6.370000000000000E+06
1124 (PID.TID 0000.0001) ;
1125 (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
1126 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1127 (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1128 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1129 (PID.TID 0000.0001) -3.923446288487304E+01, /* I = 4 */
1130 (PID.TID 0000.0001) -3.702585158682200E+01, /* I = 5 */
1131 (PID.TID 0000.0001) -3.461179367094151E+01, /* I = 6 */
1132 (PID.TID 0000.0001) -3.200434569041793E+01, /* I = 7 */
1133 (PID.TID 0000.0001) -2.921355965632675E+01, /* I = 8 */
1134 (PID.TID 0000.0001) -2.624932223028290E+01, /* I = 9 */
1135 (PID.TID 0000.0001) -2.312261250426344E+01, /* I = 10 */
1136 (PID.TID 0000.0001) -1.984640717127058E+01, /* I = 11 */
1137 (PID.TID 0000.0001) -1.643630800555134E+01, /* I = 12 */
1138 (PID.TID 0000.0001) -1.291089806302069E+01, /* I = 13 */
1139 (PID.TID 0000.0001) -9.291807802719402E+00, /* I = 14 */
1140 (PID.TID 0000.0001) -5.603475335822332E+00, /* I = 15 */
1141 (PID.TID 0000.0001) -1.872608513033445E+00, /* I = 16 */
1142 (PID.TID 0000.0001) 1.872608513033445E+00, /* I = 17 */
1143 (PID.TID 0000.0001) 5.603475335822332E+00, /* I = 18 */
1144 (PID.TID 0000.0001) 9.291807802719402E+00, /* I = 19 */
1145 (PID.TID 0000.0001) 1.291089806302069E+01, /* I = 20 */
1146 (PID.TID 0000.0001) 1.643630800555134E+01, /* I = 21 */
1147 (PID.TID 0000.0001) 1.984640717127058E+01, /* I = 22 */
1148 (PID.TID 0000.0001) 2.312261250426344E+01, /* I = 23 */
1149 (PID.TID 0000.0001) 2.624932223028290E+01, /* I = 24 */
1150 (PID.TID 0000.0001) 2.921355965632675E+01, /* I = 25 */
1151 (PID.TID 0000.0001) 3.200434569041793E+01, /* I = 26 */
1152 (PID.TID 0000.0001) 3.461179367094151E+01, /* I = 27 */
1153 (PID.TID 0000.0001) 3.702585158682200E+01, /* I = 28 */
1154 (PID.TID 0000.0001) 3.923446288487304E+01, /* I = 29 */
1155 (PID.TID 0000.0001) 4.122055553388957E+01, /* I = 30 */
1156 (PID.TID 0000.0001) 4.295641272275883E+01, /* I = 31 */
1157 (PID.TID 0000.0001) 4.439521994760536E+01, /* I = 32 */
1158 (PID.TID 0000.0001) 4.560478005239464E+01, /* I = 33 */
1159 (PID.TID 0000.0001) 4.704358727724117E+01, /* I = 34 */
1160 (PID.TID 0000.0001) 4.877944446611043E+01, /* I = 35 */
1161 (PID.TID 0000.0001) 5.076553711512697E+01, /* I = 36 */
1162 (PID.TID 0000.0001) 5.297414841317801E+01, /* I = 37 */
1163 (PID.TID 0000.0001) 5.538820632905850E+01, /* I = 38 */
1164 (PID.TID 0000.0001) 5.799565430958209E+01, /* I = 39 */
1165 (PID.TID 0000.0001) 6.078644034367325E+01, /* I = 40 */
1166 (PID.TID 0000.0001) 6.375067776971711E+01, /* I = 41 */
1167 (PID.TID 0000.0001) 6.687738749573657E+01, /* I = 42 */
1168 (PID.TID 0000.0001) 7.015359282872943E+01, /* I = 43 */
1169 (PID.TID 0000.0001) 7.356369199444866E+01, /* I = 44 */
1170 (PID.TID 0000.0001) 7.708910193697932E+01, /* I = 45 */
1171 (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1172 (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1173 (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1174 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1175 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1176 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1177 (PID.TID 0000.0001) 1.029108980630207E+02, /* I = 52 */
1178 (PID.TID 0000.0001) 1.064363080055513E+02, /* I = 53 */
1179 (PID.TID 0000.0001) 1.098464071712706E+02, /* I = 54 */
1180 (PID.TID 0000.0001) 1.131226125042634E+02, /* I = 55 */
1181 (PID.TID 0000.0001) 1.162493222302829E+02, /* I = 56 */
1182 (PID.TID 0000.0001) 1.192135596563268E+02, /* I = 57 */
1183 (PID.TID 0000.0001) 1.220043456904179E+02, /* I = 58 */
1184 (PID.TID 0000.0001) 1.246117936709415E+02, /* I = 59 */
1185 (PID.TID 0000.0001) 1.270258515868220E+02, /* I = 60 */
1186 (PID.TID 0000.0001) 1.292344628848730E+02, /* I = 61 */
1187 (PID.TID 0000.0001) 1.312205555338896E+02, /* I = 62 */
1188 (PID.TID 0000.0001) 1.329564127227588E+02, /* I = 63 */
1189 (PID.TID 0000.0001) 1.343952199476053E+02, /* I = 64 */
1190 (PID.TID 0000.0001) 4.500000000000000E+01, /* I = 65 */
1191 (PID.TID 0000.0001) 4.620805468796297E+01, /* I = 66 */
1192 (PID.TID 0000.0001) 4.781369642513039E+01, /* I = 67 */
1193 (PID.TID 0000.0001) 4.971767671143929E+01, /* I = 68 */
1194 (PID.TID 0000.0001) 5.187738319787235E+01, /* I = 69 */
1195 (PID.TID 0000.0001) 5.427004371478710E+01, /* I = 70 */
1196 (PID.TID 0000.0001) 5.688128325334060E+01, /* I = 71 */
1197 (PID.TID 0000.0001) 5.970018167786760E+01, /* I = 72 */
1198 (PID.TID 0000.0001) 6.271654991792347E+01, /* I = 73 */
1199 (PID.TID 0000.0001) 6.591914604853015E+01, /* I = 74 */
1200 (PID.TID 0000.0001) 6.929439270484148E+01, /* I = 75 */
1201 (PID.TID 0000.0001) 7.282545807616151E+01, /* I = 76 */
1202 (PID.TID 0000.0001) 7.649168830618933E+01, /* I = 77 */
1203 (PID.TID 0000.0001) 8.026842803787176E+01, /* I = 78 */
1204 (PID.TID 0000.0001) 8.412726743124185E+01, /* I = 79 */
1205 (PID.TID 0000.0001) 8.803672008547504E+01, /* I = 80 */
1206 (PID.TID 0000.0001) 9.196327991452496E+01, /* I = 81 */
1207 (PID.TID 0000.0001) 9.587273256875815E+01, /* I = 82 */
1208 (PID.TID 0000.0001) 9.973157196212824E+01, /* I = 83 */
1209 (PID.TID 0000.0001) 1.035083116938107E+02, /* I = 84 */
1210 (PID.TID 0000.0001) 1.071745419238385E+02, /* I = 85 */
1211 (PID.TID 0000.0001) 1.107056072951585E+02, /* I = 86 */
1212 (PID.TID 0000.0001) 1.140808539514698E+02, /* I = 87 */
1213 (PID.TID 0000.0001) 1.172834500820765E+02, /* I = 88 */
1214 (PID.TID 0000.0001) 1.202998183221324E+02, /* I = 89 */
1215 (PID.TID 0000.0001) 1.231187167466594E+02, /* I = 90 */
1216 (PID.TID 0000.0001) 1.257299562852129E+02, /* I = 91 */
1217 (PID.TID 0000.0001) 1.281226168021277E+02, /* I = 92 */
1218 (PID.TID 0000.0001) 1.302823232885607E+02, /* I = 93 */
1219 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1220 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1221 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1222 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1223 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1224 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1225 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =100 */
1226 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =101 */
1227 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =102 */
1228 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =103 */
1229 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =104 */
1230 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =105 */
1231 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =106 */
1232 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =107 */
1233 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =108 */
1234 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =109 */
1235 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =110 */
1236 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =111 */
1237 (PID.TID 0000.0001) 2 @ 1.363550967500717E+02, /* I =112:113 */
1238 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =114 */
1239 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =115 */
1240 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =116 */
1241 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =117 */
1242 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =118 */
1243 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =119 */
1244 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =120 */
1245 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =121 */
1246 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =122 */
1247 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =123 */
1248 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =124 */
1249 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =125 */
1250 (PID.TID 0000.0001) 1.359720382181193E+02, /* I =126 */
1251 (PID.TID 0000.0001) 1.358367907661329E+02, /* I =127 */
1252 (PID.TID 0000.0001) 1.356047800523947E+02, /* I =128 */
1253 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =129 */
1254 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =130 */
1255 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =131 */
1256 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =132 */
1257 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =133 */
1258 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =134 */
1259 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =135 */
1260 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =136 */
1261 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =137 */
1262 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =138 */
1263 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =139 */
1264 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =140 */
1265 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =141 */
1266 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1267 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1268 (PID.TID 0000.0001) 2 @ -1.336449032499283E+02, /* I =144:145 */
1269 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1270 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1271 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =148 */
1272 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =149 */
1273 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =150 */
1274 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =151 */
1275 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =152 */
1276 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =153 */
1277 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =154 */
1278 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =155 */
1279 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =156 */
1280 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =157 */
1281 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =158 */
1282 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =159 */
1283 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =160 */
1284 (PID.TID 0000.0001) -1.350000000000000E+02, /* I =161 */
1285 (PID.TID 0000.0001) -1.362080546879630E+02, /* I =162 */
1286 (PID.TID 0000.0001) -1.378136964251304E+02, /* I =163 */
1287 (PID.TID 0000.0001) -1.397176767114393E+02, /* I =164 */
1288 (PID.TID 0000.0001) -1.418773831978723E+02, /* I =165 */
1289 (PID.TID 0000.0001) -1.442700437147871E+02, /* I =166 */
1290 (PID.TID 0000.0001) -1.468812832533406E+02, /* I =167 */
1291 (PID.TID 0000.0001) -1.497001816778676E+02, /* I =168 */
1292 (PID.TID 0000.0001) -1.527165499179235E+02, /* I =169 */
1293 (PID.TID 0000.0001) -1.559191460485302E+02, /* I =170 */
1294 (PID.TID 0000.0001) -1.592943927048415E+02, /* I =171 */
1295 (PID.TID 0000.0001) -1.628254580761615E+02, /* I =172 */
1296 (PID.TID 0000.0001) -1.664916883061893E+02, /* I =173 */
1297 (PID.TID 0000.0001) -1.702684280378718E+02, /* I =174 */
1298 (PID.TID 0000.0001) -1.741272674312418E+02, /* I =175 */
1299 (PID.TID 0000.0001) -1.780367200854751E+02, /* I =176 */
1300 (PID.TID 0000.0001) 1.780367200854751E+02, /* I =177 */
1301 (PID.TID 0000.0001) 1.741272674312418E+02, /* I =178 */
1302 (PID.TID 0000.0001) 1.702684280378718E+02, /* I =179 */
1303 (PID.TID 0000.0001) 1.664916883061893E+02, /* I =180 */
1304 (PID.TID 0000.0001) 1.628254580761615E+02, /* I =181 */
1305 (PID.TID 0000.0001) 1.592943927048415E+02, /* I =182 */
1306 (PID.TID 0000.0001) 1.559191460485302E+02, /* I =183 */
1307 (PID.TID 0000.0001) 1.527165499179235E+02, /* I =184 */
1308 (PID.TID 0000.0001) 1.497001816778676E+02, /* I =185 */
1309 (PID.TID 0000.0001) 1.468812832533406E+02, /* I =186 */
1310 (PID.TID 0000.0001) 1.442700437147871E+02, /* I =187 */
1311 (PID.TID 0000.0001) 1.418773831978723E+02, /* I =188 */
1312 (PID.TID 0000.0001) 1.397176767114393E+02, /* I =189 */
1313 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1314 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1315 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1316 (PID.TID 0000.0001) ;
1317 (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
1318 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1319 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1320 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1321 (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1322 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1323 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1324 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1325 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1326 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1327 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1328 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1329 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1330 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1331 (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1332 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1333 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1334 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1335 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1336 (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1337 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1338 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1339 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1340 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1341 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1342 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1343 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1344 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1345 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1346 (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1347 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1348 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1349 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1350 (PID.TID 0000.0001) ;
1351 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1352 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1353 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1354 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1355 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1356 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1357 (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1358 (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1359 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1360 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1361 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1362 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1363 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1364 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1365 (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1366 (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1367 (PID.TID 0000.0001) ;
1368 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1369 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1370 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1371 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1372 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1373 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1374 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1375 (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1376 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1377 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1378 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1379 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1380 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1381 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1382 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1383 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1384 (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1385 (PID.TID 0000.0001) ;
1386 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1387 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1388 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1389 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1390 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 4 */
1391 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 5 */
1392 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 6 */
1393 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 7 */
1394 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 8 */
1395 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 9 */
1396 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 10 */
1397 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 11 */
1398 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 12 */
1399 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 13 */
1400 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 14 */
1401 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 15 */
1402 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 16: 17 */
1403 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 18 */
1404 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 19 */
1405 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 20 */
1406 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 21 */
1407 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 22 */
1408 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 23 */
1409 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 24 */
1410 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 25 */
1411 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 26 */
1412 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 27 */
1413 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 28 */
1414 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 29 */
1415 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 30 */
1416 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 31 */
1417 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1418 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 34 */
1419 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 35 */
1420 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 36 */
1421 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 37 */
1422 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 38 */
1423 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 39 */
1424 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 40 */
1425 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 41 */
1426 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 42 */
1427 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 43 */
1428 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 44 */
1429 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 45 */
1430 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1431 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1432 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 48: 49 */
1433 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1434 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1435 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 52 */
1436 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 53 */
1437 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 54 */
1438 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 55 */
1439 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 56 */
1440 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 57 */
1441 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 58 */
1442 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 59 */
1443 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 60 */
1444 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 61 */
1445 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 62 */
1446 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 63 */
1447 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1448 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 66 */
1449 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 67 */
1450 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 68 */
1451 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 69 */
1452 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 70 */
1453 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 71 */
1454 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 72 */
1455 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 73 */
1456 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 74 */
1457 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 75 */
1458 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 76 */
1459 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 77 */
1460 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 78 */
1461 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 79 */
1462 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 80: 81 */
1463 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 82 */
1464 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 83 */
1465 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 84 */
1466 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 85 */
1467 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 86 */
1468 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 87 */
1469 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 88 */
1470 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 89 */
1471 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 90 */
1472 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 91 */
1473 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 92 */
1474 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 93 */
1475 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1476 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1477 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1478 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1479 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1480 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =100 */
1481 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =101 */
1482 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =102 */
1483 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =103 */
1484 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =104 */
1485 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =105 */
1486 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =106 */
1487 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =107 */
1488 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =108 */
1489 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =109 */
1490 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =110 */
1491 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =111 */
1492 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =112:113 */
1493 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =114 */
1494 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =115 */
1495 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =116 */
1496 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =117 */
1497 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =118 */
1498 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =119 */
1499 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =120 */
1500 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =121 */
1501 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =122 */
1502 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =123 */
1503 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =124 */
1504 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =125 */
1505 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =126 */
1506 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =127 */
1507 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1508 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =130 */
1509 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =131 */
1510 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =132 */
1511 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =133 */
1512 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =134 */
1513 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =135 */
1514 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =136 */
1515 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =137 */
1516 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =138 */
1517 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =139 */
1518 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =140 */
1519 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =141 */
1520 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
1521 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
1522 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =144:145 */
1523 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
1524 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
1525 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =148 */
1526 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =149 */
1527 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =150 */
1528 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =151 */
1529 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =152 */
1530 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =153 */
1531 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =154 */
1532 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =155 */
1533 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =156 */
1534 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =157 */
1535 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =158 */
1536 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =159 */
1537 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1538 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =162 */
1539 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =163 */
1540 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =164 */
1541 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =165 */
1542 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =166 */
1543 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =167 */
1544 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =168 */
1545 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =169 */
1546 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =170 */
1547 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =171 */
1548 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =172 */
1549 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =173 */
1550 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =174 */
1551 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =175 */
1552 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =176:177 */
1553 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =178 */
1554 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =179 */
1555 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =180 */
1556 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =181 */
1557 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =182 */
1558 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =183 */
1559 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =184 */
1560 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =185 */
1561 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =186 */
1562 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =187 */
1563 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =188 */
1564 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =189 */
1565 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
1566 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
1567 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1568 (PID.TID 0000.0001) ;
1569 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( m - cartesian, degrees - spherical ) */
1570 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1571 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
1572 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
1573 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
1574 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
1575 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
1576 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
1577 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
1578 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
1579 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
1580 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
1581 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
1582 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
1583 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
1584 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
1585 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
1586 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
1587 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
1588 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
1589 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
1590 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
1591 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
1592 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
1593 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
1594 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
1595 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
1596 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
1597 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
1598 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
1599 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
1600 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1601 (PID.TID 0000.0001) ;
1602 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1603 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1604 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
1605 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
1606 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 4 */
1607 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 5 */
1608 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 6 */
1609 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 7 */
1610 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 8 */
1611 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 9 */
1612 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 10 */
1613 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 11 */
1614 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 12 */
1615 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 13 */
1616 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 14 */
1617 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 15 */
1618 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 16: 17 */
1619 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 18 */
1620 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 19 */
1621 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 20 */
1622 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 21 */
1623 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 22 */
1624 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 23 */
1625 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 24 */
1626 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 25 */
1627 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 26 */
1628 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 27 */
1629 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 28 */
1630 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 29 */
1631 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 30 */
1632 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 31 */
1633 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1634 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 34 */
1635 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 35 */
1636 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 36 */
1637 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 37 */
1638 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 38 */
1639 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 39 */
1640 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 40 */
1641 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 41 */
1642 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 42 */
1643 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 43 */
1644 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 44 */
1645 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 45 */
1646 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
1647 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
1648 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 48: 49 */
1649 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
1650 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
1651 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 52 */
1652 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 53 */
1653 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 54 */
1654 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 55 */
1655 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 56 */
1656 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 57 */
1657 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 58 */
1658 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 59 */
1659 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 60 */
1660 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 61 */
1661 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 62 */
1662 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 63 */
1663 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1664 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 66 */
1665 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 67 */
1666 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 68 */
1667 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 69 */
1668 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 70 */
1669 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 71 */
1670 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 72 */
1671 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 73 */
1672 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 74 */
1673 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 75 */
1674 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 76 */
1675 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 77 */
1676 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 78 */
1677 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 79 */
1678 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 80: 81 */
1679 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 82 */
1680 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 83 */
1681 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 84 */
1682 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 85 */
1683 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 86 */
1684 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 87 */
1685 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 88 */
1686 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 89 */
1687 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 90 */
1688 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 91 */
1689 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 92 */
1690 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 93 */
1691 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
1692 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
1693 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1694 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
1695 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
1696 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =100 */
1697 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =101 */
1698 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =102 */
1699 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =103 */
1700 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =104 */
1701 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =105 */
1702 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =106 */
1703 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =107 */
1704 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =108 */
1705 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =109 */
1706 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =110 */
1707 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =111 */
1708 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =112:113 */
1709 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =114 */
1710 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =115 */
1711 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =116 */
1712 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =117 */
1713 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =118 */
1714 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =119 */
1715 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =120 */
1716 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =121 */
1717 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =122 */
1718 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =123 */
1719 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =124 */
1720 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =125 */
1721 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =126 */
1722 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =127 */
1723 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1724 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =130 */
1725 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =131 */
1726 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =132 */
1727 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =133 */
1728 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =134 */
1729 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =135 */
1730 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =136 */
1731 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =137 */
1732 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =138 */
1733 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =139 */
1734 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =140 */
1735 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =141 */
1736 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
1737 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
1738 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =144:145 */
1739 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
1740 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
1741 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =148 */
1742 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =149 */
1743 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =150 */
1744 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =151 */
1745 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =152 */
1746 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =153 */
1747 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =154 */
1748 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =155 */
1749 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =156 */
1750 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =157 */
1751 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =158 */
1752 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =159 */
1753 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1754 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =162 */
1755 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =163 */
1756 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =164 */
1757 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =165 */
1758 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =166 */
1759 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =167 */
1760 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =168 */
1761 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =169 */
1762 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =170 */
1763 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =171 */
1764 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =172 */
1765 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =173 */
1766 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =174 */
1767 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =175 */
1768 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =176:177 */
1769 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =178 */
1770 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =179 */
1771 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =180 */
1772 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =181 */
1773 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =182 */
1774 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =183 */
1775 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =184 */
1776 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =185 */
1777 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =186 */
1778 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =187 */
1779 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =188 */
1780 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =189 */
1781 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
1782 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
1783 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1784 (PID.TID 0000.0001) ;
1785 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( m - cartesian, degrees - spherical ) */
1786 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1787 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
1788 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
1789 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
1790 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
1791 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
1792 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
1793 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
1794 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
1795 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
1796 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
1797 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
1798 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
1799 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
1800 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
1801 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
1802 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
1803 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
1804 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
1805 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
1806 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
1807 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
1808 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
1809 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
1810 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
1811 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
1812 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
1813 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
1814 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
1815 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
1816 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1817 (PID.TID 0000.0001) ;
1818 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1819 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1820 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
1821 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
1822 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 4 */
1823 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 5 */
1824 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 6 */
1825 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 7 */
1826 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 8 */
1827 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 9 */
1828 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 10 */
1829 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 11 */
1830 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 12 */
1831 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 13 */
1832 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 14 */
1833 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 15 */
1834 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 16: 17 */
1835 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 18 */
1836 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 19 */
1837 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 20 */
1838 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 21 */
1839 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 22 */
1840 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 23 */
1841 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 24 */
1842 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 25 */
1843 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 26 */
1844 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 27 */
1845 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 28 */
1846 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 29 */
1847 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 30 */
1848 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 31 */
1849 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 32: 33 */
1850 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 34 */
1851 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 35 */
1852 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 36 */
1853 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 37 */
1854 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 38 */
1855 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 39 */
1856 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 40 */
1857 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 41 */
1858 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 42 */
1859 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 43 */
1860 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 44 */
1861 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 45 */
1862 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
1863 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
1864 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 48: 49 */
1865 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
1866 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
1867 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 52 */
1868 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 53 */
1869 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 54 */
1870 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 55 */
1871 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 56 */
1872 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 57 */
1873 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 58 */
1874 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 59 */
1875 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 60 */
1876 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 61 */
1877 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 62 */
1878 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 63 */
1879 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 64: 65 */
1880 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 66 */
1881 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 67 */
1882 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 68 */
1883 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 69 */
1884 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 70 */
1885 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 71 */
1886 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 72 */
1887 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 73 */
1888 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 74 */
1889 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 75 */
1890 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 76 */
1891 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 77 */
1892 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 78 */
1893 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 79 */
1894 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 80: 81 */
1895 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 82 */
1896 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 83 */
1897 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 84 */
1898 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 85 */
1899 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 86 */
1900 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 87 */
1901 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 88 */
1902 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 89 */
1903 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 90 */
1904 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 91 */
1905 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 92 */
1906 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 93 */
1907 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
1908 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
1909 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 96: 97 */
1910 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
1911 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
1912 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =100 */
1913 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =101 */
1914 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =102 */
1915 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =103 */
1916 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =104 */
1917 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =105 */
1918 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =106 */
1919 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =107 */
1920 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =108 */
1921 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =109 */
1922 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =110 */
1923 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =111 */
1924 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =112:113 */
1925 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =114 */
1926 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =115 */
1927 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =116 */
1928 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =117 */
1929 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =118 */
1930 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =119 */
1931 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =120 */
1932 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =121 */
1933 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =122 */
1934 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =123 */
1935 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =124 */
1936 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =125 */
1937 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =126 */
1938 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =127 */
1939 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =128:129 */
1940 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =130 */
1941 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =131 */
1942 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =132 */
1943 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =133 */
1944 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =134 */
1945 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =135 */
1946 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =136 */
1947 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =137 */
1948 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =138 */
1949 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =139 */
1950 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =140 */
1951 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =141 */
1952 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
1953 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
1954 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =144:145 */
1955 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
1956 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
1957 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =148 */
1958 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =149 */
1959 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =150 */
1960 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =151 */
1961 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =152 */
1962 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =153 */
1963 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =154 */
1964 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =155 */
1965 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =156 */
1966 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =157 */
1967 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =158 */
1968 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =159 */
1969 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =160:161 */
1970 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =162 */
1971 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =163 */
1972 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =164 */
1973 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =165 */
1974 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =166 */
1975 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =167 */
1976 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =168 */
1977 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =169 */
1978 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =170 */
1979 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =171 */
1980 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =172 */
1981 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =173 */
1982 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =174 */
1983 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =175 */
1984 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =176:177 */
1985 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =178 */
1986 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =179 */
1987 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =180 */
1988 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =181 */
1989 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =182 */
1990 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =183 */
1991 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =184 */
1992 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =185 */
1993 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =186 */
1994 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =187 */
1995 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =188 */
1996 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =189 */
1997 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
1998 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
1999 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
2000 (PID.TID 0000.0001) ;
2001 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2002 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2003 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
2004 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
2005 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
2006 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
2007 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
2008 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
2009 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
2010 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
2011 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
2012 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
2013 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
2014 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
2015 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
2016 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
2017 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
2018 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
2019 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
2020 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
2021 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
2022 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
2023 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
2024 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
2025 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
2026 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
2027 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
2028 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
2029 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
2030 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
2031 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
2032 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
2033 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
2034 (PID.TID 0000.0001) ;
2035 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2036 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2037 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
2038 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
2039 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 4 */
2040 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 5 */
2041 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 6 */
2042 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 7 */
2043 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 8 */
2044 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 9 */
2045 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 10 */
2046 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 11 */
2047 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 12 */
2048 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 13 */
2049 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 14 */
2050 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 15 */
2051 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 16 */
2052 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 17 */
2053 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 18 */
2054 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 19 */
2055 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 20 */
2056 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 21 */
2057 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 22 */
2058 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 23 */
2059 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 24 */
2060 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 25 */
2061 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 26 */
2062 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 27 */
2063 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 28 */
2064 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 29 */
2065 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 30 */
2066 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 31 */
2067 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 32 */
2068 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 33 */
2069 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 34 */
2070 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 35 */
2071 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 36 */
2072 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 37 */
2073 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 38 */
2074 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 39 */
2075 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 40 */
2076 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 41 */
2077 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 42 */
2078 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 43 */
2079 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 44 */
2080 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 45 */
2081 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
2082 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
2083 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
2084 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
2085 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
2086 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
2087 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 52 */
2088 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 53 */
2089 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 54 */
2090 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 55 */
2091 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 56 */
2092 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 57 */
2093 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 58 */
2094 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 59 */
2095 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 60 */
2096 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 61 */
2097 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 62 */
2098 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 63 */
2099 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 64 */
2100 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 65 */
2101 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 66 */
2102 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 67 */
2103 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 68 */
2104 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 69 */
2105 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 70 */
2106 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 71 */
2107 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 72 */
2108 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 73 */
2109 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 74 */
2110 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 75 */
2111 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 76 */
2112 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 77 */
2113 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 78 */
2114 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 79 */
2115 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 80 */
2116 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 81 */
2117 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 82 */
2118 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 83 */
2119 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 84 */
2120 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 85 */
2121 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 86 */
2122 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 87 */
2123 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 88 */
2124 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 89 */
2125 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 90 */
2126 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 91 */
2127 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 92 */
2128 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 93 */
2129 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
2130 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
2131 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
2132 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
2133 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
2134 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
2135 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =100 */
2136 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =101 */
2137 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =102 */
2138 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =103 */
2139 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =104 */
2140 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =105 */
2141 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =106 */
2142 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =107 */
2143 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =108 */
2144 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =109 */
2145 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =110 */
2146 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =111 */
2147 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =112 */
2148 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =113 */
2149 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =114 */
2150 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =115 */
2151 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =116 */
2152 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =117 */
2153 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =118 */
2154 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =119 */
2155 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =120 */
2156 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =121 */
2157 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =122 */
2158 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =123 */
2159 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =124 */
2160 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =125 */
2161 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =126 */
2162 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =127 */
2163 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =128 */
2164 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =129 */
2165 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =130 */
2166 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =131 */
2167 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =132 */
2168 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =133 */
2169 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =134 */
2170 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =135 */
2171 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =136 */
2172 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =137 */
2173 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =138 */
2174 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =139 */
2175 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =140 */
2176 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =141 */
2177 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
2178 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
2179 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
2180 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
2181 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
2182 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
2183 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =148 */
2184 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =149 */
2185 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =150 */
2186 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =151 */
2187 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =152 */
2188 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =153 */
2189 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =154 */
2190 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =155 */
2191 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =156 */
2192 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =157 */
2193 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =158 */
2194 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =159 */
2195 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =160 */
2196 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =161 */
2197 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =162 */
2198 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =163 */
2199 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =164 */
2200 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =165 */
2201 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =166 */
2202 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =167 */
2203 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =168 */
2204 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =169 */
2205 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =170 */
2206 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =171 */
2207 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =172 */
2208 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =173 */
2209 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =174 */
2210 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =175 */
2211 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =176 */
2212 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =177 */
2213 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =178 */
2214 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =179 */
2215 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =180 */
2216 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =181 */
2217 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =182 */
2218 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =183 */
2219 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =184 */
2220 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =185 */
2221 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =186 */
2222 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =187 */
2223 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =188 */
2224 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =189 */
2225 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
2226 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
2227 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
2228 (PID.TID 0000.0001) ;
2229 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2230 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2231 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
2232 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
2233 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
2234 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
2235 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
2236 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
2237 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
2238 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
2239 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
2240 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
2241 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
2242 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
2243 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
2244 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
2245 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
2246 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
2247 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
2248 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
2249 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
2250 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
2251 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
2252 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
2253 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
2254 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
2255 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
2256 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
2257 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
2258 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
2259 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
2260 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
2261 (PID.TID 0000.0001) ;
2262 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2263 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2264 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
2265 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
2266 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 4 */
2267 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 5 */
2268 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 6 */
2269 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 7 */
2270 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 8 */
2271 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 9 */
2272 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 10 */
2273 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 11 */
2274 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 12 */
2275 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 13 */
2276 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 14 */
2277 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 15 */
2278 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 16 */
2279 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 17 */
2280 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 18 */
2281 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 19 */
2282 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 20 */
2283 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 21 */
2284 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 22 */
2285 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 23 */
2286 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 24 */
2287 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 25 */
2288 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 26 */
2289 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 27 */
2290 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 28 */
2291 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 29 */
2292 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 30 */
2293 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 31 */
2294 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 32 */
2295 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 33 */
2296 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 34 */
2297 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 35 */
2298 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 36 */
2299 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 37 */
2300 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 38 */
2301 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 39 */
2302 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 40 */
2303 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 41 */
2304 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 42 */
2305 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 43 */
2306 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 44 */
2307 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 45 */
2308 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
2309 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
2310 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
2311 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
2312 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
2313 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
2314 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 52 */
2315 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 53 */
2316 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 54 */
2317 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 55 */
2318 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 56 */
2319 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 57 */
2320 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 58 */
2321 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 59 */
2322 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 60 */
2323 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 61 */
2324 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 62 */
2325 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 63 */
2326 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 64 */
2327 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 65 */
2328 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 66 */
2329 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 67 */
2330 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 68 */
2331 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 69 */
2332 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 70 */
2333 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 71 */
2334 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 72 */
2335 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 73 */
2336 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 74 */
2337 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 75 */
2338 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 76 */
2339 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 77 */
2340 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 78 */
2341 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 79 */
2342 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 80 */
2343 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 81 */
2344 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 82 */
2345 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 83 */
2346 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 84 */
2347 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 85 */
2348 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 86 */
2349 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 87 */
2350 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 88 */
2351 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 89 */
2352 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 90 */
2353 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 91 */
2354 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 92 */
2355 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 93 */
2356 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
2357 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
2358 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
2359 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
2360 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
2361 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
2362 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =100 */
2363 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =101 */
2364 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =102 */
2365 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =103 */
2366 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =104 */
2367 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =105 */
2368 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =106 */
2369 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =107 */
2370 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =108 */
2371 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =109 */
2372 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =110 */
2373 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =111 */
2374 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =112 */
2375 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =113 */
2376 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =114 */
2377 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =115 */
2378 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =116 */
2379 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =117 */
2380 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =118 */
2381 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =119 */
2382 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =120 */
2383 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =121 */
2384 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =122 */
2385 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =123 */
2386 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =124 */
2387 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =125 */
2388 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =126 */
2389 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =127 */
2390 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =128 */
2391 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =129 */
2392 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =130 */
2393 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =131 */
2394 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =132 */
2395 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =133 */
2396 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =134 */
2397 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =135 */
2398 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =136 */
2399 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =137 */
2400 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =138 */
2401 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =139 */
2402 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =140 */
2403 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =141 */
2404 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
2405 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
2406 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
2407 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
2408 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
2409 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
2410 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =148 */
2411 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =149 */
2412 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =150 */
2413 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =151 */
2414 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =152 */
2415 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =153 */
2416 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =154 */
2417 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =155 */
2418 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =156 */
2419 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =157 */
2420 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =158 */
2421 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =159 */
2422 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =160 */
2423 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =161 */
2424 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =162 */
2425 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =163 */
2426 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =164 */
2427 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =165 */
2428 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =166 */
2429 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =167 */
2430 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =168 */
2431 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =169 */
2432 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =170 */
2433 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =171 */
2434 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =172 */
2435 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =173 */
2436 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =174 */
2437 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =175 */
2438 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =176 */
2439 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =177 */
2440 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =178 */
2441 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =179 */
2442 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =180 */
2443 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =181 */
2444 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =182 */
2445 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =183 */
2446 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =184 */
2447 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =185 */
2448 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =186 */
2449 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =187 */
2450 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =188 */
2451 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =189 */
2452 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
2453 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
2454 (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
2455 (PID.TID 0000.0001) ;
2456 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2457 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2458 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
2459 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
2460 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
2461 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
2462 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
2463 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
2464 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
2465 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
2466 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
2467 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
2468 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
2469 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
2470 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
2471 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
2472 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
2473 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
2474 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
2475 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
2476 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
2477 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
2478 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
2479 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
2480 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
2481 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
2482 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
2483 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
2484 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
2485 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
2486 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
2487 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
2488 (PID.TID 0000.0001) ;
2489 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2490 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2491 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
2492 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
2493 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 4 */
2494 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 5 */
2495 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 6 */
2496 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 7 */
2497 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 8 */
2498 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 9 */
2499 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 10 */
2500 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 11 */
2501 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 12 */
2502 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 13 */
2503 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 14 */
2504 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 15 */
2505 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 16: 17 */
2506 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 18 */
2507 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 19 */
2508 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 20 */
2509 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 21 */
2510 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 22 */
2511 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 23 */
2512 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 24 */
2513 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 25 */
2514 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 26 */
2515 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 27 */
2516 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 28 */
2517 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 29 */
2518 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 30 */
2519 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 31 */
2520 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 32: 33 */
2521 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 34 */
2522 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 35 */
2523 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 36 */
2524 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 37 */
2525 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 38 */
2526 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 39 */
2527 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 40 */
2528 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 41 */
2529 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 42 */
2530 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 43 */
2531 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 44 */
2532 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 45 */
2533 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
2534 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
2535 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 48: 49 */
2536 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
2537 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
2538 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 52 */
2539 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 53 */
2540 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 54 */
2541 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 55 */
2542 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 56 */
2543 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 57 */
2544 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 58 */
2545 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 59 */
2546 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 60 */
2547 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 61 */
2548 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 62 */
2549 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 63 */
2550 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 64: 65 */
2551 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 66 */
2552 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 67 */
2553 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 68 */
2554 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 69 */
2555 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 70 */
2556 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 71 */
2557 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 72 */
2558 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 73 */
2559 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 74 */
2560 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 75 */
2561 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 76 */
2562 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 77 */
2563 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 78 */
2564 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 79 */
2565 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 80: 81 */
2566 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 82 */
2567 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 83 */
2568 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 84 */
2569 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 85 */
2570 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 86 */
2571 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 87 */
2572 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 88 */
2573 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 89 */
2574 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 90 */
2575 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 91 */
2576 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 92 */
2577 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 93 */
2578 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
2579 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
2580 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 96: 97 */
2581 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
2582 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
2583 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =100 */
2584 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =101 */
2585 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =102 */
2586 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =103 */
2587 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =104 */
2588 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =105 */
2589 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =106 */
2590 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =107 */
2591 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =108 */
2592 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =109 */
2593 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =110 */
2594 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =111 */
2595 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =112:113 */
2596 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =114 */
2597 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =115 */
2598 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =116 */
2599 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =117 */
2600 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =118 */
2601 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =119 */
2602 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =120 */
2603 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =121 */
2604 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =122 */
2605 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =123 */
2606 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =124 */
2607 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =125 */
2608 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =126 */
2609 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =127 */
2610 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =128:129 */
2611 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =130 */
2612 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =131 */
2613 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =132 */
2614 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =133 */
2615 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =134 */
2616 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =135 */
2617 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =136 */
2618 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =137 */
2619 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =138 */
2620 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =139 */
2621 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =140 */
2622 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =141 */
2623 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
2624 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
2625 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =144:145 */
2626 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
2627 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
2628 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =148 */
2629 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =149 */
2630 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =150 */
2631 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =151 */
2632 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =152 */
2633 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =153 */
2634 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =154 */
2635 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =155 */
2636 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =156 */
2637 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =157 */
2638 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =158 */
2639 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =159 */
2640 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =160:161 */
2641 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =162 */
2642 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =163 */
2643 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =164 */
2644 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =165 */
2645 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =166 */
2646 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =167 */
2647 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =168 */
2648 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =169 */
2649 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =170 */
2650 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =171 */
2651 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =172 */
2652 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =173 */
2653 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =174 */
2654 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =175 */
2655 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =176:177 */
2656 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =178 */
2657 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =179 */
2658 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =180 */
2659 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =181 */
2660 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =182 */
2661 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =183 */
2662 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =184 */
2663 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =185 */
2664 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =186 */
2665 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =187 */
2666 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =188 */
2667 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =189 */
2668 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
2669 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
2670 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
2671 (PID.TID 0000.0001) ;
2672 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2673 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2674 (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
2675 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
2676 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
2677 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
2678 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
2679 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
2680 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
2681 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
2682 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
2683 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
2684 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
2685 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
2686 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
2687 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
2688 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
2689 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
2690 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
2691 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
2692 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
2693 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
2694 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
2695 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
2696 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
2697 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
2698 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
2699 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
2700 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
2701 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
2702 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
2703 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
2704 (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
2705 (PID.TID 0000.0001) ;
2706 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2707 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
2708 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
2709 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
2710 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 4 */
2711 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 5 */
2712 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 6 */
2713 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 7 */
2714 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 8 */
2715 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 9 */
2716 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 10 */
2717 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 11 */
2718 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 12 */
2719 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 13 */
2720 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 14 */
2721 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 15 */
2722 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 16 */
2723 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 17 */
2724 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 18 */
2725 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 19 */
2726 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 20 */
2727 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 21 */
2728 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 22 */
2729 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 23 */
2730 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 24 */
2731 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 25 */
2732 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 26 */
2733 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 27 */
2734 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 28 */
2735 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 29 */
2736 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 30 */
2737 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 31 */
2738 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 32 */
2739 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
2740 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 34 */
2741 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 35 */
2742 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 36 */
2743 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 37 */
2744 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 38 */
2745 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 39 */
2746 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 40 */
2747 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 41 */
2748 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 42 */
2749 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 43 */
2750 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 44 */
2751 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 45 */
2752 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
2753 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
2754 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
2755 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
2756 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
2757 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
2758 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 52 */
2759 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 53 */
2760 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 54 */
2761 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 55 */
2762 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 56 */
2763 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 57 */
2764 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 58 */
2765 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 59 */
2766 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 60 */
2767 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 61 */
2768 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 62 */
2769 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 63 */
2770 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 64 */
2771 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
2772 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 66 */
2773 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 67 */
2774 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 68 */
2775 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 69 */
2776 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 70 */
2777 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 71 */
2778 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 72 */
2779 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 73 */
2780 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 74 */
2781 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 75 */
2782 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 76 */
2783 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 77 */
2784 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 78 */
2785 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 79 */
2786 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 80 */
2787 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 81 */
2788 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 82 */
2789 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 83 */
2790 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 84 */
2791 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 85 */
2792 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 86 */
2793 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 87 */
2794 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 88 */
2795 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 89 */
2796 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 90 */
2797 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 91 */
2798 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 92 */
2799 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 93 */
2800 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
2801 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
2802 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
2803 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
2804 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
2805 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
2806 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =100 */
2807 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =101 */
2808 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =102 */
2809 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =103 */
2810 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =104 */
2811 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =105 */
2812 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =106 */
2813 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =107 */
2814 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =108 */
2815 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =109 */
2816 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =110 */
2817 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =111 */
2818 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =112 */
2819 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =113 */
2820 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =114 */
2821 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =115 */
2822 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =116 */
2823 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =117 */
2824 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =118 */
2825 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =119 */
2826 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =120 */
2827 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =121 */
2828 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =122 */
2829 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =123 */
2830 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =124 */
2831 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =125 */
2832 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =126 */
2833 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =127 */
2834 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =128 */
2835 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
2836 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =130 */
2837 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =131 */
2838 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =132 */
2839 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =133 */
2840 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =134 */
2841 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =135 */
2842 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =136 */
2843 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =137 */
2844 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =138 */
2845 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =139 */
2846 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =140 */
2847 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =141 */
2848 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
2849 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
2850 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
2851 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
2852 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
2853 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
2854 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =148 */
2855 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =149 */
2856 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =150 */
2857 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =151 */
2858 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =152 */
2859 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =153 */
2860 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =154 */
2861 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =155 */
2862 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =156 */
2863 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =157 */
2864 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =158 */
2865 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =159 */
2866 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =160 */
2867 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
2868 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =162 */
2869 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =163 */
2870 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =164 */
2871 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =165 */
2872 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =166 */
2873 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =167 */
2874 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =168 */
2875 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =169 */
2876 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =170 */
2877 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =171 */
2878 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =172 */
2879 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =173 */
2880 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =174 */
2881 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =175 */
2882 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =176 */
2883 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =177 */
2884 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =178 */
2885 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =179 */
2886 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =180 */
2887 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =181 */
2888 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =182 */
2889 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =183 */
2890 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =184 */
2891 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =185 */
2892 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =186 */
2893 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =187 */
2894 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =188 */
2895 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =189 */
2896 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
2897 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
2898 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
2899 (PID.TID 0000.0001) ;
2900 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2901 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
2902 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
2903 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
2904 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
2905 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
2906 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
2907 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
2908 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
2909 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
2910 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
2911 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
2912 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
2913 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
2914 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
2915 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
2916 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
2917 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
2918 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
2919 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
2920 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
2921 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
2922 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
2923 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
2924 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
2925 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
2926 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
2927 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
2928 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
2929 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
2930 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
2931 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
2932 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
2933 (PID.TID 0000.0001) ;
2934 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2935 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
2936 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
2937 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
2938 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 4 */
2939 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 5 */
2940 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 6 */
2941 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 7 */
2942 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 8 */
2943 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 9 */
2944 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 10 */
2945 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 11 */
2946 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 12 */
2947 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 13 */
2948 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 14 */
2949 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 15 */
2950 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 16 */
2951 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 17 */
2952 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 18 */
2953 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 19 */
2954 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 20 */
2955 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 21 */
2956 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 22 */
2957 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 23 */
2958 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 24 */
2959 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 25 */
2960 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 26 */
2961 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 27 */
2962 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 28 */
2963 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 29 */
2964 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 30 */
2965 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 31 */
2966 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 32 */
2967 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
2968 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 34 */
2969 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 35 */
2970 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 36 */
2971 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 37 */
2972 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 38 */
2973 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 39 */
2974 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 40 */
2975 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 41 */
2976 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 42 */
2977 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 43 */
2978 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 44 */
2979 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 45 */
2980 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
2981 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
2982 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
2983 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
2984 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
2985 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
2986 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 52 */
2987 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 53 */
2988 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 54 */
2989 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 55 */
2990 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 56 */
2991 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 57 */
2992 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 58 */
2993 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 59 */
2994 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 60 */
2995 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 61 */
2996 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 62 */
2997 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 63 */
2998 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 64 */
2999 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3000 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 66 */
3001 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 67 */
3002 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 68 */
3003 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 69 */
3004 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 70 */
3005 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 71 */
3006 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 72 */
3007 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 73 */
3008 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 74 */
3009 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 75 */
3010 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 76 */
3011 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 77 */
3012 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 78 */
3013 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 79 */
3014 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 80 */
3015 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 81 */
3016 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 82 */
3017 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 83 */
3018 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 84 */
3019 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 85 */
3020 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 86 */
3021 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 87 */
3022 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 88 */
3023 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 89 */
3024 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 90 */
3025 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 91 */
3026 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 92 */
3027 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 93 */
3028 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
3029 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
3030 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
3031 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3032 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
3033 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
3034 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =100 */
3035 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =101 */
3036 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =102 */
3037 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =103 */
3038 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =104 */
3039 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =105 */
3040 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =106 */
3041 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =107 */
3042 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =108 */
3043 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =109 */
3044 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =110 */
3045 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =111 */
3046 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =112 */
3047 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =113 */
3048 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =114 */
3049 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =115 */
3050 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =116 */
3051 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =117 */
3052 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =118 */
3053 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =119 */
3054 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =120 */
3055 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =121 */
3056 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =122 */
3057 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =123 */
3058 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =124 */
3059 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =125 */
3060 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =126 */
3061 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =127 */
3062 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =128 */
3063 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3064 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =130 */
3065 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =131 */
3066 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =132 */
3067 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =133 */
3068 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =134 */
3069 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =135 */
3070 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =136 */
3071 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =137 */
3072 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =138 */
3073 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =139 */
3074 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =140 */
3075 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =141 */
3076 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
3077 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
3078 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
3079 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
3080 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
3081 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
3082 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =148 */
3083 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =149 */
3084 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =150 */
3085 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =151 */
3086 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =152 */
3087 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =153 */
3088 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =154 */
3089 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =155 */
3090 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =156 */
3091 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =157 */
3092 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =158 */
3093 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =159 */
3094 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =160 */
3095 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3096 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =162 */
3097 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =163 */
3098 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =164 */
3099 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =165 */
3100 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =166 */
3101 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =167 */
3102 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =168 */
3103 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =169 */
3104 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =170 */
3105 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =171 */
3106 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =172 */
3107 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =173 */
3108 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =174 */
3109 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =175 */
3110 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =176 */
3111 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =177 */
3112 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =178 */
3113 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =179 */
3114 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =180 */
3115 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =181 */
3116 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =182 */
3117 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =183 */
3118 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =184 */
3119 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =185 */
3120 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =186 */
3121 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =187 */
3122 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =188 */
3123 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =189 */
3124 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
3125 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
3126 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
3127 (PID.TID 0000.0001) ;
3128 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3129 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3130 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
3131 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
3132 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 4 */
3133 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
3134 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
3135 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 7 */
3136 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
3137 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
3138 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 10 */
3139 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
3140 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
3141 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
3142 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
3143 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
3144 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
3145 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
3146 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
3147 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
3148 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
3149 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
3150 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
3151 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
3152 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 24 */
3153 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
3154 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
3155 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 27 */
3156 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
3157 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
3158 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 30 */
3159 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
3160 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
3161 (PID.TID 0000.0001) ;
3162 (PID.TID 0000.0001) rA = /* rA(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3163 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
3164 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
3165 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
3166 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 4 */
3167 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 5 */
3168 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 6 */
3169 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 7 */
3170 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 8 */
3171 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 9 */
3172 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 10 */
3173 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 11 */
3174 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 12 */
3175 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 13 */
3176 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 14 */
3177 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 15 */
3178 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 16 */
3179 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 17 */
3180 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 18 */
3181 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 19 */
3182 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 20 */
3183 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 21 */
3184 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 22 */
3185 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 23 */
3186 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 24 */
3187 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 25 */
3188 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 26 */
3189 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 27 */
3190 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 28 */
3191 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 29 */
3192 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 30 */
3193 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 31 */
3194 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 32 */
3195 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 33 */
3196 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 34 */
3197 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 35 */
3198 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 36 */
3199 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 37 */
3200 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 38 */
3201 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 39 */
3202 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 40 */
3203 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 41 */
3204 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 42 */
3205 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 43 */
3206 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 44 */
3207 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 45 */
3208 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 46 */
3209 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 47 */
3210 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 48 */
3211 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 49 */
3212 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
3213 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 51 */
3214 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 52 */
3215 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 53 */
3216 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 54 */
3217 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 55 */
3218 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 56 */
3219 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 57 */
3220 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 58 */
3221 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 59 */
3222 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 60 */
3223 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 61 */
3224 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 62 */
3225 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 63 */
3226 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 64 */
3227 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 65 */
3228 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 66 */
3229 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 67 */
3230 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 68 */
3231 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 69 */
3232 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 70 */
3233 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 71 */
3234 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 72 */
3235 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 73 */
3236 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 74 */
3237 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 75 */
3238 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 76 */
3239 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 77 */
3240 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 78 */
3241 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 79 */
3242 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 80 */
3243 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 81 */
3244 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 82 */
3245 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 83 */
3246 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 84 */
3247 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 85 */
3248 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 86 */
3249 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 87 */
3250 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 88 */
3251 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 89 */
3252 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 90 */
3253 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 91 */
3254 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 92 */
3255 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 93 */
3256 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
3257 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
3258 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
3259 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
3260 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
3261 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
3262 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =100 */
3263 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =101 */
3264 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =102 */
3265 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =103 */
3266 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =104 */
3267 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =105 */
3268 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =106 */
3269 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =107 */
3270 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =108 */
3271 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =109 */
3272 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =110 */
3273 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =111 */
3274 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =112 */
3275 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =113 */
3276 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =114 */
3277 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =115 */
3278 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =116 */
3279 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =117 */
3280 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =118 */
3281 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =119 */
3282 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =120 */
3283 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =121 */
3284 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =122 */
3285 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =123 */
3286 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =124 */
3287 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =125 */
3288 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =126 */
3289 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =127 */
3290 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =128 */
3291 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =129 */
3292 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =130 */
3293 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =131 */
3294 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =132 */
3295 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =133 */
3296 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =134 */
3297 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =135 */
3298 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =136 */
3299 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =137 */
3300 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =138 */
3301 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =139 */
3302 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =140 */
3303 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =141 */
3304 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =142 */
3305 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =143 */
3306 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =144 */
3307 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =145 */
3308 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
3309 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =147 */
3310 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =148 */
3311 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =149 */
3312 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =150 */
3313 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =151 */
3314 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =152 */
3315 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =153 */
3316 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =154 */
3317 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =155 */
3318 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =156 */
3319 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =157 */
3320 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =158 */
3321 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =159 */
3322 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =160 */
3323 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =161 */
3324 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =162 */
3325 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =163 */
3326 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =164 */
3327 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =165 */
3328 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =166 */
3329 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =167 */
3330 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =168 */
3331 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =169 */
3332 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =170 */
3333 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =171 */
3334 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =172 */
3335 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =173 */
3336 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =174 */
3337 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =175 */
3338 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =176 */
3339 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =177 */
3340 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =178 */
3341 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =179 */
3342 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =180 */
3343 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =181 */
3344 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =182 */
3345 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =183 */
3346 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =184 */
3347 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =185 */
3348 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =186 */
3349 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =187 */
3350 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =188 */
3351 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =189 */
3352 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
3353 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
3354 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
3355 (PID.TID 0000.0001) ;
3356 (PID.TID 0000.0001) rA = /* rA(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3357 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
3358 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
3359 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
3360 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
3361 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
3362 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 6 */
3363 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
3364 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
3365 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
3366 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
3367 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 11 */
3368 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 12 */
3369 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
3370 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 14 */
3371 (PID.TID 0000.0001) 9.008620045350865E+10, /* J = 15 */
3372 (PID.TID 0000.0001) 9.076111290418457E+10, /* J = 16 */
3373 (PID.TID 0000.0001) 9.076111290422060E+10, /* J = 17 */
3374 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
3375 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 19 */
3376 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
3377 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 21 */
3378 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 22 */
3379 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
3380 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
3381 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
3382 (PID.TID 0000.0001) 6.203683527772523E+10, /* J = 26 */
3383 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 27 */
3384 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
3385 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
3386 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
3387 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
3388 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
3389 (PID.TID 0000.0001) ;
3390 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3391 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3392 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
3393 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
3394 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 4 */
3395 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 5 */
3396 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 6 */
3397 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 7 */
3398 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 8 */
3399 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 9 */
3400 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 10 */
3401 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 11 */
3402 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 12 */
3403 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 13 */
3404 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 14 */
3405 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 15 */
3406 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 16 */
3407 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 17 */
3408 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 18 */
3409 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 19 */
3410 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 20 */
3411 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 21 */
3412 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 22 */
3413 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 23 */
3414 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 24 */
3415 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 25 */
3416 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 26 */
3417 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 27 */
3418 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 28 */
3419 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 29 */
3420 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 30 */
3421 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 31 */
3422 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 32 */
3423 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 33 */
3424 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 34 */
3425 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 35 */
3426 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 36 */
3427 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 37 */
3428 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 38 */
3429 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 39 */
3430 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 40 */
3431 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 41 */
3432 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 42 */
3433 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 43 */
3434 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 44 */
3435 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 45 */
3436 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
3437 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 47 */
3438 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
3439 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
3440 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 50 */
3441 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
3442 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 52 */
3443 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 53 */
3444 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 54 */
3445 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 55 */
3446 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 56 */
3447 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 57 */
3448 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 58 */
3449 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 59 */
3450 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 60 */
3451 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 61 */
3452 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 62 */
3453 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 63 */
3454 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 64 */
3455 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 65 */
3456 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 66 */
3457 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 67 */
3458 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 68 */
3459 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 69 */
3460 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 70 */
3461 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 71 */
3462 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 72 */
3463 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 73 */
3464 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 74 */
3465 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 75 */
3466 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 76 */
3467 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 77 */
3468 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 78 */
3469 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 79 */
3470 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 80 */
3471 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 81 */
3472 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 82 */
3473 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 83 */
3474 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 84 */
3475 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 85 */
3476 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 86 */
3477 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 87 */
3478 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 88 */
3479 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 89 */
3480 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 90 */
3481 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 91 */
3482 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 92 */
3483 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 93 */
3484 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
3485 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
3486 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
3487 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
3488 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
3489 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
3490 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =100 */
3491 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =101 */
3492 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =102 */
3493 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =103 */
3494 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =104 */
3495 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =105 */
3496 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =106 */
3497 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =107 */
3498 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =108 */
3499 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =109 */
3500 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =110 */
3501 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =111 */
3502 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =112 */
3503 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =113 */
3504 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =114 */
3505 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =115 */
3506 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =116 */
3507 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =117 */
3508 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =118 */
3509 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =119 */
3510 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =120 */
3511 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =121 */
3512 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =122 */
3513 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =123 */
3514 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =124 */
3515 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =125 */
3516 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =126 */
3517 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =127 */
3518 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =128 */
3519 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =129 */
3520 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =130 */
3521 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =131 */
3522 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =132 */
3523 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =133 */
3524 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =134 */
3525 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =135 */
3526 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =136 */
3527 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =137 */
3528 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =138 */
3529 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =139 */
3530 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =140 */
3531 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =141 */
3532 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
3533 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =143 */
3534 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
3535 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
3536 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =146 */
3537 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
3538 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =148 */
3539 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =149 */
3540 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =150 */
3541 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =151 */
3542 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =152 */
3543 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =153 */
3544 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =154 */
3545 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =155 */
3546 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =156 */
3547 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =157 */
3548 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =158 */
3549 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =159 */
3550 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =160 */
3551 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =161 */
3552 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =162 */
3553 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =163 */
3554 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =164 */
3555 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =165 */
3556 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =166 */
3557 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =167 */
3558 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =168 */
3559 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =169 */
3560 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =170 */
3561 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =171 */
3562 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =172 */
3563 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =173 */
3564 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =174 */
3565 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =175 */
3566 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =176 */
3567 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =177 */
3568 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =178 */
3569 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =179 */
3570 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =180 */
3571 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =181 */
3572 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =182 */
3573 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =183 */
3574 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =184 */
3575 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =185 */
3576 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =186 */
3577 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =187 */
3578 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =188 */
3579 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =189 */
3580 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
3581 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
3582 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
3583 (PID.TID 0000.0001) ;
3584 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3585 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3586 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
3587 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
3588 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
3589 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 5 */
3590 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 6 */
3591 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 7 */
3592 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
3593 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 9 */
3594 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
3595 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 11 */
3596 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
3597 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 13 */
3598 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 14 */
3599 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
3600 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* J = 16: 17 */
3601 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
3602 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 19 */
3603 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 20 */
3604 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
3605 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 22 */
3606 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
3607 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 24 */
3608 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
3609 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 26 */
3610 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 27 */
3611 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 28 */
3612 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
3613 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
3614 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
3615 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
3616 (PID.TID 0000.0001) ;
3617 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3618 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3619 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
3620 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
3621 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 4 */
3622 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 5 */
3623 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 6 */
3624 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 7 */
3625 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 8 */
3626 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 9 */
3627 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 10 */
3628 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 11 */
3629 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 12 */
3630 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 13 */
3631 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 14 */
3632 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 15 */
3633 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 16: 17 */
3634 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 18 */
3635 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 19 */
3636 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 20 */
3637 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 21 */
3638 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 22 */
3639 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 23 */
3640 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 24 */
3641 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 25 */
3642 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 26 */
3643 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 27 */
3644 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 28 */
3645 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 29 */
3646 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 30 */
3647 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 31 */
3648 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 32: 33 */
3649 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 34 */
3650 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 35 */
3651 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 36 */
3652 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 37 */
3653 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 38 */
3654 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 39 */
3655 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 40 */
3656 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 41 */
3657 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 42 */
3658 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 43 */
3659 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 44 */
3660 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 45 */
3661 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 46 */
3662 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
3663 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 48: 49 */
3664 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
3665 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 51 */
3666 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 52 */
3667 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 53 */
3668 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 54 */
3669 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 55 */
3670 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 56 */
3671 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 57 */
3672 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 58 */
3673 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 59 */
3674 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 60 */
3675 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 61 */
3676 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 62 */
3677 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 63 */
3678 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 64: 65 */
3679 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 66 */
3680 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 67 */
3681 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 68 */
3682 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 69 */
3683 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 70 */
3684 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 71 */
3685 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 72 */
3686 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 73 */
3687 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 74 */
3688 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 75 */
3689 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 76 */
3690 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 77 */
3691 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 78 */
3692 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 79 */
3693 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 80: 81 */
3694 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 82 */
3695 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 83 */
3696 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 84 */
3697 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 85 */
3698 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 86 */
3699 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 87 */
3700 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 88 */
3701 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 89 */
3702 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 90 */
3703 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 91 */
3704 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 92 */
3705 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 93 */
3706 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
3707 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
3708 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 96: 97 */
3709 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
3710 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
3711 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =100 */
3712 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =101 */
3713 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =102 */
3714 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =103 */
3715 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =104 */
3716 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =105 */
3717 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =106 */
3718 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =107 */
3719 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =108 */
3720 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =109 */
3721 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =110 */
3722 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =111 */
3723 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =112:113 */
3724 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =114 */
3725 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =115 */
3726 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =116 */
3727 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =117 */
3728 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =118 */
3729 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =119 */
3730 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =120 */
3731 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =121 */
3732 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =122 */
3733 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =123 */
3734 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =124 */
3735 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =125 */
3736 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =126 */
3737 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =127 */
3738 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =128:129 */
3739 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =130 */
3740 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =131 */
3741 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =132 */
3742 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =133 */
3743 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =134 */
3744 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =135 */
3745 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =136 */
3746 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =137 */
3747 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =138 */
3748 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =139 */
3749 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =140 */
3750 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =141 */
3751 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =142 */
3752 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
3753 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =144:145 */
3754 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
3755 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =147 */
3756 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =148 */
3757 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =149 */
3758 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =150 */
3759 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =151 */
3760 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =152 */
3761 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =153 */
3762 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =154 */
3763 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =155 */
3764 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =156 */
3765 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =157 */
3766 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =158 */
3767 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =159 */
3768 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =160:161 */
3769 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =162 */
3770 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =163 */
3771 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =164 */
3772 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =165 */
3773 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =166 */
3774 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =167 */
3775 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =168 */
3776 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =169 */
3777 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =170 */
3778 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =171 */
3779 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =172 */
3780 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =173 */
3781 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =174 */
3782 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =175 */
3783 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =176:177 */
3784 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =178 */
3785 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =179 */
3786 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =180 */
3787 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =181 */
3788 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =182 */
3789 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =183 */
3790 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =184 */
3791 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =185 */
3792 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =186 */
3793 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =187 */
3794 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =188 */
3795 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =189 */
3796 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
3797 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
3798 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
3799 (PID.TID 0000.0001) ;
3800 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3801 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3802 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
3803 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
3804 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
3805 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
3806 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
3807 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 7 */
3808 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 8 */
3809 (PID.TID 0000.0001) 7.014205907741882E+10, /* J = 9 */
3810 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
3811 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
3812 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
3813 (PID.TID 0000.0001) 8.549360686473492E+10, /* J = 13 */
3814 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
3815 (PID.TID 0000.0001) 8.948571540392021E+10, /* J = 15 */
3816 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
3817 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
3818 (PID.TID 0000.0001) 9.049530583087070E+10, /* J = 18 */
3819 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
3820 (PID.TID 0000.0001) 8.781353403174185E+10, /* J = 20 */
3821 (PID.TID 0000.0001) 8.549360686467184E+10, /* J = 21 */
3822 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
3823 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
3824 (PID.TID 0000.0001) 7.484854821844795E+10, /* J = 24 */
3825 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
3826 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 26 */
3827 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 27 */
3828 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
3829 (PID.TID 0000.0001) 4.571243814190767E+10, /* J = 29 */
3830 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
3831 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
3832 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
3833 (PID.TID 0000.0001) ;
3834 (PID.TID 0000.0001)
3835 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3836 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3837 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3838 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3839 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3840 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3841 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3842 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3843 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3844 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3845 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000072000
3846 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
3847 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
3848 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiQnet_cs32.bin
3849 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiEmPR_cs32.bin
3850 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
3851 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
3852 (PID.TID 0000.0001) // =======================================================
3853 (PID.TID 0000.0001) // Model current state
3854 (PID.TID 0000.0001) // =======================================================
3855 (PID.TID 0000.0001)
3856 (PID.TID 0000.0001) // =======================================================
3857 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
3858 (PID.TID 0000.0001) // =======================================================
3859 (PID.TID 0000.0001) %MON time_tsnumber = 72000
3860 (PID.TID 0000.0001) %MON time_secondsf = 6.2208000000000E+09
3861 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.2249308874653E-01
3862 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6181619580030E+00
3863 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4427566214562E-14
3864 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9907976973986E-01
3865 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1252664732722E-02
3866 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8639442347386E-01
3867 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8803502100767E-01
3868 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8914430325890E-04
3869 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2021379389426E-02
3870 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5675476577319E-03
3871 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7346247050018E-01
3872 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2519444280963E-01
3873 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0398186384005E-04
3874 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2638380334010E-02
3875 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5945023955724E-03
3876 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0315548206230E-04
3877 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0412092606640E-04
3878 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.3594270097552E-10
3879 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8382293649569E-06
3880 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3946754649746E-07
3881 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0925958904704E+01
3882 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.0175293673864E+00
3883 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9091304559860E+00
3884 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5711443147581E+00
3885 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7682322220499E-02
3886 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1386265990462E+01
3887 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8383410676806E+01
3888 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772068623474E+01
3889 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145226117181E-01
3890 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8670410580355E-02
3891 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1692195603793E-02
3892 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.5609847114589E-02
3893 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6551124574102E-02
3894 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2151483704136E-01
3895 (PID.TID 0000.0001) %MON pe_b_mean = 4.7811655460464E-04
3896 (PID.TID 0000.0001) %MON ke_max = 4.0700637549387E-02
3897 (PID.TID 0000.0001) %MON ke_mean = 1.4067882101803E-04
3898 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
3899 (PID.TID 0000.0001) %MON vort_r_min = -1.1843904755479E-06
3900 (PID.TID 0000.0001) %MON vort_r_max = 1.2148454936551E-06
3901 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
3902 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053947910691E-05
3903 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773639925E-05
3904 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777078256013E-04
3905 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.6885453665042E-08
3906 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4400775280522E-08
3907 (PID.TID 0000.0001) // =======================================================
3908 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
3909 (PID.TID 0000.0001) // =======================================================
3910 S/R EXTERNAL_FIELDS_LOAD: Reading new data: 12 1 72000 6.220800000000E+09
3911 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
3912 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
3913 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
3914 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
3915 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiQnet_cs32.bin
3916 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiQnet_cs32.bin
3917 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiEmPR_cs32.bin
3918 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiEmPR_cs32.bin
3919 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
3920 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
3921 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
3922 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
3923 cg2d: Sum(rhs),rhsMax = -9.66338120633736E-12 4.28049811553101E+00
3924 (PID.TID 0000.0001) cg2d_init_res = 1.49488312919746E-01
3925 (PID.TID 0000.0001) cg2d_iters = 62
3926 (PID.TID 0000.0001) cg2d_res = 4.72177254784851E-07
3927 (PID.TID 0000.0001) // =======================================================
3928 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
3929 (PID.TID 0000.0001) // =======================================================
3930 (PID.TID 0000.0001) %MON time_tsnumber = 72001
3931 (PID.TID 0000.0001) %MON time_secondsf = 6.2208864000000E+09
3932 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.2074069935480E-01
3933 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6177434055553E+00
3934 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4262679743539E-14
3935 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9896523301313E-01
3936 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1252089921907E-02
3937 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8678724393268E-01
3938 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8776620863423E-01
3939 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8905815832028E-04
3940 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2021174048412E-02
3941 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5673963930972E-03
3942 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7373037967178E-01
3943 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2518068582006E-01
3944 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0395158140020E-04
3945 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2641235876446E-02
3946 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5939380725146E-03
3947 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0319095854851E-04
3948 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0436889854636E-04
3949 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.4894379070750E-10
3950 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8359777362128E-06
3951 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3874806195964E-07
3952 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0941374392791E+01
3953 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.0330033726151E+00
3954 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9091878123630E+00
3955 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5711611800290E+00
3956 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7672412846909E-02
3957 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1386888211404E+01
3958 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8383695190146E+01
3959 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772068989043E+01
3960 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145417320052E-01
3961 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8680582045578E-02
3962 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1615955315669E-02
3963 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.5726624948128E-02
3964 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6631972960021E-02
3965 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2114295890510E-01
3966 (PID.TID 0000.0001) %MON pe_b_mean = 4.7793375200296E-04
3967 (PID.TID 0000.0001) %MON ke_max = 4.0598780468888E-02
3968 (PID.TID 0000.0001) %MON ke_mean = 1.4070998506276E-04
3969 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
3970 (PID.TID 0000.0001) %MON vort_r_min = -1.1880315723982E-06
3971 (PID.TID 0000.0001) %MON vort_r_max = 1.2157035676301E-06
3972 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
3973 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053947713390E-05
3974 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773632851E-05
3975 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777077744462E-04
3976 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.6784940601675E-08
3977 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.3951912652671E-08
3978 (PID.TID 0000.0001) // =======================================================
3979 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
3980 (PID.TID 0000.0001) // =======================================================
3981 cg2d: Sum(rhs),rhsMax = -9.69180291576777E-12 4.27718242610665E+00
3982 (PID.TID 0000.0001) cg2d_init_res = 1.48205094654374E-01
3983 (PID.TID 0000.0001) cg2d_iters = 61
3984 (PID.TID 0000.0001) cg2d_res = 5.64719287097686E-07
3985 (PID.TID 0000.0001) // =======================================================
3986 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
3987 (PID.TID 0000.0001) // =======================================================
3988 (PID.TID 0000.0001) %MON time_tsnumber = 72002
3989 (PID.TID 0000.0001) %MON time_secondsf = 6.2209728000000E+09
3990 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1895872176699E-01
3991 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6171655144371E+00
3992 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4207717586531E-14
3993 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9885568671547E-01
3994 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1250433059413E-02
3995 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8712220523968E-01
3996 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8748357916241E-01
3997 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8887504376031E-04
3998 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2020742756300E-02
3999 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5673099952904E-03
4000 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7397171001562E-01
4001 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2515839227052E-01
4002 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0388997932483E-04
4003 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2644149346944E-02
4004 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5932679434047E-03
4005 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0331069687110E-04
4006 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0464303806279E-04
4007 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.4042801786002E-10
4008 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8339453802564E-06
4009 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3834747736970E-07
4010 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0956247740807E+01
4011 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.0488625347942E+00
4012 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9092454901712E+00
4013 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5711837312830E+00
4014 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7655131331820E-02
4015 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1387502387208E+01
4016 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8383986586267E+01
4017 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772069369650E+01
4018 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145527497052E-01
4019 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8677720614826E-02
4020 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1535796236350E-02
4021 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.5831817445095E-02
4022 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6721352787264E-02
4023 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2068778212500E-01
4024 (PID.TID 0000.0001) %MON pe_b_mean = 4.7775894691438E-04
4025 (PID.TID 0000.0001) %MON ke_max = 4.0493518552749E-02
4026 (PID.TID 0000.0001) %MON ke_mean = 1.4073928802304E-04
4027 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4028 (PID.TID 0000.0001) %MON vort_r_min = -1.1920039300507E-06
4029 (PID.TID 0000.0001) %MON vort_r_max = 1.2168561171602E-06
4030 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4031 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053947528014E-05
4032 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773637998E-05
4033 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777077233227E-04
4034 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.6600178291940E-08
4035 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.3994564413787E-08
4036 (PID.TID 0000.0001) // =======================================================
4037 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4038 (PID.TID 0000.0001) // =======================================================
4039 cg2d: Sum(rhs),rhsMax = -9.80548975348938E-12 4.27443734512180E+00
4040 (PID.TID 0000.0001) cg2d_init_res = 1.48309541266531E-01
4041 (PID.TID 0000.0001) cg2d_iters = 61
4042 (PID.TID 0000.0001) cg2d_res = 5.71612237973105E-07
4043 (PID.TID 0000.0001) // =======================================================
4044 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4045 (PID.TID 0000.0001) // =======================================================
4046 (PID.TID 0000.0001) %MON time_tsnumber = 72003
4047 (PID.TID 0000.0001) %MON time_secondsf = 6.2210592000000E+09
4048 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1727471815714E-01
4049 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6166098398602E+00
4050 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4400085136058E-14
4051 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9875183274621E-01
4052 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1248548143006E-02
4053 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8739605731013E-01
4054 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8718707241934E-01
4055 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8861855746239E-04
4056 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2020120974257E-02
4057 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5672605249604E-03
4058 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7418512553286E-01
4059 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2512783680770E-01
4060 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0379090995037E-04
4061 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2647063858420E-02
4062 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5925994731111E-03
4063 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0349498096569E-04
4064 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0486587381335E-04
4065 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.3546817042488E-10
4066 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8316808229518E-06
4067 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3784746713620E-07
4068 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0970605065706E+01
4069 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.0651017508836E+00
4070 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9093032893780E+00
4071 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5712092990232E+00
4072 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7634431087060E-02
4073 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1388108458306E+01
4074 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8384284639831E+01
4075 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772069766607E+01
4076 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145390854595E-01
4077 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8692047867728E-02
4078 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1451701299672E-02
4079 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.5924842262418E-02
4080 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6794005650842E-02
4081 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2015268361024E-01
4082 (PID.TID 0000.0001) %MON pe_b_mean = 4.7759325470584E-04
4083 (PID.TID 0000.0001) %MON ke_max = 4.0384893196298E-02
4084 (PID.TID 0000.0001) %MON ke_mean = 1.4076646313310E-04
4085 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4086 (PID.TID 0000.0001) %MON vort_r_min = -1.1962822202313E-06
4087 (PID.TID 0000.0001) %MON vort_r_max = 1.2182731781099E-06
4088 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4089 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053947361798E-05
4090 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773634515E-05
4091 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777076780190E-04
4092 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.6742431825326E-08
4093 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4053524647618E-08
4094 (PID.TID 0000.0001) // =======================================================
4095 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4096 (PID.TID 0000.0001) // =======================================================
4097 cg2d: Sum(rhs),rhsMax = -9.60653778747655E-12 4.27185687495792E+00
4098 (PID.TID 0000.0001) cg2d_init_res = 1.74860953192859E-01
4099 (PID.TID 0000.0001) cg2d_iters = 62
4100 (PID.TID 0000.0001) cg2d_res = 5.00264070858908E-07
4101 (PID.TID 0000.0001) // =======================================================
4102 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4103 (PID.TID 0000.0001) // =======================================================
4104 (PID.TID 0000.0001) %MON time_tsnumber = 72004
4105 (PID.TID 0000.0001) %MON time_secondsf = 6.2211456000000E+09
4106 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1566664526710E-01
4107 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6160863300502E+00
4108 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4042831115507E-14
4109 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9865142687298E-01
4110 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1246919989803E-02
4111 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8760566802704E-01
4112 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8687660696946E-01
4113 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8831807878974E-04
4114 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2019361714301E-02
4115 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5672091889250E-03
4116 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7436971808771E-01
4117 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2508931364984E-01
4118 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0364635316110E-04
4119 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2649915764380E-02
4120 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5919809714418E-03
4121 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0373917668082E-04
4122 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0503507417804E-04
4123 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.2621557756909E-10
4124 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8292403673205E-06
4125 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3728177405056E-07
4126 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0984465449382E+01
4127 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.0816965449073E+00
4128 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9093612252640E+00
4129 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5712447782433E+00
4130 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7711685748056E-02
4131 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1388706397961E+01
4132 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8384589169229E+01
4133 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772070181575E+01
4134 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145434448975E-01
4135 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8718846159205E-02
4136 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1363647408966E-02
4137 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6005303556495E-02
4138 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6849171354650E-02
4139 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1953833969845E-01
4140 (PID.TID 0000.0001) %MON pe_b_mean = 4.7743309103038E-04
4141 (PID.TID 0000.0001) %MON ke_max = 4.0272963422708E-02
4142 (PID.TID 0000.0001) %MON ke_mean = 1.4079135917150E-04
4143 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4144 (PID.TID 0000.0001) %MON vort_r_min = -1.2008389812804E-06
4145 (PID.TID 0000.0001) %MON vort_r_max = 1.2199250089169E-06
4146 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4147 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053947216148E-05
4148 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773626040E-05
4149 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777076367160E-04
4150 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.6891348152926E-08
4151 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4108626893507E-08
4152 (PID.TID 0000.0001) // =======================================================
4153 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4154 (PID.TID 0000.0001) // =======================================================
4155 cg2d: Sum(rhs),rhsMax = -9.57811607804615E-12 4.26946648112991E+00
4156 (PID.TID 0000.0001) cg2d_init_res = 1.51707652931092E-01
4157 (PID.TID 0000.0001) cg2d_iters = 62
4158 (PID.TID 0000.0001) cg2d_res = 4.75379894139372E-07
4159 (PID.TID 0000.0001) // =======================================================
4160 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4161 (PID.TID 0000.0001) // =======================================================
4162 (PID.TID 0000.0001) %MON time_tsnumber = 72005
4163 (PID.TID 0000.0001) %MON time_secondsf = 6.2212320000000E+09
4164 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1410269755215E-01
4165 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6155862544900E+00
4166 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4729858078105E-14
4167 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9855136016162E-01
4168 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1246044875754E-02
4169 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8774880750393E-01
4170 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8655210947063E-01
4171 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8799357633989E-04
4172 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2018525676161E-02
4173 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5672002857815E-03
4174 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7452426843252E-01
4175 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2504309058885E-01
4176 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0344356135892E-04
4177 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2652634216333E-02
4178 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5913617361826E-03
4179 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0403839814341E-04
4180 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0514922745894E-04
4181 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.1385399074351E-10
4182 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8266841165518E-06
4183 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3663117599095E-07
4184 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0997846674252E+01
4185 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.0986216649120E+00
4186 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9094192253556E+00
4187 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5712879127858E+00
4188 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7703310542653E-02
4189 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1389296479390E+01
4190 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8384900011016E+01
4191 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772070612607E+01
4192 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145547313005E-01
4193 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8719321537730E-02
4194 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1271613763006E-02
4195 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6072669874460E-02
4196 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6886389631896E-02
4197 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1884618518348E-01
4198 (PID.TID 0000.0001) %MON pe_b_mean = 4.7727349509767E-04
4199 (PID.TID 0000.0001) %MON ke_max = 4.0157792075135E-02
4200 (PID.TID 0000.0001) %MON ke_mean = 1.4081381852480E-04
4201 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4202 (PID.TID 0000.0001) %MON vort_r_min = -1.2056443437332E-06
4203 (PID.TID 0000.0001) %MON vort_r_max = 1.2217837158566E-06
4204 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4205 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053947089418E-05
4206 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773614181E-05
4207 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777075984019E-04
4208 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.6999546719220E-08
4209 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4148849445933E-08
4210 (PID.TID 0000.0001) // =======================================================
4211 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4212 (PID.TID 0000.0001) // =======================================================
4213 cg2d: Sum(rhs),rhsMax = -9.89075488178059E-12 4.26728140649013E+00
4214 (PID.TID 0000.0001) cg2d_init_res = 1.47645780972886E-01
4215 (PID.TID 0000.0001) cg2d_iters = 62
4216 (PID.TID 0000.0001) cg2d_res = 4.76399187721462E-07
4217 (PID.TID 0000.0001) // =======================================================
4218 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4219 (PID.TID 0000.0001) // =======================================================
4220 (PID.TID 0000.0001) %MON time_tsnumber = 72006
4221 (PID.TID 0000.0001) %MON time_secondsf = 6.2213184000000E+09
4222 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1257896979585E-01
4223 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6151030464975E+00
4224 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4180236508027E-14
4225 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9845085992905E-01
4226 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1245871136332E-02
4227 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8782425621489E-01
4228 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8621350266828E-01
4229 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8764634386710E-04
4230 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2017676133470E-02
4231 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5670837411077E-03
4232 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7464794411065E-01
4233 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2498944510790E-01
4234 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0317913725334E-04
4235 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2655146952380E-02
4236 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5907762120287E-03
4237 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0438677674565E-04
4238 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0520796991118E-04
4239 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 1.0334030410404E-10
4240 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8240663051028E-06
4241 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3598349986005E-07
4242 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1010765689035E+01
4243 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.1158504173634E+00
4244 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9094772955623E+00
4245 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5713369694756E+00
4246 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7706536472367E-02
4247 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1389879299858E+01
4248 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8385217019039E+01
4249 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772071060093E+01
4250 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145602618204E-01
4251 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8721073638385E-02
4252 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1175578450933E-02
4253 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6126578360190E-02
4254 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6905541888021E-02
4255 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1807746865736E-01
4256 (PID.TID 0000.0001) %MON pe_b_mean = 4.7711323459689E-04
4257 (PID.TID 0000.0001) %MON ke_max = 4.0039438322768E-02
4258 (PID.TID 0000.0001) %MON ke_mean = 1.4083368970804E-04
4259 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4260 (PID.TID 0000.0001) %MON vort_r_min = -1.2106669763976E-06
4261 (PID.TID 0000.0001) %MON vort_r_max = 1.2238134611910E-06
4262 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4263 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946978930E-05
4264 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773599747E-05
4265 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777075625772E-04
4266 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7136295435455E-08
4267 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4177963863949E-08
4268 (PID.TID 0000.0001) // =======================================================
4269 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4270 (PID.TID 0000.0001) // =======================================================
4271 cg2d: Sum(rhs),rhsMax = -9.20863385545090E-12 4.26529428757795E+00
4272 (PID.TID 0000.0001) cg2d_init_res = 1.47496229593407E-01
4273 (PID.TID 0000.0001) cg2d_iters = 62
4274 (PID.TID 0000.0001) cg2d_res = 4.81222999012158E-07
4275 (PID.TID 0000.0001) // =======================================================
4276 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4277 (PID.TID 0000.0001) // =======================================================
4278 (PID.TID 0000.0001) %MON time_tsnumber = 72007
4279 (PID.TID 0000.0001) %MON time_secondsf = 6.2214048000000E+09
4280 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1111192616004E-01
4281 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6146314193532E+00
4282 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.3850463565980E-14
4283 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9835068013916E-01
4284 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1246153222112E-02
4285 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8783173164451E-01
4286 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8586067945559E-01
4287 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8727009379638E-04
4288 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2016874638290E-02
4289 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5669233643247E-03
4290 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7473987248926E-01
4291 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2492870335985E-01
4292 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0285959864705E-04
4293 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2657384693324E-02
4294 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5902258805421E-03
4295 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0477739207449E-04
4296 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0521143384640E-04
4297 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 9.6791754038131E-11
4298 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8214353369685E-06
4299 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3543886518936E-07
4300 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1023238565112E+01
4301 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.1333562827375E+00
4302 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9095354559607E+00
4303 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5713914372246E+00
4304 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7771293288825E-02
4305 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1390455844270E+01
4306 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8385540064962E+01
4307 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772071524658E+01
4308 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145557838003E-01
4309 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8739144076836E-02
4310 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.1075511095220E-02
4311 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6166648645316E-02
4312 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6906671261619E-02
4313 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1723376298635E-01
4314 (PID.TID 0000.0001) %MON pe_b_mean = 4.7695351186537E-04
4315 (PID.TID 0000.0001) %MON ke_max = 3.9917948770025E-02
4316 (PID.TID 0000.0001) %MON ke_mean = 1.4085083678252E-04
4317 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4318 (PID.TID 0000.0001) %MON vort_r_min = -1.2158750553322E-06
4319 (PID.TID 0000.0001) %MON vort_r_max = 1.2259843225970E-06
4320 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4321 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946880955E-05
4322 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773583416E-05
4323 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777075291804E-04
4324 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7325180101777E-08
4325 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4202790356120E-08
4326 (PID.TID 0000.0001) // =======================================================
4327 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4328 (PID.TID 0000.0001) // =======================================================
4329 cg2d: Sum(rhs),rhsMax = -9.66338120633736E-12 4.26349260347351E+00
4330 (PID.TID 0000.0001) cg2d_init_res = 1.48359566321385E-01
4331 (PID.TID 0000.0001) cg2d_iters = 62
4332 (PID.TID 0000.0001) cg2d_res = 4.83509712398149E-07
4333 (PID.TID 0000.0001) // =======================================================
4334 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4335 (PID.TID 0000.0001) // =======================================================
4336 (PID.TID 0000.0001) %MON time_tsnumber = 72008
4337 (PID.TID 0000.0001) %MON time_secondsf = 6.2214912000000E+09
4338 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0967701044025E-01
4339 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6141668643427E+00
4340 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4455047293066E-14
4341 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9825199755043E-01
4342 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1246806834511E-02
4343 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8777186409164E-01
4344 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8549349543017E-01
4345 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8685708739649E-04
4346 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2016176264265E-02
4347 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5666555744836E-03
4348 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7479933108586E-01
4349 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2486124326183E-01
4350 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0249817451013E-04
4351 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2659286510450E-02
4352 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5897480569498E-03
4353 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0520244778804E-04
4354 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0516002404678E-04
4355 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 9.3423323128328E-11
4356 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8188320687441E-06
4357 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3501412832806E-07
4358 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1035280435649E+01
4359 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.1511127339667E+00
4360 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9095937001319E+00
4361 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5714533114831E+00
4362 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7787457588398E-02
4363 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1391027417006E+01
4364 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8385868953863E+01
4365 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772072006315E+01
4366 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145585284567E-01
4367 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8744068098325E-02
4368 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0971370740615E-02
4369 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6192565809909E-02
4370 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6889909726950E-02
4371 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1631672063940E-01
4372 (PID.TID 0000.0001) %MON pe_b_mean = 4.7679620235585E-04
4373 (PID.TID 0000.0001) %MON ke_max = 3.9793355521884E-02
4374 (PID.TID 0000.0001) %MON ke_mean = 1.4086515165958E-04
4375 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4376 (PID.TID 0000.0001) %MON vort_r_min = -1.2212368122103E-06
4377 (PID.TID 0000.0001) %MON vort_r_max = 1.2282577547686E-06
4378 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4379 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946791388E-05
4380 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773566282E-05
4381 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777074984209E-04
4382 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7547405960147E-08
4383 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4233163941658E-08
4384 (PID.TID 0000.0001) // =======================================================
4385 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4386 (PID.TID 0000.0001) // =======================================================
4387 cg2d: Sum(rhs),rhsMax = -9.89075488178059E-12 4.26186293434255E+00
4388 (PID.TID 0000.0001) cg2d_init_res = 1.47101804030811E-01
4389 (PID.TID 0000.0001) cg2d_iters = 62
4390 (PID.TID 0000.0001) cg2d_res = 4.79974305094775E-07
4391 (PID.TID 0000.0001) // =======================================================
4392 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4393 (PID.TID 0000.0001) // =======================================================
4394 (PID.TID 0000.0001) %MON time_tsnumber = 72009
4395 (PID.TID 0000.0001) %MON time_secondsf = 6.2215776000000E+09
4396 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0826543052102E-01
4397 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6137054566225E+00
4398 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4290160822043E-14
4399 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9815578815967E-01
4400 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1247722894243E-02
4401 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8764619150379E-01
4402 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8511178341554E-01
4403 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8640097284711E-04
4404 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2015626848582E-02
4405 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5662903178634E-03
4406 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7482565597958E-01
4407 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2478746880450E-01
4408 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0211023995718E-04
4409 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2660802220499E-02
4410 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5892991330079E-03
4411 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0565350689336E-04
4412 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0505453497603E-04
4413 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 9.1442153270438E-11
4414 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8162893465379E-06
4415 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3461373148033E-07
4416 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1046905449872E+01
4417 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.1690941172888E+00
4418 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9096520448298E+00
4419 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5715205480743E+00
4420 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7801542493850E-02
4421 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1391595023682E+01
4422 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8386203491242E+01
4423 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772072505222E+01
4424 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145532338218E-01
4425 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8744487793001E-02
4426 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0863109972688E-02
4427 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6204040460212E-02
4428 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6855516309165E-02
4429 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1532813261411E-01
4430 (PID.TID 0000.0001) %MON pe_b_mean = 4.7664286034011E-04
4431 (PID.TID 0000.0001) %MON ke_max = 3.9665680676138E-02
4432 (PID.TID 0000.0001) %MON ke_mean = 1.4087655166031E-04
4433 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4434 (PID.TID 0000.0001) %MON vort_r_min = -1.2267207758784E-06
4435 (PID.TID 0000.0001) %MON vort_r_max = 1.2306037999943E-06
4436 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4437 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946706680E-05
4438 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773549124E-05
4439 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777074705064E-04
4440 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7748248748097E-08
4441 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4270296255471E-08
4442 (PID.TID 0000.0001) // =======================================================
4443 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4444 (PID.TID 0000.0001) // =======================================================
4445 cg2d: Sum(rhs),rhsMax = -9.83391146291979E-12 4.26039119604027E+00
4446 (PID.TID 0000.0001) cg2d_init_res = 1.46717102857619E-01
4447 (PID.TID 0000.0001) cg2d_iters = 62
4448 (PID.TID 0000.0001) cg2d_res = 4.75244422798433E-07
4449 (PID.TID 0000.0001) // =======================================================
4450 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4451 (PID.TID 0000.0001) // =======================================================
4452 (PID.TID 0000.0001) %MON time_tsnumber = 72010
4453 (PID.TID 0000.0001) %MON time_secondsf = 6.2216640000000E+09
4454 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0687654862489E-01
4455 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6132431841164E+00
4456 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4317641900547E-14
4457 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9806230762463E-01
4458 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1248727424406E-02
4459 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8745713918272E-01
4460 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8471537239746E-01
4461 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8589744501433E-04
4462 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2015260903774E-02
4463 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5658993835062E-03
4464 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7481828347479E-01
4465 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2470778037951E-01
4466 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0171124370485E-04
4467 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2661895424890E-02
4468 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5887888862463E-03
4469 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0612164206925E-04
4470 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0489618003024E-04
4471 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 8.8836805985120E-11
4472 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8138305374822E-06
4473 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3439243969296E-07
4474 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1058126752055E+01
4475 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.1872752498754E+00
4476 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9097105502924E+00
4477 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5715944465717E+00
4478 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7815769274904E-02
4479 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1392158840263E+01
4480 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8386543563705E+01
4481 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772073023066E+01
4482 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145483181036E-01
4483 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8744477729675E-02
4484 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0750680288566E-02
4485 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6200826889240E-02
4486 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6803886621180E-02
4487 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1426988955422E-01
4488 (PID.TID 0000.0001) %MON pe_b_mean = 4.7649389129629E-04
4489 (PID.TID 0000.0001) %MON ke_max = 3.9534941510922E-02
4490 (PID.TID 0000.0001) %MON ke_mean = 1.4088499204145E-04
4491 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4492 (PID.TID 0000.0001) %MON vort_r_min = -1.2322959159546E-06
4493 (PID.TID 0000.0001) %MON vort_r_max = 1.2329783241618E-06
4494 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4495 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946624006E-05
4496 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773532078E-05
4497 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777074455380E-04
4498 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7886943223013E-08
4499 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4315226381576E-08
4500 (PID.TID 0000.0001) // =======================================================
4501 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4502 (PID.TID 0000.0001) // =======================================================
4503 cg2d: Sum(rhs),rhsMax = -9.69180291576777E-12 4.25906154107720E+00
4504 (PID.TID 0000.0001) cg2d_init_res = 1.46512539527920E-01
4505 (PID.TID 0000.0001) cg2d_iters = 62
4506 (PID.TID 0000.0001) cg2d_res = 4.73416099651240E-07
4507 (PID.TID 0000.0001) // =======================================================
4508 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4509 (PID.TID 0000.0001) // =======================================================
4510 (PID.TID 0000.0001) %MON time_tsnumber = 72011
4511 (PID.TID 0000.0001) %MON time_secondsf = 6.2217504000000E+09
4512 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0551172639237E-01
4513 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6127756955361E+00
4514 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4345122979050E-14
4515 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9797135790062E-01
4516 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1249663460318E-02
4517 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8720797904383E-01
4518 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8430410290202E-01
4519 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8534642785677E-04
4520 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2015099893916E-02
4521 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5655537841967E-03
4522 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7477681849928E-01
4523 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2462255997397E-01
4524 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0131222718561E-04
4525 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2662544677936E-02
4526 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5884848354400E-03
4527 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0659770590173E-04
4528 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0468706662652E-04
4529 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 8.4818998558772E-11
4530 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8114674404208E-06
4531 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3428905078148E-07
4532 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1068956475418E+01
4533 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.2056320313187E+00
4534 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9097691729192E+00
4535 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5716740772874E+00
4536 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7805470952618E-02
4537 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1392718273984E+01
4538 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8386889069009E+01
4539 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772073559396E+01
4540 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145384857268E-01
4541 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8740322276540E-02
4542 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0634036458416E-02
4543 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6182752890582E-02
4544 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6735707760497E-02
4545 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1314396552676E-01
4546 (PID.TID 0000.0001) %MON pe_b_mean = 4.7634897765723E-04
4547 (PID.TID 0000.0001) %MON ke_max = 3.9401154662126E-02
4548 (PID.TID 0000.0001) %MON ke_mean = 1.4089046019752E-04
4549 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4550 (PID.TID 0000.0001) %MON vort_r_min = -1.2379317896803E-06
4551 (PID.TID 0000.0001) %MON vort_r_max = 1.2353540834699E-06
4552 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4553 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946541694E-05
4554 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773514873E-05
4555 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777074233098E-04
4556 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7948378487097E-08
4557 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4365720249455E-08
4558 (PID.TID 0000.0001) // =======================================================
4559 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4560 (PID.TID 0000.0001) // =======================================================
4561 cg2d: Sum(rhs),rhsMax = -9.63495949690696E-12 4.25785526084399E+00
4562 (PID.TID 0000.0001) cg2d_init_res = 1.47210828983708E-01
4563 (PID.TID 0000.0001) cg2d_iters = 62
4564 (PID.TID 0000.0001) cg2d_res = 4.73472274600938E-07
4565 (PID.TID 0000.0001) // =======================================================
4566 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4567 (PID.TID 0000.0001) // =======================================================
4568 (PID.TID 0000.0001) %MON time_tsnumber = 72012
4569 (PID.TID 0000.0001) %MON time_secondsf = 6.2218368000000E+09
4570 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0418051765233E-01
4571 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6122986990184E+00
4572 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4455047293066E-14
4573 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9788254428282E-01
4574 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1251053305533E-02
4575 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8690277251619E-01
4576 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8387783763052E-01
4577 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8475230143869E-04
4578 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2015150782899E-02
4579 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5651591072782E-03
4580 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7470110465294E-01
4581 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2453216881960E-01
4582 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0091844641205E-04
4583 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2662744541157E-02
4584 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5881987993223E-03
4585 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0707238948077E-04
4586 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0442992802300E-04
4587 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 7.9019952531149E-11
4588 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8092014170462E-06
4589 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3440727986701E-07
4590 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1079405742170E+01
4591 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.2241412292569E+00
4592 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9098278638139E+00
4593 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5717587312720E+00
4594 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7790841098310E-02
4595 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1393272401242E+01
4596 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8387239930605E+01
4597 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772074113313E+01
4598 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3145203910619E-01
4599 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8742622379340E-02
4600 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0513139541726E-02
4601 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6149750291634E-02
4602 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6651870872404E-02
4603 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1291703259654E-01
4604 (PID.TID 0000.0001) %MON pe_b_mean = 4.7620748882597E-04
4605 (PID.TID 0000.0001) %MON ke_max = 3.9264338965979E-02
4606 (PID.TID 0000.0001) %MON ke_mean = 1.4089297203555E-04
4607 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4608 (PID.TID 0000.0001) %MON vort_r_min = -1.2435987191117E-06
4609 (PID.TID 0000.0001) %MON vort_r_max = 1.2376813326937E-06
4610 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4611 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946458944E-05
4612 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773497159E-05
4613 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777074033325E-04
4614 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7929838989744E-08
4615 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4414418513916E-08
4616 (PID.TID 0000.0001) // =======================================================
4617 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4618 (PID.TID 0000.0001) // =======================================================
4619 cg2d: Sum(rhs),rhsMax = -9.54969436861575E-12 4.25675038187209E+00
4620 (PID.TID 0000.0001) cg2d_init_res = 1.48181396481636E-01
4621 (PID.TID 0000.0001) cg2d_iters = 62
4622 (PID.TID 0000.0001) cg2d_res = 4.73269143227379E-07
4623 (PID.TID 0000.0001) // =======================================================
4624 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4625 (PID.TID 0000.0001) // =======================================================
4626 (PID.TID 0000.0001) %MON time_tsnumber = 72013
4627 (PID.TID 0000.0001) %MON time_secondsf = 6.2219232000000E+09
4628 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0288506705103E-01
4629 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6118087383730E+00
4630 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4784820235113E-14
4631 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9779561023082E-01
4632 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1253344955750E-02
4633 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8654630112384E-01
4634 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8343646782185E-01
4635 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8412240987323E-04
4636 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2015408097139E-02
4637 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5647098416065E-03
4638 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7459127696805E-01
4639 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2443695002688E-01
4640 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0052960668206E-04
4641 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2662503184442E-02
4642 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5879685935523E-03
4643 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0753647788326E-04
4644 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0412809833097E-04
4645 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 7.1488281115373E-11
4646 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8070110922930E-06
4647 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3456517878742E-07
4648 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1089484667142E+01
4649 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.2427806089953E+00
4650 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9098866150552E+00
4651 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5718484901808E+00
4652 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7885176390500E-02
4653 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1393820353695E+01
4654 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8387596098461E+01
4655 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772074685307E+01
4656 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3144949294852E-01
4657 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8767104894275E-02
4658 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0387958691781E-02
4659 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6101877951069E-02
4660 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6553463003003E-02
4661 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1276714182431E-01
4662 (PID.TID 0000.0001) %MON pe_b_mean = 4.7606901468171E-04
4663 (PID.TID 0000.0001) %MON ke_max = 3.9124517046041E-02
4664 (PID.TID 0000.0001) %MON ke_mean = 1.4089256589397E-04
4665 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4666 (PID.TID 0000.0001) %MON vort_r_min = -1.2492679919774E-06
4667 (PID.TID 0000.0001) %MON vort_r_max = 1.2399399328449E-06
4668 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4669 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946375641E-05
4670 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773478428E-05
4671 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777073849578E-04
4672 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7840660352804E-08
4673 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4451871241951E-08
4674 (PID.TID 0000.0001) // =======================================================
4675 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4676 (PID.TID 0000.0001) // =======================================================
4677 cg2d: Sum(rhs),rhsMax = -9.80548975348938E-12 4.25572199354887E+00
4678 (PID.TID 0000.0001) cg2d_init_res = 1.48860140010140E-01
4679 (PID.TID 0000.0001) cg2d_iters = 62
4680 (PID.TID 0000.0001) cg2d_res = 4.76106442192832E-07
4681 (PID.TID 0000.0001) // =======================================================
4682 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4683 (PID.TID 0000.0001) // =======================================================
4684 (PID.TID 0000.0001) %MON time_tsnumber = 72014
4685 (PID.TID 0000.0001) %MON time_secondsf = 6.2220096000000E+09
4686 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0162430489291E-01
4687 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6113038132594E+00
4688 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4510009450074E-14
4689 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9771055863436E-01
4690 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1256017634392E-02
4691 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8614398371228E-01
4692 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8297991677393E-01
4693 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8346582577949E-04
4694 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2015853490418E-02
4695 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5644181869583E-03
4696 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7444781692349E-01
4697 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2433723215822E-01
4698 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.0014110083746E-04
4699 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2661843867480E-02
4700 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5878361752745E-03
4701 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0798140459258E-04
4702 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0378617702472E-04
4703 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 6.3413222487743E-11
4704 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8048699666520E-06
4705 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3474280755413E-07
4706 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1099202365416E+01
4707 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.2615292393164E+00
4708 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9099455446367E+00
4709 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5719445926371E+00
4710 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7903827253202E-02
4711 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1394361562754E+01
4712 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8387957550113E+01
4713 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772075277859E+01
4714 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3144714902289E-01
4715 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8759766809785E-02
4716 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0258472154419E-02
4717 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.6039345738738E-02
4718 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6441983754474E-02
4719 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1255319324312E-01
4720 (PID.TID 0000.0001) %MON pe_b_mean = 4.7593355852031E-04
4721 (PID.TID 0000.0001) %MON ke_max = 3.8981716078633E-02
4722 (PID.TID 0000.0001) %MON ke_mean = 1.4088931508320E-04
4723 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4724 (PID.TID 0000.0001) %MON vort_r_min = -1.2549120829468E-06
4725 (PID.TID 0000.0001) %MON vort_r_max = 1.2420755123503E-06
4726 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4727 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946292125E-05
4728 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773458177E-05
4729 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777073674910E-04
4730 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7739915977271E-08
4731 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4479629871195E-08
4732 (PID.TID 0000.0001) // =======================================================
4733 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4734 (PID.TID 0000.0001) // =======================================================
4735 cg2d: Sum(rhs),rhsMax = -9.86233317235019E-12 4.25474298312831E+00
4736 (PID.TID 0000.0001) cg2d_init_res = 1.49787183449392E-01
4737 (PID.TID 0000.0001) cg2d_iters = 62
4738 (PID.TID 0000.0001) cg2d_res = 4.79015464840875E-07
4739 (PID.TID 0000.0001) // =======================================================
4740 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4741 (PID.TID 0000.0001) // =======================================================
4742 (PID.TID 0000.0001) %MON time_tsnumber = 72015
4743 (PID.TID 0000.0001) %MON time_secondsf = 6.2220960000000E+09
4744 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.0040101230155E-01
4745 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.6107834366781E+00
4746 (PID.TID 0000.0001) %MON dynstat_eta_mean = 1.4262679743539E-14
4747 (PID.TID 0000.0001) %MON dynstat_eta_sd = 5.9762769969852E-01
4748 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1258767438050E-02
4749 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.8570178545625E-01
4750 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.8250814128478E-01
4751 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -4.8279132979786E-04
4752 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2016458243435E-02
4753 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.5642814929701E-03
4754 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.7427153729360E-01
4755 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.2423333219031E-01
4756 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -3.9974580711871E-04
4757 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.2660801929684E-02
4758 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.5877219133593E-03
4759 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.0840644574964E-04
4760 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.0341146998821E-04
4761 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 5.4779750245425E-11
4762 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.8027667108226E-06
4763 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 8.3488623761023E-07
4764 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.1108566965094E+01
4765 (PID.TID 0000.0001) %MON dynstat_theta_min = -3.2803666405131E+00
4766 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.9100045389626E+00
4767 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.5720459993886E+00
4768 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 8.7934301989093E-02
4769 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.1394895879545E+01
4770 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8388324292039E+01
4771 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4772075889374E+01
4772 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.3144432164180E-01
4773 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.8760138322486E-02
4774 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.0124667676733E-02
4775 (PID.TID 0000.0001) %MON advcfl_vvel_max = 7.5962507931537E-02
4776 (PID.TID 0000.0001) %MON advcfl_wvel_max = 6.6319815120683E-02
4777 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1227593434226E-01
4778 (PID.TID 0000.0001) %MON pe_b_mean = 4.7580161300182E-04
4779 (PID.TID 0000.0001) %MON ke_max = 3.8835967799042E-02
4780 (PID.TID 0000.0001) %MON ke_mean = 1.4088331976816E-04
4781 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4782 (PID.TID 0000.0001) %MON vort_r_min = -1.2605048708121E-06
4783 (PID.TID 0000.0001) %MON vort_r_max = 1.2440714816576E-06
4784 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4785 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053946209043E-05
4786 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715773436312E-05
4787 (PID.TID 0000.0001) %MON vort_p_sd = 1.2777073504002E-04
4788 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 4.7635254029960E-08
4789 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.4492428748891E-08
4790 (PID.TID 0000.0001) // =======================================================
4791 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4792 (PID.TID 0000.0001) // =======================================================
4793 S/R EXTERNAL_FIELDS_LOAD: Reading new data: 1 2 72015 6.222096000000E+09