ViewVC logotype

Contents of /MITgcm/verification/global_ocean.cs32x15/results/output.thsice.txt

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph

Revision 1.2 - (show annotations) (download)
Tue Dec 5 20:51:12 2006 UTC (15 years, 8 months ago) by jmc
Branch: MAIN
CVS Tags: checkpoint58u_post, checkpoint58w_post, checkpoint58x_post, checkpoint58t_post, checkpoint59a, checkpoint59, checkpoint58y_post, checkpoint58v_post, checkpoint58s_post
Changes since 1.1: +1521 -480 lines
File MIME type: text/plain
changing cg2d.F (store solver main-diagonal term) affects the output
 of cg2d solver: => fails (@ level 11); generate a new output file.

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint58n_post
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: faulks
11 (PID.TID 0000.0001) // Build date: Wed Aug 23 11:14:36 EDT 2006
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx - No. threads per process in X
19 (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20 (PID.TID 0000.0001) > &EEPARMS
21 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
22 (PID.TID 0000.0001) > nTx=1,
23 (PID.TID 0000.0001) > nTy=1,
24 (PID.TID 0000.0001) > &
25 (PID.TID 0000.0001) ># Note: Some systems use & as the
26 (PID.TID 0000.0001) ># namelist terminator. Other systems
27 (PID.TID 0000.0001) ># use a / character (as shown here).
28 (PID.TID 0000.0001)
29 (PID.TID 0000.0001) // =======================================================
30 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
31 (PID.TID 0000.0001) // ( and "eedata" )
32 (PID.TID 0000.0001) // =======================================================
33 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
34 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
35 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
36 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
37 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
38 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
39 (PID.TID 0000.0001) OLx = 3 ; /* Tile overlap distance in X */
40 (PID.TID 0000.0001) OLy = 3 ; /* Tile overlap distance in Y */
41 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
42 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
43 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
44 (PID.TID 0000.0001) nX = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
45 (PID.TID 0000.0001) nY = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
46 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
47 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
48 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
49 (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
50 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
51 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
52 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
53 (PID.TID 0000.0001) useCoupler= F ; /* Flag used to control communications with */
54 (PID.TID 0000.0001) /* other model components, through a coupler */
55 (PID.TID 0000.0001)
56 (PID.TID 0000.0001) // ======================================================
57 (PID.TID 0000.0001) // Mapping of tiles to threads
58 (PID.TID 0000.0001) // ======================================================
59 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
60 (PID.TID 0000.0001)
61 (PID.TID 0000.0001) // ======================================================
62 (PID.TID 0000.0001) // Tile <-> Tile connectvity table
63 (PID.TID 0000.0001) // ======================================================
64 (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000001)
65 (PID.TID 0000.0001) // WEST: Tile = 000006, Process = 000001, Comm = put
66 (PID.TID 0000.0001) // bi = 000006, bj = 000001
67 (PID.TID 0000.0001) // EAST: Tile = 000002, Process = 000001, Comm = put
68 (PID.TID 0000.0001) // bi = 000002, bj = 000001
69 (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000001, Comm = put
70 (PID.TID 0000.0001) // bi = 000001, bj = 000001
71 (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000001, Comm = put
72 (PID.TID 0000.0001) // bi = 000001, bj = 000001
73 (PID.TID 0000.0001) // Tile number: 000002 (process no. = 000001)
74 (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000001, Comm = put
75 (PID.TID 0000.0001) // bi = 000001, bj = 000001
76 (PID.TID 0000.0001) // EAST: Tile = 000003, Process = 000001, Comm = put
77 (PID.TID 0000.0001) // bi = 000003, bj = 000001
78 (PID.TID 0000.0001) // SOUTH: Tile = 000002, Process = 000001, Comm = put
79 (PID.TID 0000.0001) // bi = 000002, bj = 000001
80 (PID.TID 0000.0001) // NORTH: Tile = 000002, Process = 000001, Comm = put
81 (PID.TID 0000.0001) // bi = 000002, bj = 000001
82 (PID.TID 0000.0001) // Tile number: 000003 (process no. = 000001)
83 (PID.TID 0000.0001) // WEST: Tile = 000002, Process = 000001, Comm = put
84 (PID.TID 0000.0001) // bi = 000002, bj = 000001
85 (PID.TID 0000.0001) // EAST: Tile = 000004, Process = 000001, Comm = put
86 (PID.TID 0000.0001) // bi = 000004, bj = 000001
87 (PID.TID 0000.0001) // SOUTH: Tile = 000003, Process = 000001, Comm = put
88 (PID.TID 0000.0001) // bi = 000003, bj = 000001
89 (PID.TID 0000.0001) // NORTH: Tile = 000003, Process = 000001, Comm = put
90 (PID.TID 0000.0001) // bi = 000003, bj = 000001
91 (PID.TID 0000.0001) // Tile number: 000004 (process no. = 000001)
92 (PID.TID 0000.0001) // WEST: Tile = 000003, Process = 000001, Comm = put
93 (PID.TID 0000.0001) // bi = 000003, bj = 000001
94 (PID.TID 0000.0001) // EAST: Tile = 000005, Process = 000001, Comm = put
95 (PID.TID 0000.0001) // bi = 000005, bj = 000001
96 (PID.TID 0000.0001) // SOUTH: Tile = 000004, Process = 000001, Comm = put
97 (PID.TID 0000.0001) // bi = 000004, bj = 000001
98 (PID.TID 0000.0001) // NORTH: Tile = 000004, Process = 000001, Comm = put
99 (PID.TID 0000.0001) // bi = 000004, bj = 000001
100 (PID.TID 0000.0001) // Tile number: 000005 (process no. = 000001)
101 (PID.TID 0000.0001) // WEST: Tile = 000004, Process = 000001, Comm = put
102 (PID.TID 0000.0001) // bi = 000004, bj = 000001
103 (PID.TID 0000.0001) // EAST: Tile = 000006, Process = 000001, Comm = put
104 (PID.TID 0000.0001) // bi = 000006, bj = 000001
105 (PID.TID 0000.0001) // SOUTH: Tile = 000005, Process = 000001, Comm = put
106 (PID.TID 0000.0001) // bi = 000005, bj = 000001
107 (PID.TID 0000.0001) // NORTH: Tile = 000005, Process = 000001, Comm = put
108 (PID.TID 0000.0001) // bi = 000005, bj = 000001
109 (PID.TID 0000.0001) // Tile number: 000006 (process no. = 000001)
110 (PID.TID 0000.0001) // WEST: Tile = 000005, Process = 000001, Comm = put
111 (PID.TID 0000.0001) // bi = 000005, bj = 000001
112 (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000001, Comm = put
113 (PID.TID 0000.0001) // bi = 000001, bj = 000001
114 (PID.TID 0000.0001) // SOUTH: Tile = 000006, Process = 000001, Comm = put
115 (PID.TID 0000.0001) // bi = 000006, bj = 000001
116 (PID.TID 0000.0001) // NORTH: Tile = 000006, Process = 000001, Comm = put
117 (PID.TID 0000.0001) // bi = 000006, bj = 000001
118 (PID.TID 0000.0001)
119 (PID.TID 0000.0001) ===== W2 TILE TOPLOGY =====
120 (PID.TID 0000.0001) TILE: 1
121 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
122 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
123 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
124 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
125 (PID.TID 0000.0001) TILE: 2
126 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
127 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
128 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
129 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
130 (PID.TID 0000.0001) TILE: 3
131 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
132 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
133 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
134 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
135 (PID.TID 0000.0001) TILE: 4
136 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
137 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
138 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
139 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
140 (PID.TID 0000.0001) TILE: 5
141 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
142 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
143 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
144 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
145 (PID.TID 0000.0001) TILE: 6
146 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
147 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
148 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
149 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
150 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 35: -2, j= 30: 32
151 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 3(proc = 1)
152 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= -2: 35, j= 1: 3
153 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 6(proc = 1)
154 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 30: 32, j= -2: 35
155 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 2(proc = 1)
156 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 1: 3, j= 35: -2
157 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 5(proc = 1)
158 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= -2: 35, j= 30: 32
159 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 3(proc = 1)
160 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 35: -2, j= 1: 3
161 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 6(proc = 1)
162 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 30: 32, j= 35: -2
163 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 4(proc = 1)
164 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 1: 3, j= -2: 35
165 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 1(proc = 1)
166 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 35: -2, j= 30: 32
167 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 5(proc = 1)
168 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= -2: 35, j= 1: 3
169 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 2(proc = 1)
170 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 30: 32, j= -2: 35
171 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 4(proc = 1)
172 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 1: 3, j= 35: -2
173 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 1(proc = 1)
174 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= -2: 35, j= 30: 32
175 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 5(proc = 1)
176 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 35: -2, j= 1: 3
177 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 2(proc = 1)
178 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 30: 32, j= 35: -2
179 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 6(proc = 1)
180 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 1: 3, j= -2: 35
181 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 3(proc = 1)
182 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 35: -2, j= 30: 32
183 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 1(proc = 1)
184 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= -2: 35, j= 1: 3
185 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 4(proc = 1)
186 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 30: 32, j= -2: 35
187 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 6(proc = 1)
188 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 1: 3, j= 35: -2
189 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 3(proc = 1)
190 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= -2: 35, j= 30: 32
191 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 1(proc = 1)
192 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 35: -2, j= 1: 3
193 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 4(proc = 1)
194 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 30: 32, j= 35: -2
195 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 2(proc = 1)
196 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 1: 3, j= -2: 35
197 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 5(proc = 1)
198 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
199 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
200 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
201 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
202 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
203 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
204 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
205 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
206 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
207 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
208 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
209 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
210 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
211 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
212 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
213 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
214 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
215 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
216 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
217 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
218 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
219 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
220 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
221 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
222 (PID.TID 0000.0001) // =======================================================
223 (PID.TID 0000.0001) // Model parameter file "data"
224 (PID.TID 0000.0001) // =======================================================
225 (PID.TID 0000.0001) ># ====================
226 (PID.TID 0000.0001) ># | Model parameters |
227 (PID.TID 0000.0001) ># ====================
228 (PID.TID 0000.0001) >#
229 (PID.TID 0000.0001) ># Continuous equation parameters
230 (PID.TID 0000.0001) > &PARM01
231 (PID.TID 0000.0001) > tRef=15*20.,
232 (PID.TID 0000.0001) > sRef=15*35.,
233 (PID.TID 0000.0001) > viscAh =3.E5,
234 (PID.TID 0000.0001) > viscAr =1.E-3,
235 (PID.TID 0000.0001) > diffKhT=0.,
236 (PID.TID 0000.0001) > diffK4T=0.,
237 (PID.TID 0000.0001) > diffKrT=3.E-5,
238 (PID.TID 0000.0001) > diffKhS=0.,
239 (PID.TID 0000.0001) > diffK4S=0.,
240 (PID.TID 0000.0001) > diffKrS=3.E-5,
241 (PID.TID 0000.0001) > ivdc_kappa=10.,
242 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
243 (PID.TID 0000.0001) > rotationPeriod=86400.,
244 (PID.TID 0000.0001) > gravity=9.81,
245 (PID.TID 0000.0001) > rhonil=1035.,
246 (PID.TID 0000.0001) > rhoConstFresh=1000.,
247 (PID.TID 0000.0001) > eosType='JMD95Z',
248 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
249 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
250 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
251 (PID.TID 0000.0001) > exactConserv=.TRUE.,
252 (PID.TID 0000.0001) > select_rStar=2,
253 (PID.TID 0000.0001) > nonlinFreeSurf=4,
254 (PID.TID 0000.0001) > hFacInf=0.2,
255 (PID.TID 0000.0001) > hFacSup=2.0,
256 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
257 (PID.TID 0000.0001) > hFacMin=.1,
258 (PID.TID 0000.0001) > hFacMinDr=20.,
259 (PID.TID 0000.0001) > readBinaryPrec=64,
260 (PID.TID 0000.0001) >#writeBinaryPrec=64,
261 (PID.TID 0000.0001) > &
262 (PID.TID 0000.0001) >
263 (PID.TID 0000.0001) ># Elliptic solver parameters
264 (PID.TID 0000.0001) > &PARM02
265 (PID.TID 0000.0001) > cg2dMaxIters=200,
266 (PID.TID 0000.0001) >#cg2dTargetResidual=1.E-9,
267 (PID.TID 0000.0001) > cg2dTargetResWunit=1.E-14,
268 (PID.TID 0000.0001) > &
269 (PID.TID 0000.0001) >
270 (PID.TID 0000.0001) ># Time stepping parameters
271 (PID.TID 0000.0001) > &PARM03
272 (PID.TID 0000.0001) > nIter0=36000,
273 (PID.TID 0000.0001) > nTimeSteps=20,
274 (PID.TID 0000.0001) > deltaTmom =1200.,
275 (PID.TID 0000.0001) > deltaTtracer=86400.,
276 (PID.TID 0000.0001) > deltaTfreesurf=86400.,
277 (PID.TID 0000.0001) > deltaTClock =86400.,
278 (PID.TID 0000.0001) > abEps = 0.1,
279 (PID.TID 0000.0001) >#forcing_In_AB=.FALSE.,
280 (PID.TID 0000.0001) > tracForcingOutAB=1,
281 (PID.TID 0000.0001) > pChkptFreq =31104000.,
282 (PID.TID 0000.0001) > taveFreq =31104000.,
283 (PID.TID 0000.0001) > dumpFreq =31104000.,
284 (PID.TID 0000.0001) > monitorFreq =2592000.,
285 (PID.TID 0000.0001) >#tave_lastIter=0.,
286 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
287 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
288 (PID.TID 0000.0001) > externForcingCycle=31104000.,
289 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
290 (PID.TID 0000.0001) > tauThetaClimRelax = 5184000.,
291 (PID.TID 0000.0001) ># 6 months restoring timescale for salinity
292 (PID.TID 0000.0001) > tauSaltClimRelax = 15552000.,
293 (PID.TID 0000.0001) > latBandClimRelax=50.,
294 (PID.TID 0000.0001) > monitorFreq =1.,
295 (PID.TID 0000.0001) > &
296 (PID.TID 0000.0001) >
297 (PID.TID 0000.0001) ># Gridding parameters
298 (PID.TID 0000.0001) > &PARM04
299 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
300 (PID.TID 0000.0001) > horizGridFile='grid_cs32',
301 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
302 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
303 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
304 (PID.TID 0000.0001) > &
305 (PID.TID 0000.0001) >
306 (PID.TID 0000.0001) ># Input datasets
307 (PID.TID 0000.0001) > &PARM05
308 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
309 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
310 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
311 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
312 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
313 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
314 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
315 (PID.TID 0000.0001) > &
316 (PID.TID 0000.0001)
317 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM01
318 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM01 : OK
319 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM02
320 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM02 : OK
321 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM03
322 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM03 : OK
323 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM04
324 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM04 : OK
325 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM05
326 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM05 : OK
327 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
328 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
329 (PID.TID 0000.0001) // =======================================================
330 (PID.TID 0000.0001) // Parameter file "data.pkg"
331 (PID.TID 0000.0001) // =======================================================
332 (PID.TID 0000.0001) ># Packages
333 (PID.TID 0000.0001) > &PACKAGES
334 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
335 (PID.TID 0000.0001) > useBulkforce=.TRUE.,
336 (PID.TID 0000.0001) > useThSIce=.TRUE.,
337 (PID.TID 0000.0001) > useDiagnostics=.TRUE.,
338 (PID.TID 0000.0001) > &
339 (PID.TID 0000.0001)
340 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
341 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
342 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
343 (PID.TID 0000.0001) // =======================================================
344 (PID.TID 0000.0001) // Parameter file "data.gmredi"
345 (PID.TID 0000.0001) // =======================================================
346 (PID.TID 0000.0001) ># GM+Redi package parameters:
347 (PID.TID 0000.0001) >
348 (PID.TID 0000.0001) >#-from MOM :
349 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
350 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
351 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
352 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
353 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
354 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
355 (PID.TID 0000.0001) >
356 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
357 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
358 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
359 (PID.TID 0000.0001) >
360 (PID.TID 0000.0001) > &GM_PARM01
361 (PID.TID 0000.0001) > GM_background_K = 800.,
362 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
363 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
364 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
365 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
366 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
367 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
368 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
369 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
370 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
371 (PID.TID 0000.0001) > &
372 (PID.TID 0000.0001) >
373 (PID.TID 0000.0001) >
374 (PID.TID 0000.0001)
375 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
376 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.blk
377 (PID.TID 0000.0001) // =======================================================
378 (PID.TID 0000.0001) // Parameter file "data.blk"
379 (PID.TID 0000.0001) // =======================================================
380 (PID.TID 0000.0001) > &BULKF_CONST
381 (PID.TID 0000.0001) > Tf0kel = 273.15,
382 (PID.TID 0000.0001) >#p0 = 1013., <- no longer in Namelist, but hard coded
383 (PID.TID 0000.0001) > Rgas = 287.,
384 (PID.TID 0000.0001) > &
385 (PID.TID 0000.0001) >
386 (PID.TID 0000.0001) > &BULKF_PARM01
387 (PID.TID 0000.0001) ># set blk_nIter=0 to use the original FORMULA_LANL:
388 (PID.TID 0000.0001) > blk_nIter= 0,
389 (PID.TID 0000.0001) >#RainFile= 'ncep_precip_cs.bin',
390 (PID.TID 0000.0001) > RainFile= 'ncep_pr_scal_cs.bin',
391 (PID.TID 0000.0001) > SolarFile= 'ncep_downsolar_cs.bin',
392 (PID.TID 0000.0001) > AirTempFile= 'ncep_tair_cs.bin',
393 (PID.TID 0000.0001) > AirhumidityFile='ncep_qair_cs.bin',
394 (PID.TID 0000.0001) > LongwaveFile= 'ncep_downlw_cs.bin',
395 (PID.TID 0000.0001) > UWindFile= ' ',
396 (PID.TID 0000.0001) > VWindFile= ' ',
397 (PID.TID 0000.0001) > WspeedFile= 'ncep_windspeed_cs.bin',
398 (PID.TID 0000.0001) > RunoffFile= ' ',
399 (PID.TID 0000.0001) > QnetFile= ' ',
400 (PID.TID 0000.0001) > EmPFile= ' ',
401 (PID.TID 0000.0001) > CloudFile= ' ',
402 (PID.TID 0000.0001) >#blk_taveFreq=864000.,
403 (PID.TID 0000.0001) > &
404 (PID.TID 0000.0001) >
405 (PID.TID 0000.0001) > &BULKF_PARM02
406 (PID.TID 0000.0001) > qnet_off=0.0,
407 (PID.TID 0000.0001) > empmr_off=0.0,
408 (PID.TID 0000.0001) > conservcycle=311040000.,
409 (PID.TID 0000.0001) > &
410 (PID.TID 0000.0001) >
411 (PID.TID 0000.0001)
412 (PID.TID 0000.0001) BULKF_READPARMS: starts to read BULKF_CONST
414 (PID.TID 0000.0001) BULKF_READPARMS: starts to read BULKF_PARM01
415 (PID.TID 0000.0001) BULKF_READPARMS: read BULKF_PARM01 : OK
416 BlkF: rhoA = 1.3
417 BlkF: rhoFW = 1000.
418 BlkF: cpAir = 1004.
419 BlkF: Lvap = 2500000.
420 BlkF: Lfresh = 334000.
421 BlkF: Tf0kel = 273.15
422 BlkF: Rgas = 287.
423 BlkF: xkar = 0.4
424 BlkF: stefan = 5.67E-08
425 BlkF: zref = 10.
426 BlkF: zwd = 10.
427 BlkF: zth = 10.
428 BlkF: cDrag_1 = 0.0027
429 BlkF: cDrag_2 = 0.000142
430 BlkF: cDrag_3 = 7.64E-05
431 BlkF: cStantonS= 0.018
432 BlkF: cStantonU= 0.0327
433 BlkF: cDalton = 0.0346
434 BlkF: umin = 1.
435 BlkF: humid_fac= 0.606
436 BlkF: saltQsFac= 0.98
437 BlkF: gamma_blk= 0.01
438 BlkF: atm_emissivity = 0.9
439 BlkF: ocean_emissivity= 0.985
440 BlkF: snow_emissivity = 0.98
441 BlkF: ice_emissivity = 0.98
442 BlkF: ocean_albedo = 0.1
443 BlkF: FWIND0 = 0.6
444 BlkF: CHS = 0.0008
445 BlkF: VGUST = 5.
446 BlkF: DTHETA = 3.
447 BlkF: dTstab = 1.
448 BlkF: FSTAB = 0.67
449 BlkF: useFluxFormula_AIM= F
450 BlkF: calcWindStress = F
451 BlkF: useQnetch = F
452 BlkF: useEmPch = F
453 BlkF: blk_nIter = 0
454 BlkF: blk_taveFreq= 31104000.
455 (PID.TID 0000.0001) THSICE_READPARMS: opening data.ice
456 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.ice
457 (PID.TID 0000.0001) // =======================================================
458 (PID.TID 0000.0001) // Parameter file "data.ice"
459 (PID.TID 0000.0001) // =======================================================
460 (PID.TID 0000.0001) > &THSICE_CONST
461 (PID.TID 0000.0001) > Tf0kel = 273.15,
462 (PID.TID 0000.0001) >#- with LANL albedo:
463 (PID.TID 0000.0001) >#albWarmSnow=0.75,
464 (PID.TID 0000.0001) >#- for full ice-fraction :
465 (PID.TID 0000.0001) >#icemaskmin = 1.,
466 (PID.TID 0000.0001) >#himin0 = 0.01,
467 (PID.TID 0000.0001) >#frac_energy= 0.,
468 (PID.TID 0000.0001) >#hihig =100.,
469 (PID.TID 0000.0001) >#- with fractional ice:
470 (PID.TID 0000.0001) > icemaskmin = 0.05,
471 (PID.TID 0000.0001) > hiMax = 10.,
472 (PID.TID 0000.0001) > hsMax = 10.,
473 (PID.TID 0000.0001) >#albIceMax =0.7,
474 (PID.TID 0000.0001) >#albIceMin =0.7,
475 (PID.TID 0000.0001) > &
476 (PID.TID 0000.0001) >
477 (PID.TID 0000.0001) > &THSICE_PARM01
478 (PID.TID 0000.0001) >#StartIceModel=1,
479 (PID.TID 0000.0001) > stressReduction=0.,
480 (PID.TID 0000.0001) >#thSIce_taveFreq=2592000.,
481 (PID.TID 0000.0001) >#thSIce_diagFreq=2592000.,
482 (PID.TID 0000.0001) >#thSIce_monFreq=864000.,
483 (PID.TID 0000.0001) > &
484 (PID.TID 0000.0001) >
485 (PID.TID 0000.0001)
488 ThSI: rhos = 330.
489 ThSI: rhoi = 900.
490 ThSI: rhosw = 1035.
491 ThSI: rhofw = 1000.
492 ThSI: rhoiw = 135.
493 ThSI: cpice = 2106.
494 ThSI: cpwater = 3994.
495 ThSI: kice = 2.03
496 ThSI: ksnow = 0.3
497 ThSI: transcoef= 0.006
498 ThSI: Lfresh = 334000.
499 ThSI: qsnow = 334000.
500 ThSI: albColdSnow= 0.85
501 ThSI: albWarmSnow= 0.7
502 ThSI: tempSnowAlb= -10.
503 ThSI: albOldSnow = 0.55
504 ThSI: hNewSnowAge= 0.002
505 ThSI: snowAgTime = 4320000.
506 ThSI: albIceMax = 0.65
507 ThSI: albIceMin = 0.2
508 ThSI: hAlbIce = 0.5
509 ThSI: hAlbSnow = 0.3
510 ThSI: i0 = 0.3
511 ThSI: ksolar = 1.5
512 ThSI: saltice = 4.
513 ThSI: S_winton= 1.
514 ThSI: mu_Tf = 0.054
515 ThSI: Tf0kel = 273.15
516 ThSI: Tmlt1 = -0.054
517 ThSI: himin = 0.01
518 ThSI: Terrmax = 0.5
519 ThSI: nitMaxTsf= 20
520 ThSI: hiMax = 10.
521 ThSI: hsMax = 10.
522 ThSI: iceMaskmax= 1.
523 ThSI: iceMaskmin= 0.05
524 ThSI: himin0 = 0.2
525 ThSI: frac_energy 0.4
526 ThSI: hihig = 2.5
527 ThSI: stressReduction = 0.
528 ThSI: thSIce_deltaT = 86400.
529 ThSI: ocean_deltaT = 86400.
530 ThSI: stepFwd_oceMxL= F
531 ThSI: tauRelax_MxL = 0.
532 ThSI: hMxL_default = 50.
533 ThSI: sMxL_default = 35.
534 ThSI: vMxL_default = 0.05
535 ThSI: thSIce_taveFreq= 31104000.
536 ThSI: thSIce_diagFreq= 31104000.
537 ThSI: thSIce_monFreq = 1.
538 ThSI: startIceModel = 0
539 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: opening data.diagnostics
540 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.diagnostics
541 (PID.TID 0000.0001) // =======================================================
542 (PID.TID 0000.0001) // Parameter file "data.diagnostics"
543 (PID.TID 0000.0001) // =======================================================
544 (PID.TID 0000.0001) ># Diagnostic Package Choices
545 (PID.TID 0000.0001) >#-----------------
546 (PID.TID 0000.0001) ># for each output-stream:
547 (PID.TID 0000.0001) ># filename(n) : prefix of the output file name (only 8.c long) for outp.stream n
548 (PID.TID 0000.0001) ># frequency(n):< 0 : write snap-shot output every |frequency| seconds
549 (PID.TID 0000.0001) ># > 0 : write time-average output every frequency seconds
550 (PID.TID 0000.0001) ># timePhase(n) : write at time = timePhase + multiple of |frequency|
551 (PID.TID 0000.0001) ># averagingFreq(n) : frequency (in s) for periodic averaging interval
552 (PID.TID 0000.0001) ># averagingPhase(n): phase (in s) for periodic averaging interval
553 (PID.TID 0000.0001) ># repeatCycle(n) : number of averaging intervals in 1 cycle
554 (PID.TID 0000.0001) ># levels(:,n) : list of levels to write to file (Notes: declared as REAL)
555 (PID.TID 0000.0001) ># when this entry is missing, select all common levels of this list
556 (PID.TID 0000.0001) ># fields(:,n) : list of diagnostics fields (8.c) (see "available_diagnostics.log"
557 (PID.TID 0000.0001) ># file for the list of all available diag. in this particular config)
558 (PID.TID 0000.0001) >#-----------------
559 (PID.TID 0000.0001) > &DIAGNOSTICS_LIST
560 (PID.TID 0000.0001) ># diag_mnc = .FALSE.,
561 (PID.TID 0000.0001) ># dumpAtLast = .TRUE.,
562 (PID.TID 0000.0001) > fields(1,1) = 'ETAN ','ETANSQ ','DETADT2 ','PHIBOT ','PHIBOTSQ',
563 (PID.TID 0000.0001) > 'oceTAUX ','oceTAUY ','TFLUX ','SFLUX ','oceFreez',
564 (PID.TID 0000.0001) > 'TRELAX ','SRELAX ',
565 (PID.TID 0000.0001) > levels(1,1) = 1.,
566 (PID.TID 0000.0001) > filename(1) = 'surfDiag',
567 (PID.TID 0000.0001) > frequency(1) = 1555200000.,
568 (PID.TID 0000.0001) > fields(1,2) = 'UVEL ','VVEL ','WVEL ','PHIHYD ',
569 (PID.TID 0000.0001) > 'VVELMASS','UVELMASS','WVELSQ ',
570 (PID.TID 0000.0001) > 'THETA ','UTHMASS ','VTHMASS ','WTHMASS ',
572 (PID.TID 0000.0001) ># do not specify levels => all levels are selected
573 (PID.TID 0000.0001) > filename(2) = 'dynDiag',
574 (PID.TID 0000.0001) > frequency(2) = 1555200000.,
575 (PID.TID 0000.0001) > fields(1,3) = 'DRHODR ','RHOAnoma','CONVADJ ',
576 (PID.TID 0000.0001) > 'GM_PsiX ','GM_PsiY ',
577 (PID.TID 0000.0001) > 'GM_Kwx ','GM_Kwy ','GM_Kwz ',
578 (PID.TID 0000.0001) > 'GM_Kux ','GM_Kvy ',
579 (PID.TID 0000.0001) > 'GM_Kuz ','GM_Kvz ',
580 (PID.TID 0000.0001) >#- disable this output list by commenting out the file name
581 (PID.TID 0000.0001) ># filename(3) = 'oceDiag',
582 (PID.TID 0000.0001) > frequency(3) = 1555200000.,
583 (PID.TID 0000.0001) > fields(1,4) = 'ADVx_TH ','ADVy_TH ','ADVr_TH ',
584 (PID.TID 0000.0001) > 'DFxE_TH ','DFyE_TH ','DFrE_TH ',
585 (PID.TID 0000.0001) > 'DFrI_TH ',
586 (PID.TID 0000.0001) ># 'ADVx_SLT',
587 (PID.TID 0000.0001) ># filename(4) = 'flxDiag',
588 (PID.TID 0000.0001) > frequency(4) = 1728000.,
589 (PID.TID 0000.0001) > fields(1,5) = 'SI_Fract','SI_Thick','SI_SnowH',
590 (PID.TID 0000.0001) > 'SI_Tsrf ','SI_Tice1','SI_Tice2',
591 (PID.TID 0000.0001) > 'SI_Qice1','SI_Qice2','SIsnwAge',
592 (PID.TID 0000.0001) > 'SIsnwPrc','SIalbedo',
593 (PID.TID 0000.0001) > 'SIflx2oc','SIfrw2oc','SIsaltFx',
594 (PID.TID 0000.0001) > 'SIflxAtm','SIfrwAtm',
595 (PID.TID 0000.0001) ># 'SItOcMxL','SIsOcMxL',
596 (PID.TID 0000.0001) > filename(5) = 'thSIceDiag',
597 (PID.TID 0000.0001) > frequency(5) = 1555200000.,
598 (PID.TID 0000.0001) > averagingFreq(5) = 2592000.,
599 (PID.TID 0000.0001) > repeatCycle(5) = 12,
600 (PID.TID 0000.0001) > &
601 (PID.TID 0000.0001) >
602 (PID.TID 0000.0001) ># Parameter for Diagnostics of per level statistics:
603 (PID.TID 0000.0001) >#-----------------
604 (PID.TID 0000.0001) ># for each output-stream:
605 (PID.TID 0000.0001) ># stat_fname(n) : prefix of the output file name (only 8.c long) for outp.stream n
606 (PID.TID 0000.0001) ># stat_freq(n):< 0 : write snap-shot output every |stat_freq| seconds
607 (PID.TID 0000.0001) ># > 0 : write time-average output every stat_freq seconds
608 (PID.TID 0000.0001) ># stat_phase(n) : write at time = stat_phase + multiple of |stat_freq|
609 (PID.TID 0000.0001) ># stat_region(:,n) : list of "regions" (default: 1 region only=global)
610 (PID.TID 0000.0001) ># stat_fields(:,n) : list of diagnostics fields (8.c) (see "available_diagnostics.log"
611 (PID.TID 0000.0001) ># file for the list of all available diag. in this particular config)
612 (PID.TID 0000.0001) >#-----------------
613 (PID.TID 0000.0001) > &DIAG_STATIS_PARMS
614 (PID.TID 0000.0001) >#- regional mask: 3 lat. band: 1 : y <= -24 ; 2 : -24<y<24 ; 3 : 24 <= y
615 (PID.TID 0000.0001) > diagSt_regMaskFile='regMask_lat24.bin',
616 (PID.TID 0000.0001) > nSetRegMskFile=1,
617 (PID.TID 0000.0001) > set_regMask(1)= 1, 1, 1,
618 (PID.TID 0000.0001) > val_regMask(1)= 1., 2., 3.,
619 (PID.TID 0000.0001) >#---
620 (PID.TID 0000.0001) > stat_fields(1,1)= 'ETAN ','UVEL ','VVEL ','WVEL ',
621 (PID.TID 0000.0001) > 'THETA ','SALT ','CONVADJ ','DETADT2 ',
622 (PID.TID 0000.0001) > stat_fname(1)= 'dynStDiag',
623 (PID.TID 0000.0001) > stat_freq(1)= 864000.,
624 (PID.TID 0000.0001) > stat_fields(1,5)= 'SI_Fract','SI_Thick','SI_SnowH',
625 (PID.TID 0000.0001) > 'SI_Tsrf ','SI_Tice1','SI_Tice2',
626 (PID.TID 0000.0001) > 'SI_Qice1','SI_Qice2',
627 (PID.TID 0000.0001) > 'SIsnwPrc','SIalbedo','SIsnwAge',
628 (PID.TID 0000.0001) > 'SIflx2oc','SIfrw2oc','SIsaltFx',
629 (PID.TID 0000.0001) > 'SIflxAtm','SIfrwAtm',
630 (PID.TID 0000.0001) ># 'SItOcMxL','SIsOcMxL',
631 (PID.TID 0000.0001) > stat_region(1,5)= 1, 3, 0,
632 (PID.TID 0000.0001) > stat_fname(5)= 'thSIceStDiag',
633 (PID.TID 0000.0001) > stat_freq(5)= 864000.,
634 (PID.TID 0000.0001) > &
635 (PID.TID 0000.0001) >
636 (PID.TID 0000.0001)
637 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "diagnostics_list": start
638 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "diagnostics_list": OK
639 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "DIAG_STATIS_PARMS": start
641 (PID.TID 0000.0001) -----------------------------------------------------
642 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: active diagnostics summary:
643 (PID.TID 0000.0001) -----------------------------------------------------
644 (PID.TID 0000.0001) Creating Output Stream: surfDiag
645 (PID.TID 0000.0001) Output Frequency:1555200000.000000 ; Phase: 0.000000
646 (PID.TID 0000.0001) Averaging Freq.:1555200000.000000 , Phase: 0.000000 , Cycle: 1
647 (PID.TID 0000.0001) Levels: 1.
649 (PID.TID 0000.0001) Fields: TRELAX SRELAX
650 (PID.TID 0000.0001) Creating Output Stream: dynDiag
651 (PID.TID 0000.0001) Output Frequency:1555200000.000000 ; Phase: 0.000000
652 (PID.TID 0000.0001) Averaging Freq.:1555200000.000000 , Phase: 0.000000 , Cycle: 1
653 (PID.TID 0000.0001) Levels: will be set later
656 (PID.TID 0000.0001) Creating Output Stream: thSIceDiag
657 (PID.TID 0000.0001) Output Frequency:1555200000.000000 ; Phase: 0.000000
658 (PID.TID 0000.0001) Averaging Freq.: 2592000.000000 , Phase: 0.000000 , Cycle: 12
659 (PID.TID 0000.0001) Levels: will be set later
660 (PID.TID 0000.0001) Fields: SI_Fract SI_Thick SI_SnowH SI_Tsrf SI_Tice1 SI_Tice2 SI_Qice1 SI_Qice2 SIsnwAge SIsnwPrc
661 (PID.TID 0000.0001) Fields: SIalbedo SIflx2oc SIfrw2oc SIsaltFx SIflxAtm SIfrwAtm
662 (PID.TID 0000.0001) -----------------------------------------------------
663 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: statistics diags. summary:
664 (PID.TID 0000.0001) Creating Stats. Output Stream: dynStDiag
665 (PID.TID 0000.0001) Output Frequency: 864000.000000 ; Phase: 0.000000
666 (PID.TID 0000.0001) Regions : 0
668 (PID.TID 0000.0001) Creating Stats. Output Stream: thSIceStDiag
669 (PID.TID 0000.0001) Output Frequency: 864000.000000 ; Phase: 0.000000
670 (PID.TID 0000.0001) Regions : 0 1 3
671 (PID.TID 0000.0001) Fields: SI_Fract SI_Thick SI_SnowH SI_Tsrf SI_Tice1 SI_Tice2 SI_Qice1 SI_Qice2 SIsnwPrc SIalbedo SIsnwAge SIflx2oc SIfrw2oc SIsaltFx SIflxAtm SIfrwAtm
672 (PID.TID 0000.0001) -----------------------------------------------------
673 (PID.TID 0000.0001)
674 (PID.TID 0000.0001) SET_PARMS: done
675 (PID.TID 0000.0001) Enter INI_VERTICAL_GRID: setInterFDr= T ; setCenterDr= F
676 (PID.TID 0000.0001) tile: 1 ; Read from file grid_cs32.face001.bin
677 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
678 (PID.TID 0000.0001) tile: 2 ; Read from file grid_cs32.face002.bin
679 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
680 (PID.TID 0000.0001) tile: 3 ; Read from file grid_cs32.face003.bin
681 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
682 (PID.TID 0000.0001) tile: 4 ; Read from file grid_cs32.face004.bin
683 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
684 (PID.TID 0000.0001) tile: 5 ; Read from file grid_cs32.face005.bin
685 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
686 (PID.TID 0000.0001) tile: 6 ; Read from file grid_cs32.face006.bin
687 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
688 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
689 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
690 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
691 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
692 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
693 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
694 (PID.TID 0000.0001) %MON XG_mean = 1.8796250616675E+00
695 (PID.TID 0000.0001) %MON XG_sd = 1.0410625309932E+02
696 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
697 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
698 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
699 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
700 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
701 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
702 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
703 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
704 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
705 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
706 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
707 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
708 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
709 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
710 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
711 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
712 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
713 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
714 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
715 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
716 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
717 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
718 (PID.TID 0000.0001) %MON YG_mean = -1.2094344438470E-15
719 (PID.TID 0000.0001) %MON YG_sd = 3.9086186579984E+01
720 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
721 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
722 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
723 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
724 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
725 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
726 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
727 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
728 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
729 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
730 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
731 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
732 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
733 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
734 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
735 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
736 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
737 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
738 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
739 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
740 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
741 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
742 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
743 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
744 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
745 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
746 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
747 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
748 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
749 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
750 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
751 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
752 (PID.TID 0000.0001) %MON AngleCS_max = 9.9999994756719E-01
753 (PID.TID 0000.0001) %MON AngleCS_min = -9.9968286884824E-01
754 (PID.TID 0000.0001) %MON AngleCS_mean = 3.3078850405987E-01
755 (PID.TID 0000.0001) %MON AngleCS_sd = 6.2496317138039E-01
756 (PID.TID 0000.0001) %MON AngleSN_max = 9.9968286884824E-01
757 (PID.TID 0000.0001) %MON AngleSN_min = -9.9999994756719E-01
758 (PID.TID 0000.0001) %MON AngleSN_mean = -3.3078850405987E-01
759 (PID.TID 0000.0001) %MON AngleSN_sd = 6.2496317138039E-01
760 (PID.TID 0000.0001) MDSREADFIELD: opening global file: bathy_Hmin50.bin
761 (PID.TID 0000.0001) // =======================================================
762 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc) at iteration 1
763 (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
764 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
765 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
766 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
767 (PID.TID 0000.0001) // 0.0: .
768 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
769 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
770 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
771 (PID.TID 0000.0001) // =======================================================
772 (PID.TID 0000.0001) K = 1
773 (PID.TID 0000.0001) // I=7 I=17 I=27 I=31 I=41 I=51 I=61 I=65 I=75 I=85 I=95 I=99 I=109 I=119 I=129 I=133 I=143 I=153 I=163 I=167 I=177 I=187
774 (PID.TID 0000.0001) // |--J--|210123456|890123456|890123456|890123450|234567890|234567890|234567890|234567234|678901234|678901234|678901234|678945678|012345678|012345678|012345678|016789012|456789012|456789012|456789012|890123456|890123456|890123456|89012345
775 (PID.TID 0000.0001) // 35 cac--cbbeefjkfefw+..........zpu......................................kqnzrqq-b-da----bbbbfu..............fdddccaaddccaadcdddcbbbbcdddcccdffffghgffffddefligfiljfba---aafddehy...pwvlhfffcbagfccbagfcceeffffjlkjgaa---bfvheeln-aesaaa
776 (PID.TID 0000.0001) // 34 --ba-abcehjnldcclz+........spps.....................................vkqn+xnnabbcbba--aabfu+..............hcbaaaaacaaaaaccdccbaaabbddddccdffffghfeeeeedefiffefilhfcaaaacgceei.......zomggfcaecbfcaecbbccddefilihecbaacbaajfega-aesfee
777 (PID.TID 0000.0001) // 33 -abbbccceiomkfdbbc+.......+s........................................xsrxzz+zdcddb-----adu+...............hcbaa--acaa--accddba--bbbddddccdfffhhgfeeddccedfeddfgikhfffdfgccffw........zohhgebbaagebbaaaaaccdfhlhfefdcccaabjefbaaafooss
778 (PID.TID 0000.0001) // 32 -bddefhhkqqlgfaakqz..v.+..+.......................................++..u+....gfdba----adu+................kdcaaa-acaaa-accdcb---bbbcdddddefffggfeeedccccccbbdcdfgghhiihcbeiw.........+ynjgebaaagebaaaa-aacccfikkhecccbbbaaabaadfklnqp
779 (PID.TID 0000.0001) // 31 bbcffijnpnqneaaat..umrr+s.z.......................................+++++.ztsvifeb--dfdfu+................+lkdca--abca--abcccb---bbbbddddeffflhfeeeecbbbbaa-abbacbcdceffbbfw+..........++ujfbaaajfbaaa----aacffiljgfffcca--adfikkiihhh
780 (PID.TID 0000.0001) // 30 -adgillkkkifcadcx.ymmqzqikvnnps...................................+++++wmegtlifcacdlqx+++...............mligea---aea---abbbb---abaaddddeedkmeddefdbbbaaac---b--aaaaabaabm..............+viba--viba-------acdefinmlgiieb-chnnnmlmlgff
781 (PID.TID 0000.0001) // 29 -cfiljigfjd--efdozy...+ximpnnuz....................................+++yqddhpljhcbbchz+......++.........+mmhffc----fc----aaba------acdddcbcineddgdbaaa---dd--a------aa-bfz...............+qe---+qe---aa---aedeegknmlgiigcdfhpokkimlfd
782 (PID.TID 0000.0001) // 28 abgkhfcccea-bdei........t..........................................++zwgfcfkknhccbbhwwy.....+++........+njfeed----ed-----aa-------abddcabcnfddegcaaa----lf------------dk+................+ja--.+ja------bffdddehfd--bedaacfhpnligiih
783 (PID.TID 0000.0001) // 27 acghfbaaaa-achmy............................+++....................++vnbbbclkpkeeecflmqxy....++........+lhfeecc---ecc------------aaadcbabcfhddccba------qd-----------irw.................++e--.++e-----mhmijddda--------ahhfiokhedeg
784 (PID.TID 0000.0001) // 26 adhfca-----bfiv.............................++sy...................+tq-fdbblknqiheddefhiksz++++........zkhfdccb---ccb------------aabdcaaaacfddbca-------xfa-abb-----vvv...................+wa-..+wa---mlmkijhc----------cjjffiheb-aa
785 (PID.TID 0000.0001) // 25 achfa------ch+..................w.....w.......njo+................+x-----bcgiqqojfefiiiijmy.++.........zkhfdbaa---baa-------daa---acccaaaacccca--------a+udaabbb----tei...................++qd..++qdeqnghiljcaaaaidaa----beedeeca--b
786 (PID.TID 0000.0001) // 24 aeifa--acbcei...................w.....w.......likn+.....++.....++znpa----bbdfnlmnjhinlksssw............qhfeca-----a--------addc--aeffaaaaaaccb-a----a--b++udbbaba---ven....................++x...++xywnfgllcbbabegkecba----ddddcaacd
787 (PID.TID 0000.0001) // 23 bfida-aabchjk...................zz....zz.....nhhijz....tqq.....+ujgzgd---abccegklkkknols..xuu..........zgfdba-----a--------bcd---affaaadffabbb-----aa-bc+.+ufb-----l.gx...........s.........++....++zzkfilfccccoz..ulkcd---bccnfdddd
788 (PID.TID 0000.0001) // 22 afhfaa---bfgi....................zz..r.zz..rnjffggm...nlmn+....+sffzya--aabcaaffdfhimrmp...yuu.++.......zudba-----a--------adc---dda-adffe-aa--------aaa...+ufc-baaqvhh..........dcfeeh......+.....++zggqvifefhz......zobbaccfwuffee
789 (PID.TID 0000.0001) // 21 abcgca----abe.....................ysst..ysstlgeeeeoz..ijklt+....lfjzzf---adfdaadcehllotq....yy+++zzs.....+zcba----ba-------cdd--aaa----df------------aaa....+upjdcy.vohq.......+idcdfeeefwz...fwz....+hhn.vklox.........gdccfjwrigff
790 (PID.TID 0000.0001) // 20 bbbcgfcaa-aae+.......................l.....lcgfdddhq.+hiilnz++.+oquxyz--adgkcaabcfmtooyxz......+yuiiy....++gb-----b--------ddcca-a-----acbaa------bbaaaa.......ywxy.lulo.lv...kcdgddffefffilyxffilyx+fffk.+xyyy.........mgeimvskjkll
791 (PID.TID 0000.0001) // 19 mfeccdghfeegcbt......................a.....aafifccgnrzgghjry.+++sr+lq.--edfkxtkblwnnsp.vv......skhggt...+++t---------------bdaf---------edd-------adlaaa..........vnhzy.tllqiedccdhggfggffiiggffiiggfcbdgy..yz..........xigqophijkki
792 (PID.TID 0000.0001) // 18 .wifedfkhfegbbcivlqfoz..............ja....jaacfihggokeeffgt..++++..hhlfdeddk..qcz+.zwxtsttz..ysrkhot++++++zig-----g--------b--f---------egqqqaa----frb--........+kkrhw.vqmlnieddcdehgggffgigedfgigedbaaceiy.............zilrddefikkh
793 (PID.TID 0000.0001) // 17 .+wfeefikhgcbbccaaacgn.............ica...icaaccfihfoedddeedy..++...nnqwgfeeky.z++..+zsjjllllljllpjos+++.+zhhi-----i-----e-----ea--------foqqoqqo--hlwgea........+nk+..xiioonhfefddegihhghigfdbhigfdbaaabdgx..............nheddefiklh
794 (PID.TID 0000.0001) // 16 ...wiheddeccdfhfbabdfl............jdba..jdbaddddgifkccccdccd+.++..++ynvz.tkkmu....++zyslllllkhggkmpy++...ihhi-----i-----ea---feb-----a-acnoohfghknvmwnuc.........qhu..hhhkojgffgeefghihhiieedbiieedbaaabcdy..............ygddeghiljg
795 (PID.TID 0000.0001) // 15 .....ylea--acfihebcbbes..........sfcbb.sfcbbngfffigcaaabdbcac+.+++++zgmpx...mm....++..zslwz.yhhhhnz+++...rhgc----ac----ab----ige----acaaalllkddfiy..yswx.........thk.xgghiligfghfefhhhhiiheedciheedcdbbabdmz.............zfdeghikkif
796 (PID.TID 0000.0001) // 14 .......c---acgkhdcc--di..........ofddc.ofddchohffikaaaaabaaa-aw+.+ysnggox++.qrv..........yzzzzrjil+++....qhgd-----d-----a-----i---cccdeabkklldinqssy..xx..........+y.uhghikihgfghefgihhhgeeeeegeeeeeddbaadhw.............nedeghjjhfe
797 (PID.TID 0000.0001) // 13 ......+b----cfkhec---afz.........nhfdf.nhfdffholghkaaaaaba-a---flkkuswyy++++zr...........zzzzz++ry++......yd--------------------aeecdeidfkkqnqlmqquukqqm.............iihiijjhfefgefhjihiffgggfffgggffecaabelx...........zjecehijhfec
798 (PID.TID 0000.0001) // 12 ......ec----chjhec---ag..........skiqd.skiqddeiiiifaaabae--a---dd--iu+++.+++q++..........+z+++++.+++....++.s------------------a-ceccdejhlllkqlkklssiccde............wjkkkjjjigeefffgjiiighiiihghiiihhhdaabdffghtxx......mfccehjiffdb
799 (PID.TID 0000.0001) // 11 .....pdca--achlheba--ai..........nkn.f.nkn.fdemijidaaaabi-------a--q+....++.is...........+++++..........+yyza----ba----b-----a--ccccddkhieekkossssfbbbbc...........njjijhhihijhgggggjjjjijkkkkijkkkkjjhcaacddeegpy.....xfdccdhjgfdda
800 (PID.TID 0000.0001) // 10 .....wfdb--achlhea---an.........uos..duos..dcemikkfdcaabi-------equ+........k...........................zyvuq----cq----cc----a---dcfhkopqjeissrnpfbbcccd.........zslihhigghgijjihhhhkllkkkkkkjkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddca
801 (PID.TID 0000.0001) // 9 .....vgec---bfikca--cjl+.......+nnv.+cnnv.+ccffhkkiddaadha-----as++.........vz++........................zxuuk-----k------a---a----djmqrrnlllsoiddcccccdj........+zjijhfgfggffhjkkkiillljihhghgihhghgihighdeeffgghimnnjgecbbcdgfeccba
802 (PID.TID 0000.0001) // 8 ....zleca---afjfca--hdfz.......vkky.jckky.jceddefijffdddhb--a-afv...........n..ss.........................+yku----ku--------------ejnpqqnninnritqdccchkm.......wihgghgeffffeefhijkjkljiigeeffegeeffefffhjhhikkklljklmhffeeeggfdcbaay
803 (PID.TID 0000.0001) // 7 ..+zohec--abcfkhecbchbdx.......qiht.faiht.faaaabdgijgfededcdcb-f+...........n...pz.........................+zu----zu--------------edefqgqddsz+......+yudm+....tiggfggfeeeefeeefiiiijkiihheddddheddddddddjjllliijhfkmmkkjjhijgdcba--q
804 (PID.TID 0000.0001) // 6 .+yomfddcaabefkifdchaadt......uqdeisc-deisc----dfefgifffkklldc--v...........p...pp.........................v.x----.x---------a----fbbpqgzenx+........zdbllkhhfffffffgfeeeeeeeefhhhhijihhffddcbffddcbbbbdhhiihedddb-cfhhhjjjieca----+
805 (PID.TID 0000.0001) // 5 .+nhgffkghccfhkhffgdaackz....uoibcimlabcimlaaacfbddfjjhijeehf-a-c...........s...su.........................qk.yi--k.yi-------gha-fjddqs+xkrz.........q-bikdccdeeeeeeedddedddddgghhhhjhhgffcbbaffcbbaaaaddfegecca----dfeefhfgdb-----+
806 (PID.TID 0000.0001) // 4 +ujhgfllfhdffhkfffca-aady...llnabdopfcbdopfcbdgdbcdehlihgfddc--ms..........................................okn.zd-kn.zd---eciiiicfkeeqy.ysz..........n-agdcbbdeddedcdcccdddcddffggghiggfffdbaaffdbaa---acdcccba--abvfedeffdcca----b+
807 (PID.TID 0000.0001) // 3 vjggfcceeffffjlkjgaa---bfvheeln-aesphfaesphfdhgabddeflihhgfecbaaayq+++++...................................kqnz.vtqnz.vtpkllgdccfkkkkk..++..........+g--ecaaadcdddcbbbbcdddcccdffffghgffffdcaaffdcaa----abcaaaa-acxxmecdjmdbba----r+
808 (PID.TID 0000.0001) // 2 ifeecbbccddefilihecbaacbaajfega-aesqhfaesqhffiea-cdeflkkljifeddcba---bry+.................................vkqn+.sgqn+.sghfcbcbbbdgfdek.++++.........+l--aaaaaccdccbaaabbddddccdffffghfeeeeecbaeeecba------baaaa-euwxqdbcdkud-----sy+
809 (PID.TID 0000.0001) // 1 bbbbaaaaaccdfhlhfefdcccaabjefbaaafonhgafonhglid--adfgkkkklkhffddca-----s++++..............................xsrxz.terxz.tedcbbbbaaadddet.++++.........+l----a-accddba--bbbddddccdfffhhgfeeddccbaddccba-------aaaabgns.qcbcchyzqngll++.
810 (PID.TID 0000.0001) // 0 aaaaaaa-aacccfikkhecccbbbaaabaadfkllilfkllilmgebaadfijjiiikjhffdcba-----lllg............................++..u+..zmu+..zmdfbd---a-aeef.xx+..........+++s-----accdcb---bbbcdddddefffggfeeedcccbbdcccbba----aa--alrwwy.kcbccc+...++++..
811 (PID.TID 0000.0001) // -1 -aaaaa----aacffiljgfffcca--adfikkiikimkiikimiiheccfurkiffhijjigfecb-----l---............................+++++.z+.w+.z+.wqgbf-------dgzpoy+........+ys+yr-aa-abcccb---bbbbddddeffflhfeeeecbbcbbcbbcbbaa----a--bdflm.yuibbcc.......+..
812 (PID.TID 0000.0001) // -2 -aaa-------acdefinmlgiieb-chnnnmlmlfkllmlfklklkhednwwsheeghhijjgfdca----g---............................+++++wmu+++wmu++ywn--------fwvmgy+........+r-.++abc--abbbb---abaaddddeedkmeddefdbbbdcbbbbdcbaa-------ba-hv.susfbcc.......+..
813 (PID.TID 0000.0001) // =======================================================
814 (PID.TID 0000.0001) // END OF FIELD =
815 (PID.TID 0000.0001) // =======================================================
816 (PID.TID 0000.0001)
817 (PID.TID 0000.0001) // =======================================================
818 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc) at iteration 1
819 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
820 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
821 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
822 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
823 (PID.TID 0000.0001) // 0.0: .
824 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
825 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
826 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
827 (PID.TID 0000.0001) // =======================================================
828 (PID.TID 0000.0001) // =======================================================
829 (PID.TID 0000.0001) // END OF FIELD =
830 (PID.TID 0000.0001) // =======================================================
831 (PID.TID 0000.0001)
832 (PID.TID 0000.0001) // =======================================================
833 (PID.TID 0000.0001) // Field hFacC at iteration 1
834 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
835 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
836 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
837 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
838 (PID.TID 0000.0001) // 0.0: .
839 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
840 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
841 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
842 (PID.TID 0000.0001) // =======================================================
843 (PID.TID 0000.0001) // =======================================================
844 (PID.TID 0000.0001) // END OF FIELD =
845 (PID.TID 0000.0001) // =======================================================
846 (PID.TID 0000.0001)
847 (PID.TID 0000.0001) // =======================================================
848 (PID.TID 0000.0001) // Field hFacW at iteration 1
849 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
850 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
851 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
852 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
853 (PID.TID 0000.0001) // 0.0: .
854 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
855 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
856 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
857 (PID.TID 0000.0001) // =======================================================
858 (PID.TID 0000.0001) // =======================================================
859 (PID.TID 0000.0001) // END OF FIELD =
860 (PID.TID 0000.0001) // =======================================================
861 (PID.TID 0000.0001)
862 (PID.TID 0000.0001) // =======================================================
863 (PID.TID 0000.0001) // Field hFacS at iteration 1
864 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
865 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
866 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
867 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
868 (PID.TID 0000.0001) // 0.0: .
869 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
870 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
871 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
872 (PID.TID 0000.0001) // =======================================================
873 (PID.TID 0000.0001) // =======================================================
874 (PID.TID 0000.0001) // END OF FIELD =
875 (PID.TID 0000.0001) // =======================================================
876 (PID.TID 0000.0001)
877 (PID.TID 0000.0001)
878 (PID.TID 0000.0001) // ===================================
879 (PID.TID 0000.0001) // GAD parameters :
880 (PID.TID 0000.0001) // ===================================
881 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
882 (PID.TID 0000.0001) 2
883 (PID.TID 0000.0001) ;
884 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
885 (PID.TID 0000.0001) 2
886 (PID.TID 0000.0001) ;
887 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
888 (PID.TID 0000.0001) F
889 (PID.TID 0000.0001) ;
890 (PID.TID 0000.0001) AdamsBashforthGt = /* apply Adams-Bashforth extrapolation on Gt */
891 (PID.TID 0000.0001) T
892 (PID.TID 0000.0001) ;
893 (PID.TID 0000.0001) AdamsBashforth_T = /* apply Adams-Bashforth extrapolation on Temp */
894 (PID.TID 0000.0001) F
895 (PID.TID 0000.0001) ;
896 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
897 (PID.TID 0000.0001) 2
898 (PID.TID 0000.0001) ;
899 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
900 (PID.TID 0000.0001) 2
901 (PID.TID 0000.0001) ;
902 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
903 (PID.TID 0000.0001) F
904 (PID.TID 0000.0001) ;
905 (PID.TID 0000.0001) AdamsBashforthGs = /* apply Adams-Bashforth extrapolation on Gs */
906 (PID.TID 0000.0001) T
907 (PID.TID 0000.0001) ;
908 (PID.TID 0000.0001) AdamsBashforth_S = /* apply Adams-Bashforth extrapolation on Salt */
909 (PID.TID 0000.0001) F
910 (PID.TID 0000.0001) ;
911 (PID.TID 0000.0001) // ===================================
912 (PID.TID 0000.0001) ------------------------------------------------------------
913 (PID.TID 0000.0001) DIAGNOSTICS_SET_LEVELS: done
914 (PID.TID 0000.0001) Total Nb of available Diagnostics: ndiagt= 198
915 (PID.TID 0000.0001) write list of available Diagnostics to file: available_diagnostics.log
916 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 23 ETAN
917 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 24 ETANSQ
918 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 25 DETADT2
919 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 67 PHIBOT
920 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 68 PHIBOTSQ
921 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 71 oceTAUX
922 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 72 oceTAUY
923 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 84 TFLUX
924 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 85 SFLUX
925 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 79 oceFreez
926 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 80 TRELAX
927 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 81 SRELAX
928 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 30 UVEL
929 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 31 VVEL
930 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 32 WVEL
931 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 65 PHIHYD
932 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 44 VVELMASS
933 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 43 UVELMASS
934 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 38 WVELSQ
935 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 26 THETA
936 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 46 UTHMASS
937 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 47 VTHMASS
938 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 48 WTHMASS
939 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 27 SALT
940 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 49 USLTMASS
941 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 50 VSLTMASS
942 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 51 WSLTMASS
943 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 181 SI_Fract
944 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 182 SI_Thick
945 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
946 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 183 SI_SnowH
947 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
948 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 184 SI_Tsrf
949 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
950 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 185 SI_Tice1
951 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
952 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 186 SI_Tice2
953 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
954 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 187 SI_Qice1
955 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
956 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 188 SI_Qice2
957 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
958 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 190 SIsnwAge
959 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 191 SIsnwPrc
960 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
961 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 189 SIalbedo
962 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
963 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 194 SIflx2oc
964 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 195 SIfrw2oc
965 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 196 SIsaltFx
966 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 192 SIflxAtm
967 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 193 SIfrwAtm
968 (PID.TID 0000.0001) space allocated for all diagnostics: 429 levels
969 (PID.TID 0000.0001) set mate pointer for diag # 30 UVEL , Parms: UU 031MR
970 (PID.TID 0000.0001) set mate pointer for diag # 31 VVEL , Parms: VV 030MR
971 (PID.TID 0000.0001) set mate pointer for diag # 44 VVELMASS , Parms: VV 043MR
972 (PID.TID 0000.0001) set mate pointer for diag # 43 UVELMASS , Parms: UU 044MR
973 (PID.TID 0000.0001) set mate pointer for diag # 46 UTHMASS , Parms: UU 047MR
974 (PID.TID 0000.0001) set mate pointer for diag # 47 VTHMASS , Parms: VV 046MR
975 (PID.TID 0000.0001) set mate pointer for diag # 49 USLTMASS , Parms: UU 050MR
976 (PID.TID 0000.0001) set mate pointer for diag # 50 VSLTMASS , Parms: VV 049MR
977 (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: Set levels for Outp.Stream: dynDiag
978 (PID.TID 0000.0001) Levels: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15.
979 (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: Set levels for Outp.Stream: thSIceDiag
980 (PID.TID 0000.0001) Levels: 1.
982 (PID.TID 0000.0001) ------------------------------------------------------------
983 DIAGSTATS_SET_REGIONS: start reading region-mask file: regMask_lat24.bin
984 DIAGSTATS_SET_REGIONS: reading set k= 1
985 (PID.TID 0000.0001) MDSREADFIELD: opening global file: regMask_lat24.bin
986 DIAGSTATS_SET_REGIONS: set k= 1 <= done
987 (PID.TID 0000.0001) DIAGSTATS_SET_REGIONS: define 3 regions: 1 2 3
988 (PID.TID 0000.0001) ------------------------------------------------------------
989 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 23 ETAN
990 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 30 UVEL
991 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 31 VVEL
992 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 32 WVEL
993 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 26 THETA
994 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 27 SALT
995 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 70 CONVADJ
996 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 25 DETADT2
997 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 181 SI_Fract
998 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 182 SI_Thick
999 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1000 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 183 SI_SnowH
1001 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1002 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 184 SI_Tsrf
1003 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1004 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 185 SI_Tice1
1005 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1006 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 186 SI_Tice2
1007 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1008 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 187 SI_Qice1
1009 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
1010 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 188 SI_Qice2
1011 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
1012 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 191 SIsnwPrc
1013 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1014 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 189 SIalbedo
1015 (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1016 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 190 SIsnwAge
1017 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 194 SIflx2oc
1018 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 195 SIfrw2oc
1019 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 196 SIsaltFx
1020 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 192 SIflxAtm
1021 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 193 SIfrwAtm
1022 (PID.TID 0000.0001) space allocated for all stats-diags: 108 levels
1023 (PID.TID 0000.0001) DIAGSTATS_SET_POINTERS: done
1024 (PID.TID 0000.0001) ------------------------------------------------------------
1025 (PID.TID 0000.0001) DIAGSTATS_INI_IO: open file: dynStDiag.0000036000.txt , unit= 9
1026 (PID.TID 0000.0001) DIAGSTATS_INI_IO: open file: thSIceStDiag.0000036000.txt , unit= 10
1027 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
1028 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
1029 (PID.TID 0000.0001) F
1030 (PID.TID 0000.0001) ;
1031 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
1032 (PID.TID 0000.0001) F
1033 (PID.TID 0000.0001) ;
1034 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
1035 (PID.TID 0000.0001) F
1036 (PID.TID 0000.0001) ;
1037 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity ( m^2/s ) */
1038 (PID.TID 0000.0001) 8.000000000000000E+02
1039 (PID.TID 0000.0001) ;
1040 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity ( m^2/s ) */
1041 (PID.TID 0000.0001) 8.000000000000000E+02
1042 (PID.TID 0000.0001) ;
1043 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity ( m^2/s ) */
1044 (PID.TID 0000.0001) 0.000000000000000E+00
1045 (PID.TID 0000.0001) ;
1046 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. ( ) */
1047 (PID.TID 0000.0001) 0.000000000000000E+00
1048 (PID.TID 0000.0001) ;
1049 (PID.TID 0000.0001) Tapering/Cliping : gkw91
1050 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
1051 (PID.TID 0000.0001) 1.000000000000000E-12
1052 (PID.TID 0000.0001) ;
1053 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
1054 (PID.TID 0000.0001) 1.000000000000000E+48
1055 (PID.TID 0000.0001) ;
1056 (PID.TID 0000.0001) %MON fCori_max = 1.4535016908525E-04
1057 (PID.TID 0000.0001) %MON fCori_min = -1.4535016908525E-04
1058 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
1059 (PID.TID 0000.0001) %MON fCori_sd = 8.3972192788621E-05
1060 (PID.TID 0000.0001) %MON fCoriG_max = 1.4544410433286E-04
1061 (PID.TID 0000.0001) %MON fCoriG_min = -1.4544410433286E-04
1062 (PID.TID 0000.0001) %MON fCoriG_mean = 0.0000000000000E+00
1063 (PID.TID 0000.0001) %MON fCoriG_sd = 8.4860812167727E-05
1064 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4540341538469E-04
1065 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2264550201501E-06
1066 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1482595466044E-04
1067 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0292878037194E-05
1068 (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
1069 (PID.TID 0000.0001) INI_CG2D: cg2dTolerance = 5.809016360175293E-07 (Area=3.6388673751E+14)
1070 (PID.TID 0000.0001)
1071 (PID.TID 0000.0001) CONFIG_CHECK: OK
1072 (PID.TID 0000.0001) // =======================================================
1073 (PID.TID 0000.0001) // Model configuration
1074 (PID.TID 0000.0001) // =======================================================
1075 (PID.TID 0000.0001) //
1076 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
1077 (PID.TID 0000.0001) //
1078 (PID.TID 0000.0001) buoyancyRelation = OCEANIC
1079 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
1080 (PID.TID 0000.0001) F
1081 (PID.TID 0000.0001) ;
1082 (PID.TID 0000.0001) fluidIsWater= /* fluid major constituent is Water */
1083 (PID.TID 0000.0001) T
1084 (PID.TID 0000.0001) ;
1085 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
1086 (PID.TID 0000.0001) F
1087 (PID.TID 0000.0001) ;
1088 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
1089 (PID.TID 0000.0001) T
1090 (PID.TID 0000.0001) ;
1091 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or K ) */
1092 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
1093 (PID.TID 0000.0001) ;
1094 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( psu ) */
1095 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
1096 (PID.TID 0000.0001) ;
1097 (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
1098 (PID.TID 0000.0001) 3.000000000000000E+05
1099 (PID.TID 0000.0001) ;
1100 (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
1101 (PID.TID 0000.0001) 1.000000000000000E+21
1102 (PID.TID 0000.0001) ;
1103 (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
1104 (PID.TID 0000.0001) 0.000000000000000E+00
1105 (PID.TID 0000.0001) ;
1106 (PID.TID 0000.0001) useFullLeith = /* Use Full Form of Leith Viscosity on/off flag*/
1107 (PID.TID 0000.0001) F
1108 (PID.TID 0000.0001) ;
1109 (PID.TID 0000.0001) useStrainTensionVisc = /* Use StrainTension Form of Viscous Operator on/off flag*/
1110 (PID.TID 0000.0001) F
1111 (PID.TID 0000.0001) ;
1112 (PID.TID 0000.0001) useAreaViscLength = /* Use area for visc length instead of geom. mean*/
1113 (PID.TID 0000.0001) F
1114 (PID.TID 0000.0001) ;
1115 (PID.TID 0000.0001) viscC2leith = /* Leith harmonic visc. factor (on grad(vort),non-dim.) */
1116 (PID.TID 0000.0001) 0.000000000000000E+00
1117 (PID.TID 0000.0001) ;
1118 (PID.TID 0000.0001) viscC2leithD = /* Leith harmonic viscosity factor (on grad(div),non-dim.) */
1119 (PID.TID 0000.0001) 0.000000000000000E+00
1120 (PID.TID 0000.0001) ;
1121 (PID.TID 0000.0001) viscC2smag = /* Smagorinsky harmonic viscosity factor (non-dim.) */
1122 (PID.TID 0000.0001) 0.000000000000000E+00
1123 (PID.TID 0000.0001) ;
1124 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
1125 (PID.TID 0000.0001) 0.000000000000000E+00
1126 (PID.TID 0000.0001) ;
1127 (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
1128 (PID.TID 0000.0001) 1.000000000000000E+21
1129 (PID.TID 0000.0001) ;
1130 (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
1131 (PID.TID 0000.0001) 0.000000000000000E+00
1132 (PID.TID 0000.0001) ;
1133 (PID.TID 0000.0001) viscC4leith = /* Leith biharm viscosity factor (on grad(vort), non-dim.) */
1134 (PID.TID 0000.0001) 0.000000000000000E+00
1135 (PID.TID 0000.0001) ;
1136 (PID.TID 0000.0001) viscC4leithD = /* Leith biharm viscosity factor (on grad(div), non-dim.) */
1137 (PID.TID 0000.0001) 0.000000000000000E+00
1138 (PID.TID 0000.0001) ;
1139 (PID.TID 0000.0001) viscC4Smag = /* Smagorinsky biharm viscosity factor (non-dim) */
1140 (PID.TID 0000.0001) 0.000000000000000E+00
1141 (PID.TID 0000.0001) ;
1142 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
1143 (PID.TID 0000.0001) T
1144 (PID.TID 0000.0001) ;
1145 (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
1146 (PID.TID 0000.0001) 2.000000000000000E+00
1147 (PID.TID 0000.0001) ;
1148 (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
1149 (PID.TID 0000.0001) 1.000000000000000E-03
1150 (PID.TID 0000.0001) ;
1151 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
1152 (PID.TID 0000.0001) T
1153 (PID.TID 0000.0001) ;
1154 (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( 1/s ) */
1155 (PID.TID 0000.0001) 0.000000000000000E+00
1156 (PID.TID 0000.0001) ;
1157 (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coeff. ( 1/m ) */
1158 (PID.TID 0000.0001) 0.000000000000000E+00
1159 (PID.TID 0000.0001) ;
1160 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
1161 (PID.TID 0000.0001) 0.000000000000000E+00
1162 (PID.TID 0000.0001) ;
1163 (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
1164 (PID.TID 0000.0001) 0.000000000000000E+00
1165 (PID.TID 0000.0001) ;
1166 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
1167 (PID.TID 0000.0001) 0.000000000000000E+00
1168 (PID.TID 0000.0001) ;
1169 (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
1170 (PID.TID 0000.0001) 0.000000000000000E+00
1171 (PID.TID 0000.0001) ;
1172 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
1173 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
1174 (PID.TID 0000.0001) ;
1175 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
1176 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
1177 (PID.TID 0000.0001) ;
1178 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 1979 ( m^2/s ) */
1179 (PID.TID 0000.0001) 0.000000000000000E+00
1180 (PID.TID 0000.0001) ;
1181 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
1182 (PID.TID 0000.0001) 0.000000000000000E+00
1183 (PID.TID 0000.0001) ;
1184 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
1185 (PID.TID 0000.0001) 2.000000000000000E+02
1186 (PID.TID 0000.0001) ;
1187 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
1188 (PID.TID 0000.0001) -2.000000000000000E+03
1189 (PID.TID 0000.0001) ;
1190 (PID.TID 0000.0001) Equation of State : eosType = JMD95Z ;
1191 (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/oC ) */
1192 (PID.TID 0000.0001) 1.234567000000000E+05
1193 (PID.TID 0000.0001) ;
1194 (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/psu ) */
1195 (PID.TID 0000.0001) 1.234567000000000E+05
1196 (PID.TID 0000.0001) ;
1197 (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
1198 (PID.TID 0000.0001) 1.035000000000000E+03
1199 (PID.TID 0000.0001) ;
1200 (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
1201 (PID.TID 0000.0001) 1.035000000000000E+03
1202 (PID.TID 0000.0001) ;
1203 (PID.TID 0000.0001) rhoFacC = /* normalized Reference density @ cell-Center (-) */
1204 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1205 (PID.TID 0000.0001) ;
1206 (PID.TID 0000.0001) rhoFacF = /* normalized Reference density @ W-Interface (-) */
1207 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1208 (PID.TID 0000.0001) ;
1209 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
1210 (PID.TID 0000.0001) 1.000000000000000E+03
1211 (PID.TID 0000.0001) ;
1212 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
1213 (PID.TID 0000.0001) 9.810000000000000E+00
1214 (PID.TID 0000.0001) ;
1215 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
1216 (PID.TID 0000.0001) 9.810000000000000E+00
1217 (PID.TID 0000.0001) ;
1218 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
1219 (PID.TID 0000.0001) 8.640000000000000E+04
1220 (PID.TID 0000.0001) ;
1221 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
1222 (PID.TID 0000.0001) 7.272205216643040E-05
1223 (PID.TID 0000.0001) ;
1224 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
1225 (PID.TID 0000.0001) 1.000000000000000E-04
1226 (PID.TID 0000.0001) ;
1227 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
1228 (PID.TID 0000.0001) 9.999999999999999E-12
1229 (PID.TID 0000.0001) ;
1230 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
1231 (PID.TID 0000.0001) 1.000000000000000E+00
1232 (PID.TID 0000.0001) ;
1233 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
1234 (PID.TID 0000.0001) T
1235 (PID.TID 0000.0001) ;
1236 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
1237 (PID.TID 0000.0001) F
1238 (PID.TID 0000.0001) ;
1239 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
1240 (PID.TID 0000.0001) 1.000000000000000E+00
1241 (PID.TID 0000.0001) ;
1242 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
1243 (PID.TID 0000.0001) 1.000000000000000E+00
1244 (PID.TID 0000.0001) ;
1245 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
1246 (PID.TID 0000.0001) T
1247 (PID.TID 0000.0001) ;
1248 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
1249 (PID.TID 0000.0001) T
1250 (PID.TID 0000.0001) ;
1251 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
1252 (PID.TID 0000.0001) 4
1253 (PID.TID 0000.0001) ;
1254 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
1255 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
1256 (PID.TID 0000.0001) 2.000000000000000E-01
1257 (PID.TID 0000.0001) ;
1258 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
1259 (PID.TID 0000.0001) 2.000000000000000E+00
1260 (PID.TID 0000.0001) ;
1261 (PID.TID 0000.0001) select_rStar = /* r* Coordinate options (not yet implemented)*/
1262 (PID.TID 0000.0001) 2
1263 (PID.TID 0000.0001) ;
1264 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
1265 (PID.TID 0000.0001) T
1266 (PID.TID 0000.0001) ;
1267 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
1268 (PID.TID 0000.0001) 1.234567000000000E+05
1269 (PID.TID 0000.0001) ;
1270 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(ppt)*/
1271 (PID.TID 0000.0001) 0.000000000000000E+00
1272 (PID.TID 0000.0001) ;
1273 (PID.TID 0000.0001) use3Dsolver = /* use 3-D pressure solver on/off flag */
1274 (PID.TID 0000.0001) F
1275 (PID.TID 0000.0001) ;
1276 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
1277 (PID.TID 0000.0001) F
1278 (PID.TID 0000.0001) ;
1279 (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
1280 (PID.TID 0000.0001) 1.000000000000000E+00
1281 (PID.TID 0000.0001) ;
1282 (PID.TID 0000.0001) quasiHydrostatic = /* Quasi-Hydrostatic on/off flag */
1283 (PID.TID 0000.0001) F
1284 (PID.TID 0000.0001) ;
1285 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
1286 (PID.TID 0000.0001) T
1287 (PID.TID 0000.0001) ;
1288 (PID.TID 0000.0001) vectorInvariantMomentum= /* Vector-Invariant Momentum on/off */
1289 (PID.TID 0000.0001) T
1290 (PID.TID 0000.0001) ;
1291 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
1292 (PID.TID 0000.0001) T
1293 (PID.TID 0000.0001) ;
1294 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
1295 (PID.TID 0000.0001) T
1296 (PID.TID 0000.0001) ;
1297 (PID.TID 0000.0001) momImplVertAdv =/* Momentum implicit vert. advection on/off*/
1298 (PID.TID 0000.0001) F
1299 (PID.TID 0000.0001) ;
1300 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
1301 (PID.TID 0000.0001) F
1302 (PID.TID 0000.0001) ;
1303 (PID.TID 0000.0001) metricTerms = /* metric-Terms on/off flag */
1304 (PID.TID 0000.0001) F
1305 (PID.TID 0000.0001) ;
1306 (PID.TID 0000.0001) useNHMTerms = /* Non-Hydrostatic Metric-Terms on/off */
1307 (PID.TID 0000.0001) F
1308 (PID.TID 0000.0001) ;
1309 (PID.TID 0000.0001) useConstantF = /* use Constant f0 Coriolis flag */
1310 (PID.TID 0000.0001) F
1311 (PID.TID 0000.0001) ;
1312 (PID.TID 0000.0001) useBetaPlaneF = /* use Beta-Plane Coriolis flag */
1313 (PID.TID 0000.0001) F
1314 (PID.TID 0000.0001) ;
1315 (PID.TID 0000.0001) useSphereF = /* use Spherical Coriolis flag */
1316 (PID.TID 0000.0001) T
1317 (PID.TID 0000.0001) ;
1318 (PID.TID 0000.0001) use3dCoriolis = /* 3-D Coriolis on/off flag */
1319 (PID.TID 0000.0001) F
1320 (PID.TID 0000.0001) ;
1321 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
1322 (PID.TID 0000.0001) T
1323 (PID.TID 0000.0001) ;
1324 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
1325 (PID.TID 0000.0001) F
1326 (PID.TID 0000.0001) ;
1327 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
1328 (PID.TID 0000.0001) F
1329 (PID.TID 0000.0001) ;
1330 (PID.TID 0000.0001) useJamartMomAdv= /* V.I. Non-linear terms Jamart flag */
1331 (PID.TID 0000.0001) F
1332 (PID.TID 0000.0001) ;
1333 (PID.TID 0000.0001) SadournyCoriolis= /* Sadourny Coriolis discr. flag */
1334 (PID.TID 0000.0001) F
1335 (PID.TID 0000.0001) ;
1336 (PID.TID 0000.0001) upwindVorticity= /* Upwind bias vorticity flag */
1337 (PID.TID 0000.0001) F
1338 (PID.TID 0000.0001) ;
1339 (PID.TID 0000.0001) useAbsVorticity= /* Work with f+zeta in Coriolis */
1340 (PID.TID 0000.0001) F
1341 (PID.TID 0000.0001) ;
1342 (PID.TID 0000.0001) highOrderVorticity= /* High order interp. of vort. flag */
1343 (PID.TID 0000.0001) F
1344 (PID.TID 0000.0001) ;
1345 (PID.TID 0000.0001) upwindShear= /* Upwind vertical Shear advection flag */
1346 (PID.TID 0000.0001) F
1347 (PID.TID 0000.0001) ;
1348 (PID.TID 0000.0001) selectKEscheme= /* Kinetic Energy scheme selector */
1349 (PID.TID 0000.0001) 0
1350 (PID.TID 0000.0001) ;
1351 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
1352 (PID.TID 0000.0001) T
1353 (PID.TID 0000.0001) ;
1354 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
1355 (PID.TID 0000.0001) T
1356 (PID.TID 0000.0001) ;
1357 (PID.TID 0000.0001) implicitIntGravWave= /* Implicit Internal Gravity Wave flag */
1358 (PID.TID 0000.0001) F
1359 (PID.TID 0000.0001) ;
1360 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
1361 (PID.TID 0000.0001) T
1362 (PID.TID 0000.0001) ;
1363 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
1364 (PID.TID 0000.0001) T
1365 (PID.TID 0000.0001) ;
1366 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
1367 (PID.TID 0000.0001) F
1368 (PID.TID 0000.0001) ;
1369 (PID.TID 0000.0001) implicitDiffusion =/* Implicit Diffusion on/off flag */
1370 (PID.TID 0000.0001) T
1371 (PID.TID 0000.0001) ;
1372 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
1373 (PID.TID 0000.0001) T
1374 (PID.TID 0000.0001) ;
1375 (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
1376 (PID.TID 0000.0001) T
1377 (PID.TID 0000.0001) ;
1378 (PID.TID 0000.0001) tempImplVertAdv =/* Temp. implicit vert. advection on/off */
1379 (PID.TID 0000.0001) F
1380 (PID.TID 0000.0001) ;
1381 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
1382 (PID.TID 0000.0001) T
1383 (PID.TID 0000.0001) ;
1384 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
1385 (PID.TID 0000.0001) T
1386 (PID.TID 0000.0001) ;
1387 (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
1388 (PID.TID 0000.0001) T
1389 (PID.TID 0000.0001) ;
1390 (PID.TID 0000.0001) saltImplVertAdv =/* Sali. implicit vert. advection on/off */
1391 (PID.TID 0000.0001) F
1392 (PID.TID 0000.0001) ;
1393 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
1394 (PID.TID 0000.0001) T
1395 (PID.TID 0000.0001) ;
1396 (PID.TID 0000.0001) readBinaryPrec = /* Precision used for reading binary files */
1397 (PID.TID 0000.0001) 64
1398 (PID.TID 0000.0001) ;
1399 (PID.TID 0000.0001) writeBinaryPrec = /* Precision used for writing binary files */
1400 (PID.TID 0000.0001) 32
1401 (PID.TID 0000.0001) ;
1402 (PID.TID 0000.0001) globalFiles = /* write "global" (=not per tile) files */
1403 (PID.TID 0000.0001) F
1404 (PID.TID 0000.0001) ;
1405 (PID.TID 0000.0001) useSingleCpuIO = /* only master MPI process does I/O */
1406 (PID.TID 0000.0001) F
1407 (PID.TID 0000.0001) ;
1408 (PID.TID 0000.0001) debugMode = /* Debug Mode on/off flag */
1409 (PID.TID 0000.0001) F
1410 (PID.TID 0000.0001) ;
1411 (PID.TID 0000.0001) debLevA = /* 1rst level of debugging */
1412 (PID.TID 0000.0001) 1
1413 (PID.TID 0000.0001) ;
1414 (PID.TID 0000.0001) debLevB = /* 2nd level of debugging */
1415 (PID.TID 0000.0001) 2
1416 (PID.TID 0000.0001) ;
1417 (PID.TID 0000.0001) debugLevel = /* select debugging level */
1418 (PID.TID 0000.0001) 1
1419 (PID.TID 0000.0001) ;
1420 (PID.TID 0000.0001) //
1421 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
1422 (PID.TID 0000.0001) //
1423 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
1424 (PID.TID 0000.0001) 200
1425 (PID.TID 0000.0001) ;
1426 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
1427 (PID.TID 0000.0001) 1
1428 (PID.TID 0000.0001) ;
1429 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
1430 (PID.TID 0000.0001) 1.000000000000000E-07
1431 (PID.TID 0000.0001) ;
1432 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
1433 (PID.TID 0000.0001) 1.000000000000000E-14
1434 (PID.TID 0000.0001) ;
1435 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
1436 (PID.TID 0000.0001) 1
1437 (PID.TID 0000.0001) ;
1438 (PID.TID 0000.0001) //
1439 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
1440 (PID.TID 0000.0001) //
1441 (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
1442 (PID.TID 0000.0001) 36000
1443 (PID.TID 0000.0001) ;
1444 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
1445 (PID.TID 0000.0001) 20
1446 (PID.TID 0000.0001) ;
1447 (PID.TID 0000.0001) deltaTmom = /* Momentum equation timestep ( s ) */
1448 (PID.TID 0000.0001) 1.200000000000000E+03
1449 (PID.TID 0000.0001) ;
1450 (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
1451 (PID.TID 0000.0001) 8.640000000000000E+04
1452 (PID.TID 0000.0001) ;
1453 (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
1454 (PID.TID 0000.0001) 15 @ 8.640000000000000E+04 /* K = 1: 15 */
1455 (PID.TID 0000.0001) ;
1456 (PID.TID 0000.0001) deltaTClock = /* Model clock timestep ( s ) */
1457 (PID.TID 0000.0001) 8.640000000000000E+04
1458 (PID.TID 0000.0001) ;
1459 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1460 (PID.TID 0000.0001) 0.000000000000000E+00
1461 (PID.TID 0000.0001) ;
1462 (PID.TID 0000.0001) momForcingOutAB = /* =1: take Momentum Forcing out of Adams-Bash. stepping */
1463 (PID.TID 0000.0001) 0
1464 (PID.TID 0000.0001) ;
1465 (PID.TID 0000.0001) tracForcingOutAB = /* =1: take T,S,pTr Forcing out of Adams-Bash. stepping */
1466 (PID.TID 0000.0001) 1
1467 (PID.TID 0000.0001) ;
1468 (PID.TID 0000.0001) momDissip_In_AB = /* put Dissipation Tendency in Adams-Bash. stepping */
1469 (PID.TID 0000.0001) T
1470 (PID.TID 0000.0001) ;
1471 (PID.TID 0000.0001) doAB_onGtGs = /* apply AB on Tendencies (rather than on T,S)*/
1472 (PID.TID 0000.0001) T
1473 (PID.TID 0000.0001) ;
1474 (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
1475 (PID.TID 0000.0001) 1.000000000000000E-01
1476 (PID.TID 0000.0001) ;
1477 (PID.TID 0000.0001) baseTime = /* Model base time ( s ). */
1478 (PID.TID 0000.0001) 0.000000000000000E+00
1479 (PID.TID 0000.0001) ;
1480 (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
1481 (PID.TID 0000.0001) 3.110400000000000E+09
1482 (PID.TID 0000.0001) ;
1483 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
1484 (PID.TID 0000.0001) 3.112128000000000E+09
1485 (PID.TID 0000.0001) ;
1486 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
1487 (PID.TID 0000.0001) 3.110400000000000E+07
1488 (PID.TID 0000.0001) ;
1489 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
1490 (PID.TID 0000.0001) 0.000000000000000E+00
1491 (PID.TID 0000.0001) ;
1492 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1493 (PID.TID 0000.0001) T
1494 (PID.TID 0000.0001) ;
1495 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1496 (PID.TID 0000.0001) T
1497 (PID.TID 0000.0001) ;
1498 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1499 (PID.TID 0000.0001) F
1500 (PID.TID 0000.0001) ;
1501 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1502 (PID.TID 0000.0001) 3.110400000000000E+07
1503 (PID.TID 0000.0001) ;
1504 (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1505 (PID.TID 0000.0001) T
1506 (PID.TID 0000.0001) ;
1507 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1508 (PID.TID 0000.0001) T
1509 (PID.TID 0000.0001) ;
1510 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1511 (PID.TID 0000.0001) 1.000000000000000E+00
1512 (PID.TID 0000.0001) ;
1513 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1514 (PID.TID 0000.0001) T
1515 (PID.TID 0000.0001) ;
1516 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1517 (PID.TID 0000.0001) 2.592000000000000E+06
1518 (PID.TID 0000.0001) ;
1519 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1520 (PID.TID 0000.0001) 3.110400000000000E+07
1521 (PID.TID 0000.0001) ;
1522 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1523 (PID.TID 0000.0001) 5.184000000000000E+06
1524 (PID.TID 0000.0001) ;
1525 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1526 (PID.TID 0000.0001) 1.555200000000000E+07
1527 (PID.TID 0000.0001) ;
1528 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1529 (PID.TID 0000.0001) 5.000000000000000E+01
1530 (PID.TID 0000.0001) ;
1531 (PID.TID 0000.0001) //
1532 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1533 (PID.TID 0000.0001) //
1534 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True/False ) */
1535 (PID.TID 0000.0001) F
1536 (PID.TID 0000.0001) ;
1537 (PID.TID 0000.0001) usingCylindricalGrid = /* Cylindrical coordinates flag ( True/False ) */
1538 (PID.TID 0000.0001) F
1539 (PID.TID 0000.0001) ;
1540 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True/False ) */
1541 (PID.TID 0000.0001) F
1542 (PID.TID 0000.0001) ;
1543 (PID.TID 0000.0001) usingCurvilinearGrid = /* Curvilinear coordinates flag ( True/False ) */
1544 (PID.TID 0000.0001) T
1545 (PID.TID 0000.0001) ;
1546 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r ) */
1547 (PID.TID 0000.0001) 0.000000000000000E+00
1548 (PID.TID 0000.0001) ;
1549 (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1550 (PID.TID 0000.0001) -1.000000000000000E+00
1551 (PID.TID 0000.0001) ;
1552 (PID.TID 0000.0001) gravitySign = /* gravity orientation relative to vertical coordinate */
1553 (PID.TID 0000.0001) -1.000000000000000E+00
1554 (PID.TID 0000.0001) ;
1555 (PID.TID 0000.0001) horiVertRatio = /* Ratio on units : Horiz - Vertical */
1556 (PID.TID 0000.0001) 1.000000000000000E+00
1557 (PID.TID 0000.0001) ;
1558 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1559 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1560 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1561 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1562 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1563 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1564 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1565 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1566 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1567 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1568 (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1569 (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1570 (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1571 (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1572 (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1573 (PID.TID 0000.0001) 6.650000000000000E+02 /* K = 15 */
1574 (PID.TID 0000.0001) ;
1575 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1576 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1577 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1578 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1579 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1580 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1581 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1582 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1583 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1584 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1585 (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1586 (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1587 (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1588 (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1589 (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1590 (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1591 (PID.TID 0000.0001) ;
1592 (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
1593 (PID.TID 0000.0001) 192 @ 1.234567000000000E+05 /* I = 1:192 */
1594 (PID.TID 0000.0001) ;
1595 (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
1596 (PID.TID 0000.0001) 32 @ 1.234567000000000E+05 /* J = 1: 32 */
1597 (PID.TID 0000.0001) ;
1598 (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
1599 (PID.TID 0000.0001) 0.000000000000000E+00
1600 (PID.TID 0000.0001) ;
1601 (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
1602 (PID.TID 0000.0001) 0.000000000000000E+00
1603 (PID.TID 0000.0001) ;
1604 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1605 (PID.TID 0000.0001) 6.370000000000000E+06
1606 (PID.TID 0000.0001) ;
1607 (PID.TID 0000.0001) deepAtmosphere = /* Deep/Shallow Atmosphere flag (True/False) */
1608 (PID.TID 0000.0001) F
1609 (PID.TID 0000.0001) ;
1610 (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
1611 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1612 (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1613 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1614 (PID.TID 0000.0001) -3.923446288487304E+01, /* I = 4 */
1615 (PID.TID 0000.0001) -3.702585158682200E+01, /* I = 5 */
1616 (PID.TID 0000.0001) -3.461179367094151E+01, /* I = 6 */
1617 (PID.TID 0000.0001) -3.200434569041793E+01, /* I = 7 */
1618 (PID.TID 0000.0001) -2.921355965632675E+01, /* I = 8 */
1619 (PID.TID 0000.0001) -2.624932223028290E+01, /* I = 9 */
1620 (PID.TID 0000.0001) -2.312261250426344E+01, /* I = 10 */
1621 (PID.TID 0000.0001) -1.984640717127058E+01, /* I = 11 */
1622 (PID.TID 0000.0001) -1.643630800555134E+01, /* I = 12 */
1623 (PID.TID 0000.0001) -1.291089806302069E+01, /* I = 13 */
1624 (PID.TID 0000.0001) -9.291807802719402E+00, /* I = 14 */
1625 (PID.TID 0000.0001) -5.603475335822332E+00, /* I = 15 */
1626 (PID.TID 0000.0001) -1.872608513033445E+00, /* I = 16 */
1627 (PID.TID 0000.0001) 1.872608513033445E+00, /* I = 17 */
1628 (PID.TID 0000.0001) 5.603475335822332E+00, /* I = 18 */
1629 (PID.TID 0000.0001) 9.291807802719402E+00, /* I = 19 */
1630 (PID.TID 0000.0001) 1.291089806302069E+01, /* I = 20 */
1631 (PID.TID 0000.0001) 1.643630800555134E+01, /* I = 21 */
1632 (PID.TID 0000.0001) 1.984640717127058E+01, /* I = 22 */
1633 (PID.TID 0000.0001) 2.312261250426344E+01, /* I = 23 */
1634 (PID.TID 0000.0001) 2.624932223028290E+01, /* I = 24 */
1635 (PID.TID 0000.0001) 2.921355965632675E+01, /* I = 25 */
1636 (PID.TID 0000.0001) 3.200434569041793E+01, /* I = 26 */
1637 (PID.TID 0000.0001) 3.461179367094151E+01, /* I = 27 */
1638 (PID.TID 0000.0001) 3.702585158682200E+01, /* I = 28 */
1639 (PID.TID 0000.0001) 3.923446288487304E+01, /* I = 29 */
1640 (PID.TID 0000.0001) 4.122055553388957E+01, /* I = 30 */
1641 (PID.TID 0000.0001) 4.295641272275883E+01, /* I = 31 */
1642 (PID.TID 0000.0001) 4.439521994760536E+01, /* I = 32 */
1643 (PID.TID 0000.0001) 4.560478005239464E+01, /* I = 33 */
1644 (PID.TID 0000.0001) 4.704358727724117E+01, /* I = 34 */
1645 (PID.TID 0000.0001) 4.877944446611043E+01, /* I = 35 */
1646 (PID.TID 0000.0001) 5.076553711512697E+01, /* I = 36 */
1647 (PID.TID 0000.0001) 5.297414841317801E+01, /* I = 37 */
1648 (PID.TID 0000.0001) 5.538820632905850E+01, /* I = 38 */
1649 (PID.TID 0000.0001) 5.799565430958209E+01, /* I = 39 */
1650 (PID.TID 0000.0001) 6.078644034367325E+01, /* I = 40 */
1651 (PID.TID 0000.0001) 6.375067776971711E+01, /* I = 41 */
1652 (PID.TID 0000.0001) 6.687738749573657E+01, /* I = 42 */
1653 (PID.TID 0000.0001) 7.015359282872943E+01, /* I = 43 */
1654 (PID.TID 0000.0001) 7.356369199444866E+01, /* I = 44 */
1655 (PID.TID 0000.0001) 7.708910193697932E+01, /* I = 45 */
1656 (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1657 (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1658 (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1659 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1660 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1661 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1662 (PID.TID 0000.0001) 1.029108980630207E+02, /* I = 52 */
1663 (PID.TID 0000.0001) 1.064363080055513E+02, /* I = 53 */
1664 (PID.TID 0000.0001) 1.098464071712706E+02, /* I = 54 */
1665 (PID.TID 0000.0001) 1.131226125042634E+02, /* I = 55 */
1666 (PID.TID 0000.0001) 1.162493222302829E+02, /* I = 56 */
1667 (PID.TID 0000.0001) 1.192135596563268E+02, /* I = 57 */
1668 (PID.TID 0000.0001) 1.220043456904179E+02, /* I = 58 */
1669 (PID.TID 0000.0001) 1.246117936709415E+02, /* I = 59 */
1670 (PID.TID 0000.0001) 1.270258515868220E+02, /* I = 60 */
1671 (PID.TID 0000.0001) 1.292344628848730E+02, /* I = 61 */
1672 (PID.TID 0000.0001) 1.312205555338896E+02, /* I = 62 */
1673 (PID.TID 0000.0001) 1.329564127227588E+02, /* I = 63 */
1674 (PID.TID 0000.0001) 1.343952199476053E+02, /* I = 64 */
1675 (PID.TID 0000.0001) 4.500000000000000E+01, /* I = 65 */
1676 (PID.TID 0000.0001) 4.620805468796297E+01, /* I = 66 */
1677 (PID.TID 0000.0001) 4.781369642513039E+01, /* I = 67 */
1678 (PID.TID 0000.0001) 4.971767671143929E+01, /* I = 68 */
1679 (PID.TID 0000.0001) 5.187738319787235E+01, /* I = 69 */
1680 (PID.TID 0000.0001) 5.427004371478710E+01, /* I = 70 */
1681 (PID.TID 0000.0001) 5.688128325334060E+01, /* I = 71 */
1682 (PID.TID 0000.0001) 5.970018167786760E+01, /* I = 72 */
1683 (PID.TID 0000.0001) 6.271654991792347E+01, /* I = 73 */
1684 (PID.TID 0000.0001) 6.591914604853015E+01, /* I = 74 */
1685 (PID.TID 0000.0001) 6.929439270484148E+01, /* I = 75 */
1686 (PID.TID 0000.0001) 7.282545807616151E+01, /* I = 76 */
1687 (PID.TID 0000.0001) 7.649168830618933E+01, /* I = 77 */
1688 (PID.TID 0000.0001) 8.026842803787176E+01, /* I = 78 */
1689 (PID.TID 0000.0001) 8.412726743124185E+01, /* I = 79 */
1690 (PID.TID 0000.0001) 8.803672008547504E+01, /* I = 80 */
1691 (PID.TID 0000.0001) 9.196327991452496E+01, /* I = 81 */
1692 (PID.TID 0000.0001) 9.587273256875815E+01, /* I = 82 */
1693 (PID.TID 0000.0001) 9.973157196212824E+01, /* I = 83 */
1694 (PID.TID 0000.0001) 1.035083116938107E+02, /* I = 84 */
1695 (PID.TID 0000.0001) 1.071745419238385E+02, /* I = 85 */
1696 (PID.TID 0000.0001) 1.107056072951585E+02, /* I = 86 */
1697 (PID.TID 0000.0001) 1.140808539514698E+02, /* I = 87 */
1698 (PID.TID 0000.0001) 1.172834500820765E+02, /* I = 88 */
1699 (PID.TID 0000.0001) 1.202998183221324E+02, /* I = 89 */
1700 (PID.TID 0000.0001) 1.231187167466594E+02, /* I = 90 */
1701 (PID.TID 0000.0001) 1.257299562852129E+02, /* I = 91 */
1702 (PID.TID 0000.0001) 1.281226168021277E+02, /* I = 92 */
1703 (PID.TID 0000.0001) 1.302823232885607E+02, /* I = 93 */
1704 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1705 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1706 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1707 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1708 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1709 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1710 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =100 */
1711 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =101 */
1712 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =102 */
1713 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =103 */
1714 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =104 */
1715 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =105 */
1716 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =106 */
1717 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =107 */
1718 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =108 */
1719 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =109 */
1720 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =110 */
1721 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =111 */
1722 (PID.TID 0000.0001) 2 @ 1.363550967500717E+02, /* I =112:113 */
1723 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =114 */
1724 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =115 */
1725 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =116 */
1726 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =117 */
1727 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =118 */
1728 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =119 */
1729 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =120 */
1730 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =121 */
1731 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =122 */
1732 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =123 */
1733 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =124 */
1734 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =125 */
1735 (PID.TID 0000.0001) 1.359720382181193E+02, /* I =126 */
1736 (PID.TID 0000.0001) 1.358367907661329E+02, /* I =127 */
1737 (PID.TID 0000.0001) 1.356047800523947E+02, /* I =128 */
1738 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =129 */
1739 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =130 */
1740 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =131 */
1741 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =132 */
1742 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =133 */
1743 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =134 */
1744 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =135 */
1745 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =136 */
1746 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =137 */
1747 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =138 */
1748 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =139 */
1749 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =140 */
1750 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =141 */
1751 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1752 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1753 (PID.TID 0000.0001) 2 @ -1.336449032499283E+02, /* I =144:145 */
1754 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1755 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1756 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =148 */
1757 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =149 */
1758 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =150 */
1759 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =151 */
1760 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =152 */
1761 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =153 */
1762 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =154 */
1763 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =155 */
1764 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =156 */
1765 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =157 */
1766 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =158 */
1767 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =159 */
1768 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =160 */
1769 (PID.TID 0000.0001) -1.350000000000000E+02, /* I =161 */
1770 (PID.TID 0000.0001) -1.362080546879630E+02, /* I =162 */
1771 (PID.TID 0000.0001) -1.378136964251304E+02, /* I =163 */
1772 (PID.TID 0000.0001) -1.397176767114393E+02, /* I =164 */
1773 (PID.TID 0000.0001) -1.418773831978723E+02, /* I =165 */
1774 (PID.TID 0000.0001) -1.442700437147871E+02, /* I =166 */
1775 (PID.TID 0000.0001) -1.468812832533406E+02, /* I =167 */
1776 (PID.TID 0000.0001) -1.497001816778676E+02, /* I =168 */
1777 (PID.TID 0000.0001) -1.527165499179235E+02, /* I =169 */
1778 (PID.TID 0000.0001) -1.559191460485302E+02, /* I =170 */
1779 (PID.TID 0000.0001) -1.592943927048415E+02, /* I =171 */
1780 (PID.TID 0000.0001) -1.628254580761615E+02, /* I =172 */
1781 (PID.TID 0000.0001) -1.664916883061893E+02, /* I =173 */
1782 (PID.TID 0000.0001) -1.702684280378718E+02, /* I =174 */
1783 (PID.TID 0000.0001) -1.741272674312418E+02, /* I =175 */
1784 (PID.TID 0000.0001) -1.780367200854751E+02, /* I =176 */
1785 (PID.TID 0000.0001) 1.780367200854751E+02, /* I =177 */
1786 (PID.TID 0000.0001) 1.741272674312418E+02, /* I =178 */
1787 (PID.TID 0000.0001) 1.702684280378718E+02, /* I =179 */
1788 (PID.TID 0000.0001) 1.664916883061893E+02, /* I =180 */
1789 (PID.TID 0000.0001) 1.628254580761615E+02, /* I =181 */
1790 (PID.TID 0000.0001) 1.592943927048415E+02, /* I =182 */
1791 (PID.TID 0000.0001) 1.559191460485302E+02, /* I =183 */
1792 (PID.TID 0000.0001) 1.527165499179235E+02, /* I =184 */
1793 (PID.TID 0000.0001) 1.497001816778676E+02, /* I =185 */
1794 (PID.TID 0000.0001) 1.468812832533406E+02, /* I =186 */
1795 (PID.TID 0000.0001) 1.442700437147871E+02, /* I =187 */
1796 (PID.TID 0000.0001) 1.418773831978723E+02, /* I =188 */
1797 (PID.TID 0000.0001) 1.397176767114393E+02, /* I =189 */
1798 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1799 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1800 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1801 (PID.TID 0000.0001) ;
1802 (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
1803 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1804 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1805 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1806 (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1807 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1808 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1809 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1810 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1811 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1812 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1813 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1814 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1815 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1816 (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1817 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1818 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1819 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1820 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1821 (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1822 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1823 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1824 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1825 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1826 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1827 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1828 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1829 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1830 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1831 (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1832 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1833 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1834 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1835 (PID.TID 0000.0001) ;
1836 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1837 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1838 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1839 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1840 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1841 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1842 (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1843 (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1844 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1845 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1846 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1847 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1848 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1849 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1850 (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1851 (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1852 (PID.TID 0000.0001) ;
1853 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1854 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1855 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1856 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1857 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1858 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1859 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1860 (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1861 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1862 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1863 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1864 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1865 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1866 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1867 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1868 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1869 (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1870 (PID.TID 0000.0001) ;
1871 (PID.TID 0000.0001) deepFacC = /* deep-model grid factor @ cell-Center (-) */
1872 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1873 (PID.TID 0000.0001) ;
1874 (PID.TID 0000.0001) deepFacF = /* deep-model grid factor @ W-Interface (-) */
1875 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1876 (PID.TID 0000.0001) ;
1877 (PID.TID 0000.0001) dBdrRef = /* Vertical gradient of reference boyancy [(m/s/r)^2)] */
1878 (PID.TID 0000.0001) 15 @ 0.000000000000000E+00 /* K = 1: 15 */
1879 (PID.TID 0000.0001) ;
1880 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( units: m ) */
1881 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1882 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1883 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1884 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 4 */
1885 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 5 */
1886 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 6 */
1887 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 7 */
1888 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 8 */
1889 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 9 */
1890 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 10 */
1891 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 11 */
1892 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 12 */
1893 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 13 */
1894 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 14 */
1895 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 15 */
1896 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 16: 17 */
1897 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 18 */
1898 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 19 */
1899 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 20 */
1900 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 21 */
1901 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 22 */
1902 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 23 */
1903 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 24 */
1904 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 25 */
1905 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 26 */
1906 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 27 */
1907 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 28 */
1908 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 29 */
1909 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 30 */
1910 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 31 */
1911 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1912 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 34 */
1913 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 35 */
1914 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 36 */
1915 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 37 */
1916 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 38 */
1917 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 39 */
1918 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 40 */
1919 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 41 */
1920 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 42 */
1921 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 43 */
1922 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 44 */
1923 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 45 */
1924 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1925 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1926 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 48: 49 */
1927 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1928 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1929 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 52 */
1930 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 53 */
1931 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 54 */
1932 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 55 */
1933 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 56 */
1934 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 57 */
1935 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 58 */
1936 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 59 */
1937 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 60 */
1938 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 61 */
1939 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 62 */
1940 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 63 */
1941 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1942 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 66 */
1943 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 67 */
1944 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 68 */
1945 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 69 */
1946 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 70 */
1947 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 71 */
1948 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 72 */
1949 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 73 */
1950 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 74 */
1951 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 75 */
1952 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 76 */
1953 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 77 */
1954 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 78 */
1955 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 79 */
1956 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 80: 81 */
1957 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 82 */
1958 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 83 */
1959 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 84 */
1960 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 85 */
1961 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 86 */
1962 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 87 */
1963 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 88 */
1964 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 89 */
1965 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 90 */
1966 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 91 */
1967 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 92 */
1968 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 93 */
1969 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1970 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1971 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1972 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1973 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1974 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =100 */
1975 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =101 */
1976 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =102 */
1977 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =103 */
1978 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =104 */
1979 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =105 */
1980 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =106 */
1981 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =107 */
1982 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =108 */
1983 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =109 */
1984 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =110 */
1985 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =111 */
1986 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =112:113 */
1987 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =114 */
1988 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =115 */
1989 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =116 */
1990 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =117 */
1991 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =118 */
1992 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =119 */
1993 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =120 */
1994 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =121 */
1995 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =122 */
1996 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =123 */
1997 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =124 */
1998 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =125 */
1999 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =126 */
2000 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =127 */
2001 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
2002 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =130 */
2003 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =131 */
2004 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =132 */
2005 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =133 */
2006 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =134 */
2007 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =135 */
2008 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =136 */
2009 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =137 */
2010 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =138 */
2011 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =139 */
2012 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =140 */
2013 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =141 */
2014 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
2015 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
2016 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =144:145 */
2017 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
2018 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
2019 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =148 */
2020 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =149 */
2021 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =150 */
2022 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =151 */
2023 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =152 */
2024 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =153 */
2025 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =154 */
2026 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =155 */
2027 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =156 */
2028 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =157 */
2029 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =158 */
2030 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =159 */
2031 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
2032 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =162 */
2033 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =163 */
2034 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =164 */
2035 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =165 */
2036 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =166 */
2037 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =167 */
2038 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =168 */
2039 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =169 */
2040 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =170 */
2041 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =171 */
2042 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =172 */
2043 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =173 */
2044 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =174 */
2045 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =175 */
2046 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =176:177 */
2047 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =178 */
2048 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =179 */
2049 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =180 */
2050 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =181 */
2051 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =182 */
2052 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =183 */
2053 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =184 */
2054 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =185 */
2055 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =186 */
2056 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =187 */
2057 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =188 */
2058 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =189 */
2059 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
2060 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
2061 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
2062 (PID.TID 0000.0001) ;
2063 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( units: m ) */
2064 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
2065 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
2066 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
2067 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
2068 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
2069 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
2070 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
2071 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
2072 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
2073 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
2074 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
2075 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
2076 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
2077 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
2078 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
2079 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
2080 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
2081 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
2082 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
2083 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
2084 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
2085 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
2086 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
2087 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
2088 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
2089 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
2090 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
2091 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
2092 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
2093 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
2094 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
2095 (PID.TID 0000.0001) ;
2096 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( units: m ) */
2097 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
2098 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
2099 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
2100 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 4 */
2101 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 5 */
2102 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 6 */
2103 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 7 */
2104 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 8 */
2105 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 9 */
2106 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 10 */
2107 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 11 */
2108 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 12 */
2109 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 13 */
2110 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 14 */
2111 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 15 */
2112 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 16: 17 */
2113 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 18 */
2114 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 19 */
2115 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 20 */
2116 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 21 */
2117 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 22 */
2118 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 23 */
2119 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 24 */
2120 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 25 */
2121 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 26 */
2122 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 27 */
2123 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 28 */
2124 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 29 */
2125 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 30 */
2126 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 31 */
2127 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
2128 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 34 */
2129 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 35 */
2130 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 36 */
2131 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 37 */
2132 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 38 */
2133 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 39 */
2134 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 40 */
2135 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 41 */
2136 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 42 */
2137 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 43 */
2138 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 44 */
2139 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 45 */
2140 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
2141 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
2142 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 48: 49 */
2143 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
2144 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
2145 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 52 */
2146 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 53 */
2147 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 54 */
2148 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 55 */
2149 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 56 */
2150 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 57 */
2151 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 58 */
2152 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 59 */
2153 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 60 */
2154 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 61 */
2155 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 62 */
2156 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 63 */
2157 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
2158 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 66 */
2159 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 67 */
2160 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 68 */
2161 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 69 */
2162 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 70 */
2163 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 71 */
2164 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 72 */
2165 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 73 */
2166 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 74 */
2167 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 75 */
2168 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 76 */
2169 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 77 */
2170 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 78 */
2171 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 79 */
2172 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 80: 81 */
2173 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 82 */
2174 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 83 */
2175 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 84 */
2176 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 85 */
2177 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 86 */
2178 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 87 */
2179 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 88 */
2180 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 89 */
2181 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 90 */
2182 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 91 */
2183 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 92 */
2184 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 93 */
2185 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
2186 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
2187 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
2188 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
2189 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
2190 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =100 */
2191 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =101 */
2192 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =102 */
2193 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =103 */
2194 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =104 */
2195 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =105 */
2196 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =106 */
2197 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =107 */
2198 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =108 */
2199 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =109 */
2200 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =110 */
2201 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =111 */
2202 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =112:113 */
2203 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =114 */
2204 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =115 */
2205 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =116 */
2206 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =117 */
2207 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =118 */
2208 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =119 */
2209 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =120 */
2210 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =121 */
2211 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =122 */
2212 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =123 */
2213 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =124 */
2214 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =125 */
2215 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =126 */
2216 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =127 */
2217 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
2218 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =130 */
2219 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =131 */
2220 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =132 */
2221 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =133 */
2222 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =134 */
2223 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =135 */
2224 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =136 */
2225 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =137 */
2226 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =138 */
2227 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =139 */
2228 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =140 */
2229 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =141 */
2230 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
2231 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
2232 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =144:145 */
2233 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
2234 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
2235 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =148 */
2236 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =149 */
2237 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =150 */
2238 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =151 */
2239 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =152 */
2240 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =153 */
2241 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =154 */
2242 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =155 */
2243 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =156 */
2244 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =157 */
2245 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =158 */
2246 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =159 */
2247 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
2248 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =162 */
2249 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =163 */
2250 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =164 */
2251 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =165 */
2252 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =166 */
2253 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =167 */
2254 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =168 */
2255 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =169 */
2256 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =170 */
2257 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =171 */
2258 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =172 */
2259 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =173 */
2260 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =174 */
2261 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =175 */
2262 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =176:177 */
2263 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =178 */
2264 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =179 */
2265 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =180 */
2266 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =181 */
2267 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =182 */
2268 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =183 */
2269 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =184 */
2270 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =185 */
2271 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =186 */
2272 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =187 */
2273 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =188 */
2274 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =189 */
2275 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
2276 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
2277 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
2278 (PID.TID 0000.0001) ;
2279 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( units: m ) */
2280 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
2281 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
2282 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
2283 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
2284 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
2285 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
2286 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
2287 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
2288 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
2289 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
2290 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
2291 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
2292 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
2293 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
2294 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
2295 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
2296 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
2297 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
2298 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
2299 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
2300 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
2301 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
2302 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
2303 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
2304 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
2305 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
2306 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
2307 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
2308 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
2309 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
2310 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
2311 (PID.TID 0000.0001) ;
2312 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( units: m ) */
2313 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2314 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
2315 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
2316 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 4 */
2317 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 5 */
2318 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 6 */
2319 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 7 */
2320 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 8 */
2321 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 9 */
2322 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 10 */
2323 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 11 */
2324 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 12 */
2325 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 13 */
2326 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 14 */
2327 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 15 */
2328 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 16: 17 */
2329 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 18 */
2330 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 19 */
2331 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 20 */
2332 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 21 */
2333 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 22 */
2334 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 23 */
2335 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 24 */
2336 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 25 */
2337 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 26 */
2338 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 27 */
2339 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 28 */
2340 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 29 */
2341 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 30 */
2342 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 31 */
2343 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 32: 33 */
2344 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 34 */
2345 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 35 */
2346 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 36 */
2347 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 37 */
2348 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 38 */
2349 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 39 */
2350 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 40 */
2351 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 41 */
2352 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 42 */
2353 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 43 */
2354 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 44 */
2355 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 45 */
2356 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
2357 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
2358 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 48: 49 */
2359 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
2360 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
2361 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 52 */
2362 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 53 */
2363 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 54 */
2364 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 55 */
2365 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 56 */
2366 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 57 */
2367 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 58 */
2368 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 59 */
2369 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 60 */
2370 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 61 */
2371 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 62 */
2372 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 63 */
2373 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 64: 65 */
2374 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 66 */
2375 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 67 */
2376 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 68 */
2377 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 69 */
2378 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 70 */
2379 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 71 */
2380 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 72 */
2381 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 73 */
2382 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 74 */
2383 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 75 */
2384 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 76 */
2385 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 77 */
2386 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 78 */
2387 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 79 */
2388 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 80: 81 */
2389 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 82 */
2390 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 83 */
2391 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 84 */
2392 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 85 */
2393 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 86 */
2394 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 87 */
2395 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 88 */
2396 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 89 */
2397 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 90 */
2398 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 91 */
2399 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 92 */
2400 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 93 */
2401 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
2402 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
2403 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 96: 97 */
2404 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
2405 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
2406 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =100 */
2407 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =101 */
2408 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =102 */
2409 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =103 */
2410 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =104 */
2411 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =105 */
2412 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =106 */
2413 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =107 */
2414 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =108 */
2415 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =109 */
2416 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =110 */
2417 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =111 */
2418 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =112:113 */
2419 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =114 */
2420 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =115 */
2421 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =116 */
2422 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =117 */
2423 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =118 */
2424 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =119 */
2425 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =120 */
2426 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =121 */
2427 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =122 */
2428 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =123 */
2429 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =124 */
2430 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =125 */
2431 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =126 */
2432 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =127 */
2433 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =128:129 */
2434 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =130 */
2435 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =131 */
2436 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =132 */
2437 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =133 */
2438 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =134 */
2439 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =135 */
2440 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =136 */
2441 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =137 */
2442 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =138 */
2443 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =139 */
2444 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =140 */
2445 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =141 */
2446 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
2447 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
2448 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =144:145 */
2449 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
2450 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
2451 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =148 */
2452 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =149 */
2453 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =150 */
2454 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =151 */
2455 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =152 */
2456 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =153 */
2457 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =154 */
2458 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =155 */
2459 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =156 */
2460 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =157 */
2461 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =158 */
2462 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =159 */
2463 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =160:161 */
2464 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =162 */
2465 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =163 */
2466 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =164 */
2467 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =165 */
2468 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =166 */
2469 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =167 */
2470 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =168 */
2471 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =169 */
2472 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =170 */
2473 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =171 */
2474 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =172 */
2475 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =173 */
2476 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =174 */
2477 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =175 */
2478 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =176:177 */
2479 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =178 */
2480 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =179 */
2481 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =180 */
2482 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =181 */
2483 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =182 */
2484 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =183 */
2485 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =184 */
2486 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =185 */
2487 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =186 */
2488 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =187 */
2489 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =188 */
2490 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =189 */
2491 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
2492 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
2493 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
2494 (PID.TID 0000.0001) ;
2495 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( units: m ) */
2496 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2497 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
2498 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
2499 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
2500 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
2501 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
2502 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
2503 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
2504 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
2505 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
2506 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
2507 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
2508 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
2509 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
2510 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
2511 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
2512 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
2513 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
2514 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
2515 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
2516 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
2517 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
2518 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
2519 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
2520 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
2521 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
2522 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
2523 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
2524 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
2525 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
2526 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
2527 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
2528 (PID.TID 0000.0001) ;
2529 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( units: m ) */
2530 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2531 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
2532 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
2533 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 4 */
2534 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 5 */
2535 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 6 */
2536 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 7 */
2537 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 8 */
2538 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 9 */
2539 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 10 */
2540 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 11 */
2541 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 12 */
2542 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 13 */
2543 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 14 */
2544 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 15 */
2545 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 16 */
2546 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 17 */
2547 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 18 */
2548 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 19 */
2549 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 20 */
2550 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 21 */
2551 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 22 */
2552 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 23 */
2553 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 24 */
2554 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 25 */
2555 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 26 */
2556 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 27 */
2557 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 28 */
2558 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 29 */
2559 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 30 */
2560 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 31 */
2561 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 32 */
2562 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 33 */
2563 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 34 */
2564 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 35 */
2565 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 36 */
2566 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 37 */
2567 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 38 */
2568 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 39 */
2569 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 40 */
2570 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 41 */
2571 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 42 */
2572 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 43 */
2573 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 44 */
2574 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 45 */
2575 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
2576 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
2577 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
2578 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
2579 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
2580 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
2581 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 52 */
2582 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 53 */
2583 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 54 */
2584 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 55 */
2585 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 56 */
2586 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 57 */
2587 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 58 */
2588 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 59 */
2589 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 60 */
2590 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 61 */
2591 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 62 */
2592 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 63 */
2593 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 64 */
2594 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 65 */
2595 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 66 */
2596 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 67 */
2597 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 68 */
2598 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 69 */
2599 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 70 */
2600 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 71 */
2601 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 72 */
2602 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 73 */
2603 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 74 */
2604 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 75 */
2605 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 76 */
2606 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 77 */
2607 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 78 */
2608 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 79 */
2609 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 80 */
2610 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 81 */
2611 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 82 */
2612 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 83 */
2613 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 84 */
2614 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 85 */
2615 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 86 */
2616 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 87 */
2617 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 88 */
2618 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 89 */
2619 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 90 */
2620 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 91 */
2621 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 92 */
2622 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 93 */
2623 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
2624 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
2625 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
2626 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
2627 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
2628 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
2629 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =100 */
2630 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =101 */
2631 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =102 */
2632 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =103 */
2633 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =104 */
2634 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =105 */
2635 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =106 */
2636 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =107 */
2637 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =108 */
2638 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =109 */
2639 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =110 */
2640 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =111 */
2641 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =112 */
2642 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =113 */
2643 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =114 */
2644 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =115 */
2645 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =116 */
2646 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =117 */
2647 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =118 */
2648 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =119 */
2649 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =120 */
2650 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =121 */
2651 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =122 */
2652 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =123 */
2653 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =124 */
2654 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =125 */
2655 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =126 */
2656 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =127 */
2657 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =128 */
2658 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =129 */
2659 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =130 */
2660 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =131 */
2661 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =132 */
2662 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =133 */
2663 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =134 */
2664 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =135 */
2665 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =136 */
2666 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =137 */
2667 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =138 */
2668 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =139 */
2669 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =140 */
2670 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =141 */
2671 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
2672 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
2673 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
2674 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
2675 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
2676 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
2677 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =148 */
2678 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =149 */
2679 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =150 */
2680 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =151 */
2681 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =152 */
2682 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =153 */
2683 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =154 */
2684 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =155 */
2685 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =156 */
2686 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =157 */
2687 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =158 */
2688 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =159 */
2689 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =160 */
2690 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =161 */
2691 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =162 */
2692 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =163 */
2693 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =164 */
2694 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =165 */
2695 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =166 */
2696 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =167 */
2697 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =168 */
2698 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =169 */
2699 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =170 */
2700 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =171 */
2701 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =172 */
2702 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =173 */
2703 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =174 */
2704 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =175 */
2705 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =176 */
2706 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =177 */
2707 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =178 */
2708 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =179 */
2709 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =180 */
2710 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =181 */
2711 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =182 */
2712 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =183 */
2713 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =184 */
2714 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =185 */
2715 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =186 */
2716 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =187 */
2717 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =188 */
2718 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =189 */
2719 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
2720 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
2721 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
2722 (PID.TID 0000.0001) ;
2723 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( units: m ) */
2724 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2725 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
2726 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
2727 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
2728 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
2729 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
2730 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
2731 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
2732 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
2733 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
2734 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
2735 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
2736 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
2737 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
2738 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
2739 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
2740 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
2741 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
2742 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
2743 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
2744 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
2745 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
2746 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
2747 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
2748 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
2749 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
2750 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
2751 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
2752 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
2753 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
2754 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
2755 (PID.TID 0000.0001) ;
2756 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( units: m ) */
2757 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2758 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
2759 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
2760 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 4 */
2761 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 5 */
2762 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 6 */
2763 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 7 */
2764 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 8 */
2765 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 9 */
2766 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 10 */
2767 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 11 */
2768 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 12 */
2769 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 13 */
2770 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 14 */
2771 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 15 */
2772 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 16 */
2773 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 17 */
2774 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 18 */
2775 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 19 */
2776 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 20 */
2777 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 21 */
2778 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 22 */
2779 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 23 */
2780 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 24 */
2781 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 25 */
2782 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 26 */
2783 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 27 */
2784 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 28 */
2785 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 29 */
2786 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 30 */
2787 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 31 */
2788 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 32 */
2789 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 33 */
2790 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 34 */
2791 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 35 */
2792 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 36 */
2793 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 37 */
2794 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 38 */
2795 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 39 */
2796 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 40 */
2797 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 41 */
2798 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 42 */
2799 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 43 */
2800 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 44 */
2801 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 45 */
2802 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
2803 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
2804 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
2805 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
2806 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
2807 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
2808 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 52 */
2809 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 53 */
2810 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 54 */
2811 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 55 */
2812 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 56 */
2813 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 57 */
2814 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 58 */
2815 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 59 */
2816 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 60 */
2817 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 61 */
2818 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 62 */
2819 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 63 */
2820 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 64 */
2821 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 65 */
2822 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 66 */
2823 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 67 */
2824 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 68 */
2825 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 69 */
2826 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 70 */
2827 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 71 */
2828 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 72 */
2829 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 73 */
2830 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 74 */
2831 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 75 */
2832 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 76 */
2833 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 77 */
2834 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 78 */
2835 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 79 */
2836 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 80 */
2837 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 81 */
2838 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 82 */
2839 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 83 */
2840 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 84 */
2841 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 85 */
2842 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 86 */
2843 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 87 */
2844 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 88 */
2845 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 89 */
2846 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 90 */
2847 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 91 */
2848 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 92 */
2849 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 93 */
2850 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
2851 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
2852 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
2853 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
2854 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
2855 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
2856 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =100 */
2857 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =101 */
2858 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =102 */
2859 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =103 */
2860 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =104 */
2861 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =105 */
2862 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =106 */
2863 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =107 */
2864 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =108 */
2865 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =109 */
2866 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =110 */
2867 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =111 */
2868 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =112 */
2869 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =113 */
2870 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =114 */
2871 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =115 */
2872 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =116 */
2873 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =117 */
2874 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =118 */
2875 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =119 */
2876 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =120 */
2877 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =121 */
2878 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =122 */
2879 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =123 */
2880 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =124 */
2881 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =125 */
2882 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =126 */
2883 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =127 */
2884 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =128 */
2885 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =129 */
2886 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =130 */
2887 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =131 */
2888 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =132 */
2889 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =133 */
2890 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =134 */
2891 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =135 */
2892 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =136 */
2893 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =137 */
2894 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =138 */
2895 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =139 */
2896 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =140 */
2897 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =141 */
2898 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
2899 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
2900 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
2901 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
2902 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
2903 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
2904 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =148 */
2905 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =149 */
2906 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =150 */
2907 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =151 */
2908 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =152 */
2909 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =153 */
2910 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =154 */
2911 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =155 */
2912 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =156 */
2913 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =157 */
2914 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =158 */
2915 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =159 */
2916 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =160 */
2917 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =161 */
2918 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =162 */
2919 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =163 */
2920 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =164 */
2921 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =165 */
2922 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =166 */
2923 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =167 */
2924 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =168 */
2925 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =169 */
2926 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =170 */
2927 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =171 */
2928 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =172 */
2929 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =173 */
2930 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =174 */
2931 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =175 */
2932 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =176 */
2933 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =177 */
2934 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =178 */
2935 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =179 */
2936 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =180 */
2937 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =181 */
2938 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =182 */
2939 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =183 */
2940 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =184 */
2941 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =185 */
2942 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =186 */
2943 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =187 */
2944 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =188 */
2945 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =189 */
2946 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
2947 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
2948 (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
2949 (PID.TID 0000.0001) ;
2950 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( units: m ) */
2951 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2952 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
2953 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
2954 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
2955 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
2956 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
2957 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
2958 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
2959 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
2960 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
2961 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
2962 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
2963 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
2964 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
2965 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
2966 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
2967 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
2968 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
2969 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
2970 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
2971 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
2972 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
2973 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
2974 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
2975 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
2976 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
2977 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
2978 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
2979 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
2980 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
2981 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
2982 (PID.TID 0000.0001) ;
2983 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( units: m ) */
2984 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2985 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
2986 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
2987 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 4 */
2988 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 5 */
2989 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 6 */
2990 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 7 */
2991 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 8 */
2992 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 9 */
2993 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 10 */
2994 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 11 */
2995 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 12 */
2996 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 13 */
2997 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 14 */
2998 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 15 */
2999 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 16: 17 */
3000 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 18 */
3001 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 19 */
3002 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 20 */
3003 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 21 */
3004 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 22 */
3005 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 23 */
3006 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 24 */
3007 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 25 */
3008 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 26 */
3009 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 27 */
3010 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 28 */
3011 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 29 */
3012 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 30 */
3013 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 31 */
3014 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 32: 33 */
3015 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 34 */
3016 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 35 */
3017 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 36 */
3018 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 37 */
3019 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 38 */
3020 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 39 */
3021 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 40 */
3022 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 41 */
3023 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 42 */
3024 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 43 */
3025 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 44 */
3026 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 45 */
3027 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
3028 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
3029 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 48: 49 */
3030 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
3031 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
3032 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 52 */
3033 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 53 */
3034 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 54 */
3035 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 55 */
3036 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 56 */
3037 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 57 */
3038 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 58 */
3039 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 59 */
3040 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 60 */
3041 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 61 */
3042 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 62 */
3043 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 63 */
3044 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 64: 65 */
3045 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 66 */
3046 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 67 */
3047 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 68 */
3048 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 69 */
3049 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 70 */
3050 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 71 */
3051 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 72 */
3052 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 73 */
3053 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 74 */
3054 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 75 */
3055 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 76 */
3056 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 77 */
3057 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 78 */
3058 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 79 */
3059 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 80: 81 */
3060 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 82 */
3061 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 83 */
3062 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 84 */
3063 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 85 */
3064 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 86 */
3065 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 87 */
3066 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 88 */
3067 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 89 */
3068 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 90 */
3069 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 91 */
3070 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 92 */
3071 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 93 */
3072 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
3073 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
3074 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 96: 97 */
3075 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
3076 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
3077 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =100 */
3078 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =101 */
3079 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =102 */
3080 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =103 */
3081 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =104 */
3082 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =105 */
3083 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =106 */
3084 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =107 */
3085 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =108 */
3086 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =109 */
3087 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =110 */
3088 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =111 */
3089 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =112:113 */
3090 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =114 */
3091 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =115 */
3092 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =116 */
3093 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =117 */
3094 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =118 */
3095 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =119 */
3096 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =120 */
3097 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =121 */
3098 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =122 */
3099 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =123 */
3100 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =124 */
3101 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =125 */
3102 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =126 */
3103 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =127 */
3104 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =128:129 */
3105 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =130 */
3106 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =131 */
3107 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =132 */
3108 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =133 */
3109 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =134 */
3110 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =135 */
3111 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =136 */
3112 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =137 */
3113 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =138 */
3114 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =139 */
3115 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =140 */
3116 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =141 */
3117 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
3118 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
3119 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =144:145 */
3120 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
3121 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
3122 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =148 */
3123 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =149 */
3124 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =150 */
3125 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =151 */
3126 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =152 */
3127 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =153 */
3128 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =154 */
3129 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =155 */
3130 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =156 */
3131 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =157 */
3132 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =158 */
3133 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =159 */
3134 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =160:161 */
3135 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =162 */
3136 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =163 */
3137 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =164 */
3138 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =165 */
3139 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =166 */
3140 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =167 */
3141 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =168 */
3142 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =169 */
3143 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =170 */
3144 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =171 */
3145 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =172 */
3146 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =173 */
3147 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =174 */
3148 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =175 */
3149 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =176:177 */
3150 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =178 */
3151 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =179 */
3152 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =180 */
3153 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =181 */
3154 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =182 */
3155 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =183 */
3156 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =184 */
3157 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =185 */
3158 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =186 */
3159 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =187 */
3160 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =188 */
3161 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =189 */
3162 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
3163 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
3164 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
3165 (PID.TID 0000.0001) ;
3166 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( units: m ) */
3167 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
3168 (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
3169 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
3170 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
3171 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
3172 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
3173 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
3174 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
3175 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
3176 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
3177 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
3178 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
3179 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
3180 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
3181 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
3182 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
3183 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
3184 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
3185 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
3186 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
3187 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
3188 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
3189 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
3190 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
3191 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
3192 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
3193 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
3194 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
3195 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
3196 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
3197 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
3198 (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
3199 (PID.TID 0000.0001) ;
3200 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( units: m ) */
3201 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
3202 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
3203 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
3204 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 4 */
3205 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 5 */
3206 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 6 */
3207 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 7 */
3208 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 8 */
3209 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 9 */
3210 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 10 */
3211 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 11 */
3212 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 12 */
3213 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 13 */
3214 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 14 */
3215 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 15 */
3216 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 16 */
3217 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 17 */
3218 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 18 */
3219 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 19 */
3220 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 20 */
3221 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 21 */
3222 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 22 */
3223 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 23 */
3224 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 24 */
3225 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 25 */
3226 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 26 */
3227 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 27 */
3228 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 28 */
3229 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 29 */
3230 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 30 */
3231 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 31 */
3232 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 32 */
3233 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
3234 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 34 */
3235 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 35 */
3236 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 36 */
3237 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 37 */
3238 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 38 */
3239 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 39 */
3240 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 40 */
3241 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 41 */
3242 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 42 */
3243 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 43 */
3244 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 44 */
3245 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 45 */
3246 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
3247 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
3248 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
3249 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
3250 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
3251 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
3252 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 52 */
3253 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 53 */
3254 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 54 */
3255 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 55 */
3256 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 56 */
3257 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 57 */
3258 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 58 */
3259 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 59 */
3260 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 60 */
3261 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 61 */
3262 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 62 */
3263 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 63 */
3264 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 64 */
3265 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3266 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 66 */
3267 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 67 */
3268 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 68 */
3269 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 69 */
3270 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 70 */
3271 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 71 */
3272 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 72 */
3273 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 73 */
3274 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 74 */
3275 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 75 */
3276 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 76 */
3277 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 77 */
3278 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 78 */
3279 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 79 */
3280 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 80 */
3281 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 81 */
3282 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 82 */
3283 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 83 */
3284 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 84 */
3285 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 85 */
3286 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 86 */
3287 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 87 */
3288 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 88 */
3289 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 89 */
3290 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 90 */
3291 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 91 */
3292 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 92 */
3293 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 93 */
3294 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
3295 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
3296 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
3297 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3298 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
3299 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
3300 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =100 */
3301 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =101 */
3302 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =102 */
3303 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =103 */
3304 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =104 */
3305 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =105 */
3306 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =106 */
3307 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =107 */
3308 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =108 */
3309 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =109 */
3310 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =110 */
3311 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =111 */
3312 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =112 */
3313 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =113 */
3314 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =114 */
3315 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =115 */
3316 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =116 */
3317 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =117 */
3318 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =118 */
3319 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =119 */
3320 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =120 */
3321 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =121 */
3322 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =122 */
3323 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =123 */
3324 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =124 */
3325 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =125 */
3326 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =126 */
3327 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =127 */
3328 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =128 */
3329 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3330 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =130 */
3331 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =131 */
3332 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =132 */
3333 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =133 */
3334 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =134 */
3335 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =135 */
3336 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =136 */
3337 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =137 */
3338 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =138 */
3339 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =139 */
3340 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =140 */
3341 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =141 */
3342 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
3343 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
3344 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
3345 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
3346 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
3347 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
3348 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =148 */
3349 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =149 */
3350 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =150 */
3351 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =151 */
3352 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =152 */
3353 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =153 */
3354 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =154 */
3355 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =155 */
3356 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =156 */
3357 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =157 */
3358 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =158 */
3359 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =159 */
3360 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =160 */
3361 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3362 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =162 */
3363 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =163 */
3364 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =164 */
3365 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =165 */
3366 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =166 */
3367 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =167 */
3368 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =168 */
3369 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =169 */
3370 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =170 */
3371 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =171 */
3372 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =172 */
3373 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =173 */
3374 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =174 */
3375 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =175 */
3376 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =176 */
3377 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =177 */
3378 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =178 */
3379 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =179 */
3380 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =180 */
3381 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =181 */
3382 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =182 */
3383 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =183 */
3384 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =184 */
3385 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =185 */
3386 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =186 */
3387 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =187 */
3388 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =188 */
3389 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =189 */
3390 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
3391 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
3392 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
3393 (PID.TID 0000.0001) ;
3394 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( units: m ) */
3395 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3396 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
3397 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
3398 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
3399 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
3400 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
3401 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
3402 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
3403 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
3404 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
3405 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
3406 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
3407 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
3408 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
3409 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
3410 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
3411 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
3412 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
3413 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
3414 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
3415 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
3416 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
3417 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
3418 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
3419 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
3420 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
3421 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
3422 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
3423 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
3424 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
3425 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
3426 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
3427 (PID.TID 0000.0001) ;
3428 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( units: m ) */
3429 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
3430 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
3431 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
3432 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 4 */
3433 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 5 */
3434 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 6 */
3435 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 7 */
3436 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 8 */
3437 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 9 */
3438 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 10 */
3439 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 11 */
3440 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 12 */
3441 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 13 */
3442 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 14 */
3443 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 15 */
3444 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 16 */
3445 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 17 */
3446 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 18 */
3447 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 19 */
3448 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 20 */
3449 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 21 */
3450 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 22 */
3451 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 23 */
3452 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 24 */
3453 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 25 */
3454 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 26 */
3455 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 27 */
3456 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 28 */
3457 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 29 */
3458 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 30 */
3459 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 31 */
3460 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 32 */
3461 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
3462 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 34 */
3463 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 35 */
3464 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 36 */
3465 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 37 */
3466 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 38 */
3467 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 39 */
3468 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 40 */
3469 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 41 */
3470 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 42 */
3471 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 43 */
3472 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 44 */
3473 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 45 */
3474 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
3475 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
3476 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
3477 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
3478 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
3479 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
3480 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 52 */
3481 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 53 */
3482 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 54 */
3483 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 55 */
3484 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 56 */
3485 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 57 */
3486 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 58 */
3487 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 59 */
3488 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 60 */
3489 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 61 */
3490 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 62 */
3491 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 63 */
3492 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 64 */
3493 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3494 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 66 */
3495 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 67 */
3496 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 68 */
3497 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 69 */
3498 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 70 */
3499 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 71 */
3500 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 72 */
3501 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 73 */
3502 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 74 */
3503 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 75 */
3504 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 76 */
3505 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 77 */
3506 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 78 */
3507 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 79 */
3508 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 80 */
3509 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 81 */
3510 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 82 */
3511 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 83 */
3512 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 84 */
3513 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 85 */
3514 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 86 */
3515 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 87 */
3516 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 88 */
3517 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 89 */
3518 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 90 */
3519 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 91 */
3520 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 92 */
3521 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 93 */
3522 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
3523 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
3524 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
3525 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3526 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
3527 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
3528 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =100 */
3529 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =101 */
3530 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =102 */
3531 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =103 */
3532 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =104 */
3533 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =105 */
3534 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =106 */
3535 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =107 */
3536 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =108 */
3537 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =109 */
3538 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =110 */
3539 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =111 */
3540 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =112 */
3541 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =113 */
3542 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =114 */
3543 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =115 */
3544 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =116 */
3545 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =117 */
3546 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =118 */
3547 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =119 */
3548 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =120 */
3549 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =121 */
3550 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =122 */
3551 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =123 */
3552 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =124 */
3553 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =125 */
3554 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =126 */
3555 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =127 */
3556 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =128 */
3557 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3558 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =130 */
3559 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =131 */
3560 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =132 */
3561 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =133 */
3562 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =134 */
3563 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =135 */
3564 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =136 */
3565 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =137 */
3566 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =138 */
3567 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =139 */
3568 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =140 */
3569 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =141 */
3570 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
3571 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
3572 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
3573 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
3574 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
3575 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
3576 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =148 */
3577 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =149 */
3578 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =150 */
3579 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =151 */
3580 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =152 */
3581 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =153 */
3582 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =154 */
3583 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =155 */
3584 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =156 */
3585 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =157 */
3586 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =158 */
3587 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =159 */
3588 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =160 */
3589 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3590 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =162 */
3591 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =163 */
3592 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =164 */
3593 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =165 */
3594 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =166 */
3595 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =167 */
3596 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =168 */
3597 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =169 */
3598 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =170 */
3599 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =171 */
3600 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =172 */
3601 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =173 */
3602 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =174 */
3603 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =175 */
3604 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =176 */
3605 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =177 */
3606 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =178 */
3607 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =179 */
3608 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =180 */
3609 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =181 */
3610 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =182 */
3611 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =183 */
3612 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =184 */
3613 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =185 */
3614 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =186 */
3615 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =187 */
3616 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =188 */
3617 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =189 */
3618 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
3619 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
3620 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
3621 (PID.TID 0000.0001) ;
3622 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( units: m ) */
3623 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3624 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
3625 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
3626 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 4 */
3627 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
3628 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
3629 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 7 */
3630 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
3631 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
3632 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 10 */
3633 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
3634 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
3635 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
3636 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
3637 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
3638 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
3639 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
3640 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
3641 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
3642 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
3643 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
3644 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
3645 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
3646 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 24 */
3647 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
3648 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
3649 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 27 */
3650 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
3651 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
3652 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 30 */
3653 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
3654 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
3655 (PID.TID 0000.0001) ;
3656 (PID.TID 0000.0001) rA = /* rA (:,1,:,1) ( units: m^2 ) */
3657 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
3658 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
3659 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
3660 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 4 */
3661 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 5 */
3662 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 6 */
3663 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 7 */
3664 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 8 */
3665 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 9 */
3666 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 10 */
3667 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 11 */
3668 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 12 */
3669 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 13 */
3670 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 14 */
3671 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 15 */
3672 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 16 */
3673 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 17 */
3674 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 18 */
3675 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 19 */
3676 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 20 */
3677 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 21 */
3678 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 22 */
3679 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 23 */
3680 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 24 */
3681 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 25 */
3682 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 26 */
3683 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 27 */
3684 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 28 */
3685 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 29 */
3686 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 30 */
3687 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 31 */
3688 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 32 */
3689 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 33 */
3690 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 34 */
3691 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 35 */
3692 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 36 */
3693 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 37 */
3694 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 38 */
3695 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 39 */
3696 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 40 */
3697 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 41 */
3698 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 42 */
3699 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 43 */
3700 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 44 */
3701 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 45 */
3702 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 46 */
3703 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 47 */
3704 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 48 */
3705 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 49 */
3706 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
3707 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 51 */
3708 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 52 */
3709 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 53 */
3710 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 54 */
3711 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 55 */
3712 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 56 */
3713 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 57 */
3714 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 58 */
3715 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 59 */
3716 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 60 */
3717 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 61 */
3718 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 62 */
3719 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 63 */
3720 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 64 */
3721 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 65 */
3722 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 66 */
3723 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 67 */
3724 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 68 */
3725 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 69 */
3726 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 70 */
3727 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 71 */
3728 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 72 */
3729 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 73 */
3730 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 74 */
3731 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 75 */
3732 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 76 */
3733 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 77 */
3734 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 78 */
3735 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 79 */
3736 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 80 */
3737 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 81 */
3738 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 82 */
3739 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 83 */
3740 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 84 */
3741 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 85 */
3742 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 86 */
3743 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 87 */
3744 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 88 */
3745 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 89 */
3746 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 90 */
3747 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 91 */
3748 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 92 */
3749 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 93 */
3750 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
3751 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
3752 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
3753 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
3754 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
3755 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
3756 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =100 */
3757 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =101 */
3758 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =102 */
3759 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =103 */
3760 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =104 */
3761 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =105 */
3762 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =106 */
3763 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =107 */
3764 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =108 */
3765 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =109 */
3766 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =110 */
3767 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =111 */
3768 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =112 */
3769 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =113 */
3770 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =114 */
3771 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =115 */
3772 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =116 */
3773 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =117 */
3774 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =118 */
3775 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =119 */
3776 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =120 */
3777 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =121 */
3778 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =122 */
3779 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =123 */
3780 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =124 */
3781 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =125 */
3782 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =126 */
3783 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =127 */
3784 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =128 */
3785 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =129 */
3786 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =130 */
3787 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =131 */
3788 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =132 */
3789 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =133 */
3790 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =134 */
3791 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =135 */
3792 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =136 */
3793 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =137 */
3794 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =138 */
3795 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =139 */
3796 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =140 */
3797 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =141 */
3798 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =142 */
3799 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =143 */
3800 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =144 */
3801 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =145 */
3802 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
3803 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =147 */
3804 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =148 */
3805 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =149 */
3806 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =150 */
3807 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =151 */
3808 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =152 */
3809 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =153 */
3810 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =154 */
3811 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =155 */
3812 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =156 */
3813 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =157 */
3814 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =158 */
3815 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =159 */
3816 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =160 */
3817 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =161 */
3818 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =162 */
3819 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =163 */
3820 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =164 */
3821 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =165 */
3822 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =166 */
3823 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =167 */
3824 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =168 */
3825 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =169 */
3826 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =170 */
3827 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =171 */
3828 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =172 */
3829 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =173 */
3830 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =174 */
3831 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =175 */
3832 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =176 */
3833 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =177 */
3834 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =178 */
3835 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =179 */
3836 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =180 */
3837 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =181 */
3838 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =182 */
3839 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =183 */
3840 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =184 */
3841 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =185 */
3842 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =186 */
3843 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =187 */
3844 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =188 */
3845 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =189 */
3846 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
3847 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
3848 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
3849 (PID.TID 0000.0001) ;
3850 (PID.TID 0000.0001) rA = /* rA (1,:,1,:) ( units: m^2 ) */
3851 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
3852 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
3853 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
3854 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
3855 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
3856 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 6 */
3857 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
3858 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
3859 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
3860 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
3861 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 11 */
3862 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 12 */
3863 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
3864 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 14 */
3865 (PID.TID 0000.0001) 9.008620045350865E+10, /* J = 15 */
3866 (PID.TID 0000.0001) 9.076111290418457E+10, /* J = 16 */
3867 (PID.TID 0000.0001) 9.076111290422060E+10, /* J = 17 */
3868 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
3869 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 19 */
3870 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
3871 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 21 */
3872 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 22 */
3873 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
3874 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
3875 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
3876 (PID.TID 0000.0001) 6.203683527772523E+10, /* J = 26 */
3877 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 27 */
3878 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
3879 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
3880 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
3881 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
3882 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
3883 (PID.TID 0000.0001) ;
3884 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( units: m^2 ) */
3885 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3886 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
3887 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
3888 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 4 */
3889 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 5 */
3890 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 6 */
3891 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 7 */
3892 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 8 */
3893 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 9 */
3894 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 10 */
3895 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 11 */
3896 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 12 */
3897 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 13 */
3898 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 14 */
3899 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 15 */
3900 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 16 */
3901 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 17 */
3902 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 18 */
3903 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 19 */
3904 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 20 */
3905 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 21 */
3906 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 22 */
3907 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 23 */
3908 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 24 */
3909 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 25 */
3910 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 26 */
3911 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 27 */
3912 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 28 */
3913 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 29 */
3914 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 30 */
3915 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 31 */
3916 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 32 */
3917 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 33 */
3918 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 34 */
3919 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 35 */
3920 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 36 */
3921 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 37 */
3922 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 38 */
3923 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 39 */
3924 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 40 */
3925 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 41 */
3926 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 42 */
3927 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 43 */
3928 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 44 */
3929 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 45 */
3930 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
3931 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 47 */
3932 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
3933 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
3934 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 50 */
3935 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
3936 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 52 */
3937 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 53 */
3938 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 54 */
3939 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 55 */
3940 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 56 */
3941 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 57 */
3942 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 58 */
3943 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 59 */
3944 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 60 */
3945 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 61 */
3946 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 62 */
3947 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 63 */
3948 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 64 */
3949 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 65 */
3950 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 66 */
3951 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 67 */
3952 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 68 */
3953 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 69 */
3954 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 70 */
3955 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 71 */
3956 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 72 */
3957 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 73 */
3958 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 74 */
3959 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 75 */
3960 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 76 */
3961 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 77 */
3962 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 78 */
3963 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 79 */
3964 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 80 */
3965 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 81 */
3966 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 82 */
3967 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 83 */
3968 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 84 */
3969 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 85 */
3970 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 86 */
3971 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 87 */
3972 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 88 */
3973 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 89 */
3974 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 90 */
3975 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 91 */
3976 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 92 */
3977 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 93 */
3978 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
3979 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
3980 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
3981 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
3982 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
3983 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
3984 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =100 */
3985 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =101 */
3986 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =102 */
3987 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =103 */
3988 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =104 */
3989 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =105 */
3990 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =106 */
3991 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =107 */
3992 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =108 */
3993 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =109 */
3994 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =110 */
3995 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =111 */
3996 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =112 */
3997 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =113 */
3998 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =114 */
3999 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =115 */
4000 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =116 */
4001 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =117 */
4002 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =118 */
4003 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =119 */
4004 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =120 */
4005 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =121 */
4006 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =122 */
4007 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =123 */
4008 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =124 */
4009 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =125 */
4010 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =126 */
4011 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =127 */
4012 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =128 */
4013 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =129 */
4014 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =130 */
4015 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =131 */
4016 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =132 */
4017 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =133 */
4018 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =134 */
4019 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =135 */
4020 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =136 */
4021 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =137 */
4022 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =138 */
4023 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =139 */
4024 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =140 */
4025 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =141 */
4026 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
4027 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =143 */
4028 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
4029 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
4030 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =146 */
4031 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
4032 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =148 */
4033 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =149 */
4034 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =150 */
4035 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =151 */
4036 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =152 */
4037 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =153 */
4038 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =154 */
4039 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =155 */
4040 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =156 */
4041 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =157 */
4042 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =158 */
4043 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =159 */
4044 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =160 */
4045 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =161 */
4046 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =162 */
4047 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =163 */
4048 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =164 */
4049 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =165 */
4050 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =166 */
4051 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =167 */
4052 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =168 */
4053 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =169 */
4054 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =170 */
4055 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =171 */
4056 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =172 */
4057 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =173 */
4058 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =174 */
4059 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =175 */
4060 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =176 */
4061 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =177 */
4062 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =178 */
4063 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =179 */
4064 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =180 */
4065 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =181 */
4066 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =182 */
4067 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =183 */
4068 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =184 */
4069 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =185 */
4070 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =186 */
4071 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =187 */
4072 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =188 */
4073 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =189 */
4074 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
4075 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
4076 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
4077 (PID.TID 0000.0001) ;
4078 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( units: m^2 ) */
4079 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
4080 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
4081 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
4082 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
4083 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 5 */
4084 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 6 */
4085 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 7 */
4086 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
4087 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 9 */
4088 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
4089 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 11 */
4090 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
4091 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 13 */
4092 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 14 */
4093 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
4094 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* J = 16: 17 */
4095 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
4096 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 19 */
4097 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 20 */
4098 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
4099 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 22 */
4100 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
4101 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 24 */
4102 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
4103 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 26 */
4104 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 27 */
4105 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 28 */
4106 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
4107 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
4108 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
4109 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
4110 (PID.TID 0000.0001) ;
4111 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( units: m^2 ) */
4112 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
4113 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
4114 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
4115 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 4 */
4116 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 5 */
4117 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 6 */
4118 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 7 */
4119 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 8 */
4120 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 9 */
4121 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 10 */
4122 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 11 */
4123 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 12 */
4124 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 13 */
4125 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 14 */
4126 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 15 */
4127 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 16: 17 */
4128 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 18 */
4129 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 19 */
4130 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 20 */
4131 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 21 */
4132 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 22 */
4133 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 23 */
4134 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 24 */
4135 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 25 */
4136 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 26 */
4137 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 27 */
4138 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 28 */
4139 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 29 */
4140 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 30 */
4141 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 31 */
4142 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 32: 33 */
4143 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 34 */
4144 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 35 */
4145 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 36 */
4146 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 37 */
4147 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 38 */
4148 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 39 */
4149 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 40 */
4150 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 41 */
4151 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 42 */
4152 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 43 */
4153 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 44 */
4154 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 45 */
4155 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 46 */
4156 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
4157 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 48: 49 */
4158 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
4159 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 51 */
4160 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 52 */
4161 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 53 */
4162 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 54 */
4163 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 55 */
4164 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 56 */
4165 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 57 */
4166 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 58 */
4167 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 59 */
4168 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 60 */
4169 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 61 */
4170 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 62 */
4171 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 63 */
4172 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 64: 65 */
4173 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 66 */
4174 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 67 */
4175 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 68 */
4176 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 69 */
4177 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 70 */
4178 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 71 */
4179 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 72 */
4180 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 73 */
4181 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 74 */
4182 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 75 */
4183 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 76 */
4184 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 77 */
4185 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 78 */
4186 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 79 */
4187 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 80: 81 */
4188 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 82 */
4189 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 83 */
4190 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 84 */
4191 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 85 */
4192 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 86 */
4193 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 87 */
4194 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 88 */
4195 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 89 */
4196 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 90 */
4197 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 91 */
4198 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 92 */
4199 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 93 */
4200 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
4201 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
4202 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 96: 97 */
4203 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
4204 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
4205 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =100 */
4206 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =101 */
4207 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =102 */
4208 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =103 */
4209 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =104 */
4210 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =105 */
4211 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =106 */
4212 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =107 */
4213 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =108 */
4214 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =109 */
4215 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =110 */
4216 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =111 */
4217 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =112:113 */
4218 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =114 */
4219 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =115 */
4220 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =116 */
4221 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =117 */
4222 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =118 */
4223 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =119 */
4224 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =120 */
4225 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =121 */
4226 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =122 */
4227 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =123 */
4228 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =124 */
4229 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =125 */
4230 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =126 */
4231 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =127 */
4232 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =128:129 */
4233 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =130 */
4234 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =131 */
4235 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =132 */
4236 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =133 */
4237 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =134 */
4238 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =135 */
4239 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =136 */
4240 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =137 */
4241 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =138 */
4242 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =139 */
4243 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =140 */
4244 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =141 */
4245 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =142 */
4246 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
4247 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =144:145 */
4248 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
4249 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =147 */
4250 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =148 */
4251 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =149 */
4252 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =150 */
4253 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =151 */
4254 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =152 */
4255 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =153 */
4256 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =154 */
4257 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =155 */
4258 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =156 */
4259 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =157 */
4260 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =158 */
4261 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =159 */
4262 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =160:161 */
4263 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =162 */
4264 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =163 */
4265 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =164 */
4266 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =165 */
4267 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =166 */
4268 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =167 */
4269 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =168 */
4270 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =169 */
4271 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =170 */
4272 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =171 */
4273 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =172 */
4274 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =173 */
4275 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =174 */
4276 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =175 */
4277 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =176:177 */
4278 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =178 */
4279 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =179 */
4280 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =180 */
4281 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =181 */
4282 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =182 */
4283 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =183 */
4284 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =184 */
4285 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =185 */
4286 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =186 */
4287 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =187 */
4288 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =188 */
4289 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =189 */
4290 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
4291 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
4292 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
4293 (PID.TID 0000.0001) ;
4294 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( units: m^2 ) */
4295 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
4296 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
4297 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
4298 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
4299 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
4300 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
4301 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 7 */
4302 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 8 */
4303 (PID.TID 0000.0001) 7.014205907741882E+10, /* J = 9 */
4304 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
4305 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
4306 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
4307 (PID.TID 0000.0001) 8.549360686473492E+10, /* J = 13 */
4308 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
4309 (PID.TID 0000.0001) 8.948571540392021E+10, /* J = 15 */
4310 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
4311 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
4312 (PID.TID 0000.0001) 9.049530583087070E+10, /* J = 18 */
4313 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
4314 (PID.TID 0000.0001) 8.781353403174185E+10, /* J = 20 */
4315 (PID.TID 0000.0001) 8.549360686467184E+10, /* J = 21 */
4316 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
4317 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
4318 (PID.TID 0000.0001) 7.484854821844795E+10, /* J = 24 */
4319 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
4320 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 26 */
4321 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 27 */
4322 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
4323 (PID.TID 0000.0001) 4.571243814190767E+10, /* J = 29 */
4324 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
4325 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
4326 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
4327 (PID.TID 0000.0001) ;
4328 (PID.TID 0000.0001) globalArea = /* Integrated horizontal Area (m^2) */
4329 (PID.TID 0000.0001) 3.638867375081598E+14
4330 (PID.TID 0000.0001) ;
4331 (PID.TID 0000.0001) // =======================================================
4332 (PID.TID 0000.0001) // End of Model config. summary
4333 (PID.TID 0000.0001) // =======================================================
4334 (PID.TID 0000.0001)
4335 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4336 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4337 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4338 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4339 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4340 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4341 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4342 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4343 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4344 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4345 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4346 (PID.TID 0000.0001) write diagnostics summary to file ioUnit: 6
4347 Iter.Nb: 36000 ; Time(s): 3.1104000000000E+09
4348 ------------------------------------------------------------------------
4349 2D/3D diagnostics: Number of lists: 3
4350 ------------------------------------------------------------------------
4351 listId= 1 ; file name: surfDiag
4352 nFlds, nActive, freq & phase , nLev
4353 12 | 12 |1555200000.000000 0.000000 | 1
4354 levels: 1
4355 diag#| name | ipt | iMate| kLev| count | mate.C|
4356 23 |ETAN | 1 | 0 | 1 | 0 |
4357 24 |ETANSQ | 2 | 0 | 1 | 0 |
4358 25 |DETADT2 | 3 | 0 | 1 | 0 |
4359 67 |PHIBOT | 4 | 0 | 1 | 0 |
4360 68 |PHIBOTSQ| 5 | 0 | 1 | 0 |
4361 71 |oceTAUX | 6 | 0 | 1 | 0 |
4362 72 |oceTAUY | 7 | 0 | 1 | 0 |
4363 84 |TFLUX | 8 | 0 | 1 | 0 |
4364 85 |SFLUX | 9 | 0 | 1 | 0 |
4365 79 |oceFreez| 10 | 0 | 1 | 0 |
4366 80 |TRELAX | 11 | 0 | 1 | 0 |
4367 81 |SRELAX | 12 | 0 | 1 | 0 |
4368 ------------------------------------------------------------------------
4369 listId= 2 ; file name: dynDiag
4370 nFlds, nActive, freq & phase , nLev
4371 15 | 15 |1555200000.000000 0.000000 | 15
4372 levels: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
4373 diag#| name | ipt | iMate| kLev| count | mate.C|
4374 30 |UVEL | 13 | 28 | 15 | 0 | 0 |
4375 31 |VVEL | 28 | 13 | 15 | 0 | 0 |
4376 32 |WVEL | 43 | 0 | 15 | 0 |
4377 65 |PHIHYD | 58 | 0 | 15 | 0 |
4378 44 |VVELMASS| 73 | 88 | 15 | 0 | 0 |
4379 43 |UVELMASS| 88 | 73 | 15 | 0 | 0 |
4380 38 |WVELSQ | 103 | 0 | 15 | 0 |
4381 26 |THETA | 118 | 0 | 15 | 0 |
4382 46 |UTHMASS | 133 | 148 | 15 | 0 | 0 |
4383 47 |VTHMASS | 148 | 133 | 15 | 0 | 0 |
4384 48 |WTHMASS | 163 | 0 | 15 | 0 |
4385 27 |SALT | 178 | 0 | 15 | 0 |
4386 49 |USLTMASS| 193 | 208 | 15 | 0 | 0 |
4387 50 |VSLTMASS| 208 | 193 | 15 | 0 | 0 |
4388 51 |WSLTMASS| 223 | 0 | 15 | 0 |
4389 ------------------------------------------------------------------------
4390 listId= 3 ; file name: thSIceDiag
4391 nFlds, nActive, freq & phase , nLev
4392 16 | 16 |1555200000.000000 0.000000 | 1
4393 levels: 1
4394 diag#| name | ipt | iMate| kLev| count | mate.C|
4395 181 |SI_Fract| 238 | 0 | 1 | 0(x12) |
4396 182 |SI_Thick| 250 | 238 | 1 | 0(x12) |
4397 183 |SI_SnowH| 262 | 238 | 1 | 0(x12) |
4398 184 |SI_Tsrf | 274 | 238 | 1 | 0(x12) |
4399 185 |SI_Tice1| 286 | 238 | 1 | 0(x12) |
4400 186 |SI_Tice2| 298 | 238 | 1 | 0(x12) |
4401 187 |SI_Qice1| 310 | 250 | 1 | 0(x12) |
4402 188 |SI_Qice2| 322 | 250 | 1 | 0(x12) |
4403 190 |SIsnwAge| 334 | 0 | 1 | 0(x12) |
4404 191 |SIsnwPrc| 346 | 238 | 1 | 0(x12) |
4405 189 |SIalbedo| 358 | 238 | 1 | 0(x12) |
4406 194 |SIflx2oc| 370 | 0 | 1 | 0(x12) |
4407 195 |SIfrw2oc| 382 | 0 | 1 | 0(x12) |
4408 196 |SIsaltFx| 394 | 0 | 1 | 0(x12) |
4409 192 |SIflxAtm| 406 | 0 | 1 | 0(x12) |
4410 193 |SIfrwAtm| 418 | 0 | 1 | 0(x12) |
4411 ------------------------------------------------------------------------
4412 Global & Regional Statistics diagnostics: Number of lists: 2
4413 ------------------------------------------------------------------------
4414 listId= 1 ; file name: dynStDiag
4415 nFlds, nActive, freq & phase |
4416 8 | 8 | 864000.000000 0.000000 |
4417 Regions: 0
4418 diag#| name | ipt | iMate| Volume | mate-Vol. |
4419 23 |ETAN | 1 | 0 | 0.00000E+00 |
4420 30 |UVEL | 2 | 0 | 0.00000E+00 |
4421 31 |VVEL | 17 | 0 | 0.00000E+00 |
4422 32 |WVEL | 32 | 0 | 0.00000E+00 |
4423 26 |THETA | 47 | 0 | 0.00000E+00 |
4424 27 |SALT | 62 | 0 | 0.00000E+00 |
4425 70 |CONVADJ | 77 | 0 | 0.00000E+00 |
4426 25 |DETADT2 | 92 | 0 | 0.00000E+00 |
4427 ------------------------------------------------------------------------
4428 listId= 2 ; file name: thSIceStDiag
4429 nFlds, nActive, freq & phase |
4430 16 | 16 | 864000.000000 0.000000 |
4431 Regions: 0 1 3
4432 diag#| name | ipt | iMate| Volume | mate-Vol. |
4433 181 |SI_Fract| 93 | 0 | 0.00000E+00 |
4434 182 |SI_Thick| 94 | 93 | 0.00000E+00 | 0.00000E+00 |
4435 183 |SI_SnowH| 95 | 93 | 0.00000E+00 | 0.00000E+00 |
4436 184 |SI_Tsrf | 96 | 93 | 0.00000E+00 | 0.00000E+00 |
4437 185 |SI_Tice1| 97 | 93 | 0.00000E+00 | 0.00000E+00 |
4438 186 |SI_Tice2| 98 | 93 | 0.00000E+00 | 0.00000E+00 |
4439 187 |SI_Qice1| 99 | 94 | 0.00000E+00 | 0.00000E+00 |
4440 188 |SI_Qice2| 100 | 94 | 0.00000E+00 | 0.00000E+00 |
4441 191 |SIsnwPrc| 101 | 93 | 0.00000E+00 | 0.00000E+00 |
4442 189 |SIalbedo| 102 | 93 | 0.00000E+00 | 0.00000E+00 |
4443 190 |SIsnwAge| 103 | 0 | 0.00000E+00 |
4444 194 |SIflx2oc| 104 | 0 | 0.00000E+00 |
4445 195 |SIfrw2oc| 105 | 0 | 0.00000E+00 |
4446 196 |SIsaltFx| 106 | 0 | 0.00000E+00 |
4447 192 |SIflxAtm| 107 | 0 | 0.00000E+00 |
4448 193 |SIfrwAtm| 108 | 0 | 0.00000E+00 |
4449 ------------------------------------------------------------------------
4450 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4451 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4452 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4453 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4454 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4455 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4456 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4457 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4458 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4459 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4460 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4461 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4462 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4463 (PID.TID 0000.0001) // =======================================================
4464 (PID.TID 0000.0001) // Model current state
4465 (PID.TID 0000.0001) // =======================================================
4466 (PID.TID 0000.0001)
4467 (PID.TID 0000.0001) // =======================================================
4468 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4469 (PID.TID 0000.0001) // =======================================================
4470 (PID.TID 0000.0001) %MON time_tsnumber = 36000
4471 (PID.TID 0000.0001) %MON time_secondsf = 3.1104000000000E+09
4472 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3500434503471E-01
4473 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1986891348601E+01
4474 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8045564487853E-01
4475 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6994311255501E+00
4476 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6453306471101E-02
4477 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7235154042170E-01
4478 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7145887709522E-01
4479 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2887824837157E-04
4480 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2989468965472E-02
4481 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7920186340225E-03
4482 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9306786753954E-01
4483 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1050631286072E-01
4484 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2470116939793E-04
4485 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3472945317820E-02
4486 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8319026986974E-03
4487 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3888727589247E-05
4488 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7681850941337E-04
4489 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.2631701181818E-09
4490 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6274614748344E-06
4491 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1378775396729E-06
4492 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0162021109834E+01
4493 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.5087736803077E+00
4494 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5027154873320E+00
4495 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7490175075967E+00
4496 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5106365389722E-02
4497 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0815425249776E+01
4498 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8030178312691E+01
4499 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756092396968E+01
4500 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1193688315107E-01
4501 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0020089713970E-02
4502 (PID.TID 0000.0001) %MON extforcing_qnet_max = 0.0000000000000E+00
4503 (PID.TID 0000.0001) %MON extforcing_qnet_min = 0.0000000000000E+00
4504 (PID.TID 0000.0001) %MON extforcing_qnet_mean = 0.0000000000000E+00
4505 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 0.0000000000000E+00
4506 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 0.0000000000000E+00
4507 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4508 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4509 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4510 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4511 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4512 (PID.TID 0000.0001) %MON extforcing_empmr_max = 0.0000000000000E+00
4513 (PID.TID 0000.0001) %MON extforcing_empmr_min = 0.0000000000000E+00
4514 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 0.0000000000000E+00
4515 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 0.0000000000000E+00
4516 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 0.0000000000000E+00
4517 (PID.TID 0000.0001) %MON extforcing_fu_max = 2.4892781143428E-01
4518 (PID.TID 0000.0001) %MON extforcing_fu_min = -2.1535754027523E-01
4519 (PID.TID 0000.0001) %MON extforcing_fu_mean = -1.5044401616678E-03
4520 (PID.TID 0000.0001) %MON extforcing_fu_sd = 6.2251894339929E-02
4521 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 4.9965835202135E-03
4522 (PID.TID 0000.0001) %MON extforcing_fv_max = 2.9305960402537E-01
4523 (PID.TID 0000.0001) %MON extforcing_fv_min = -3.3950131228473E-01
4524 (PID.TID 0000.0001) %MON extforcing_fv_mean = -5.6789986032871E-03
4525 (PID.TID 0000.0001) %MON extforcing_fv_sd = 7.0480050409315E-02
4526 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 4.8186630840511E-03
4527 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6990886762546E-02
4528 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4155563479013E-02
4529 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7649506465342E-02
4530 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3178433447991E-01
4531 (PID.TID 0000.0001) %MON pe_b_mean = 4.2969665467446E-03
4532 (PID.TID 0000.0001) %MON ke_max = 3.6920742855791E-02
4533 (PID.TID 0000.0001) %MON ke_mean = 1.6194090277160E-04
4534 (PID.TID 0000.0001) %MON ke_vol = 1.3395912415612E+18
4535 (PID.TID 0000.0001) %MON vort_r_min = -1.2103928619458E-06
4536 (PID.TID 0000.0001) %MON vort_r_max = 1.3658356323918E-06
4537 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4538 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054014221264E-05
4539 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719485005016E-05
4540 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782267184684E-04
4541 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.4664546923379E-08
4542 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 2.0573162615946E-08
4543 (PID.TID 0000.0001) // =======================================================
4544 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4545 (PID.TID 0000.0001) // =======================================================
4546 (PID.TID 0000.0001) // =======================================================
4547 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4548 (PID.TID 0000.0001) // =======================================================
4549 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1104000000000E+09
4550 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4716044426698E+13
4551 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.2123515471256E+13
4552 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2592528955442E+13
4553 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5665991101486E+00
4554 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.6548113929333E+00
4555 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5189177037341E+00
4556 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4557 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4558 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0642325960795E+00
4559 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.8039252994821E+00
4560 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5209002603598E-01
4561 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920173287519E+00
4562 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933581672150E+00
4563 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7927617991529E+22
4564 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6644740861567E+01
4565 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.2271804409750E-01
4566 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2551394715834E+01
4567 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.2879155123950E+00
4568 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6099403861095E+01
4569 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4570 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -1.7223298637424E+00
4571 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.3503593345479E+00
4572 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1859254669298E+00
4573 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3246125323351E+01
4574 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.7372153208148E+01
4575 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0584120855350E+01
4576 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -1.5363024655854E-01
4577 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -5.8630083767312E-01
4578 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.7701031784537E+00
4579 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1173552909385E+00
4580 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.7799839472262E+00
4581 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.8326933331569E+00
4582 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.3985906582730E+00
4583 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.1778332319913E+00
4584 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.1561961802541E+00
4585 (PID.TID 0000.0001) // =======================================================
4586 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4587 (PID.TID 0000.0001) // =======================================================
4588 S/R BULKF_FIELDS_LOAD: Reading new data: 12 1 36000 3.110400000000E+09
4589 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_tair_cs.bin
4590 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_tair_cs.bin
4591 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_qair_cs.bin
4592 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_qair_cs.bin
4593 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downsolar_cs.bin
4594 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downsolar_cs.bin
4595 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downlw_cs.bin
4596 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downlw_cs.bin
4597 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_windspeed_cs.bin
4598 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_windspeed_cs.bin
4599 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_pr_scal_cs.bin
4600 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_pr_scal_cs.bin
4601 S/R EXTERNAL_FIELDS_LOAD: Reading new data: 12 1 36000 3.110400000000E+09
4602 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4603 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4604 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4605 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4606 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4607 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4608 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4609 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4610 cg2d: Sum(rhs),rhsMax = 3.90289325938286E+02 2.29381049687594E+02
4611 (PID.TID 0000.0001) cg2d_init_res = 2.72226824003653E+00
4612 (PID.TID 0000.0001) cg2d_iters = 70
4613 (PID.TID 0000.0001) cg2d_res = 5.23489116409268E-07
4614 (PID.TID 0000.0001) // =======================================================
4615 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4616 (PID.TID 0000.0001) // =======================================================
4617 (PID.TID 0000.0001) %MON time_tsnumber = 36001
4618 (PID.TID 0000.0001) %MON time_secondsf = 3.1104864000000E+09
4619 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3364164879859E-01
4620 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1985262839272E+01
4621 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8049410898974E-01
4622 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6988083963297E+00
4623 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6452590000758E-02
4624 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7283785322873E-01
4625 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7114247823162E-01
4626 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2855026675769E-04
4627 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2989432141127E-02
4628 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7920769731559E-03
4629 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9354675233826E-01
4630 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1061392972789E-01
4631 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2479013027779E-04
4632 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3474904197754E-02
4633 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8307943717889E-03
4634 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3873825771363E-05
4635 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7706104088122E-04
4636 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.1123915672728E-09
4637 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6270069344646E-06
4638 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1368855083104E-06
4639 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0146913789449E+01
4640 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.5027137017355E+00
4641 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5027708413056E+00
4642 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7490710016378E+00
4643 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5258934667259E-02
4644 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0818099758811E+01
4645 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8030808752363E+01
4646 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756093444270E+01
4647 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1192753002860E-01
4648 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0043601737515E-02
4649 (PID.TID 0000.0001) %MON extforcing_qnet_max = 7.7549616936275E+02
4650 (PID.TID 0000.0001) %MON extforcing_qnet_min = -2.4069156055538E+02
4651 (PID.TID 0000.0001) %MON extforcing_qnet_mean = -4.4721104550911E+00
4652 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 1.2156430563105E+02
4653 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 1.2206400577027E+01
4654 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4655 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4656 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4657 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4658 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4659 (PID.TID 0000.0001) %MON extforcing_empmr_max = 9.4768243132575E-07
4660 (PID.TID 0000.0001) %MON extforcing_empmr_min = -4.0448513424106E-07
4661 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 4.6076799885593E-10
4662 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 5.9444449466385E-08
4663 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 9.2366607943261E-09
4664 (PID.TID 0000.0001) %MON extforcing_fu_max = 2.4760613571392E-01
4665 (PID.TID 0000.0001) %MON extforcing_fu_min = -1.9244755495625E-01
4666 (PID.TID 0000.0001) %MON extforcing_fu_mean = -1.4713067633654E-03
4667 (PID.TID 0000.0001) %MON extforcing_fu_sd = 6.1390754177136E-02
4668 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 3.3540311124505E-03
4669 (PID.TID 0000.0001) %MON extforcing_fv_max = 2.5281098043587E-01
4670 (PID.TID 0000.0001) %MON extforcing_fv_min = -3.2691992401999E-01
4671 (PID.TID 0000.0001) %MON extforcing_fv_mean = -4.7616642545506E-03
4672 (PID.TID 0000.0001) %MON extforcing_fv_sd = 6.7215108136440E-02
4673 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 3.3046708266940E-03
4674 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6901150043157E-02
4675 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4364302616145E-02
4676 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7728580875990E-02
4677 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3123583025944E-01
4678 (PID.TID 0000.0001) %MON pe_b_mean = -1.9133641844718E-03
4679 (PID.TID 0000.0001) %MON ke_max = 3.6816950973246E-02
4680 (PID.TID 0000.0001) %MON ke_mean = 1.6196482659883E-04
4681 (PID.TID 0000.0001) %MON ke_vol = 1.3395912252519E+18
4682 (PID.TID 0000.0001) %MON vort_r_min = -1.2135055973192E-06
4683 (PID.TID 0000.0001) %MON vort_r_max = 1.3680147941269E-06
4684 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4685 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054014056508E-05
4686 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719484734269E-05
4687 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782267838298E-04
4688 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.2657406153308E-08
4689 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8729880161429E-08
4690 (PID.TID 0000.0001) // =======================================================
4691 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4692 (PID.TID 0000.0001) // =======================================================
4693 (PID.TID 0000.0001) // =======================================================
4694 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4695 (PID.TID 0000.0001) // =======================================================
4696 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1104864000000E+09
4697 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4728883099595E+13
4698 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.2065961868429E+13
4699 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2662921231167E+13
4700 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5654407614691E+00
4701 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.6742582922090E+00
4702 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5088954508955E+00
4703 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4704 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4705 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0588371685031E+00
4706 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7996814543254E+00
4707 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5291799393107E-01
4708 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920142046519E+00
4709 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933709551204E+00
4710 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7928505610144E+22
4711 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6732848320405E+01
4712 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.0597900522313E-01
4713 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2575888602023E+01
4714 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3043441467213E+00
4715 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6213990021686E+01
4716 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4717 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -6.7474323125520E+00
4718 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.3787022045759E+00
4719 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1656406927223E+00
4720 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3329620458183E+01
4721 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.7216897768510E+01
4722 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0666395739877E+01
4723 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -2.1831092533945E-01
4724 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -5.9497842414135E-01
4725 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.7829629711607E+00
4726 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1140487668830E+00
4727 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.8136745002859E+00
4728 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.8094598422842E+00
4729 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.4380986141887E+00
4730 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.1539915958877E+00
4731 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.1753502729289E+00
4732 (PID.TID 0000.0001) // =======================================================
4733 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4734 (PID.TID 0000.0001) // =======================================================
4735 cg2d: Sum(rhs),rhsMax = 3.90298796408743E+02 2.29444544707321E+02
4736 (PID.TID 0000.0001) cg2d_init_res = 2.71308605027915E+00
4737 (PID.TID 0000.0001) cg2d_iters = 70
4738 (PID.TID 0000.0001) cg2d_res = 4.90256327973350E-07
4739 (PID.TID 0000.0001) // =======================================================
4740 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4741 (PID.TID 0000.0001) // =======================================================
4742 (PID.TID 0000.0001) %MON time_tsnumber = 36002
4743 (PID.TID 0000.0001) %MON time_secondsf = 3.1105728000000E+09
4744 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3228517042750E-01
4745 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1983690939175E+01
4746 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8050819482798E-01
4747 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6981894458467E+00
4748 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6466435880585E-02
4749 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7327218931753E-01
4750 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7081469137613E-01
4751 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2815246466662E-04
4752 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2989186453492E-02
4753 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7921141167682E-03
4754 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9396956883914E-01
4755 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1072476095831E-01
4756 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2477305633567E-04
4757 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3476968635429E-02
4758 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8296602694059E-03
4759 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3825772543285E-05
4760 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7739767363231E-04
4761 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.1695329633537E-09
4762 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6271943561189E-06
4763 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1367604859388E-06
4764 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0130334922152E+01
4765 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.4965484170856E+00
4766 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5028259663660E+00
4767 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7491309249140E+00
4768 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5345806817354E-02
4769 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0820622897724E+01
4770 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8031424297812E+01
4771 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756094316126E+01
4772 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1191960987484E-01
4773 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0051733059192E-02
4774 (PID.TID 0000.0001) %MON extforcing_qnet_max = 7.7879844478951E+02
4775 (PID.TID 0000.0001) %MON extforcing_qnet_min = -2.4011430029303E+02
4776 (PID.TID 0000.0001) %MON extforcing_qnet_mean = -4.4171504379692E+00
4777 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 1.2143076637173E+02
4778 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 1.2283389419199E+01
4779 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4780 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4781 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4782 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4783 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4784 (PID.TID 0000.0001) %MON extforcing_empmr_max = 5.9641914073401E-07
4785 (PID.TID 0000.0001) %MON extforcing_empmr_min = -3.9953529779390E-07
4786 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 1.6873660385344E-10
4787 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 5.5687578096415E-08
4788 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 8.8379359343702E-09
4789 (PID.TID 0000.0001) %MON extforcing_fu_max = 2.4755808644372E-01
4790 (PID.TID 0000.0001) %MON extforcing_fu_min = -1.9021211852269E-01
4791 (PID.TID 0000.0001) %MON extforcing_fu_mean = -1.4735151054632E-03
4792 (PID.TID 0000.0001) %MON extforcing_fu_sd = 6.1360460766495E-02
4793 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 3.3527300417974E-03
4794 (PID.TID 0000.0001) %MON extforcing_fv_max = 2.5549422200851E-01
4795 (PID.TID 0000.0001) %MON extforcing_fv_min = -3.2770782795392E-01
4796 (PID.TID 0000.0001) %MON extforcing_fv_mean = -4.8228167834891E-03
4797 (PID.TID 0000.0001) %MON extforcing_fv_sd = 6.7376925509786E-02
4798 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 3.3051312271693E-03
4799 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6808183473254E-02
4800 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4548602372150E-02
4801 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7838335855969E-02
4802 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3061251564728E-01
4803 (PID.TID 0000.0001) %MON pe_b_mean = -1.9120546454300E-03
4804 (PID.TID 0000.0001) %MON ke_max = 3.6710234873888E-02
4805 (PID.TID 0000.0001) %MON ke_mean = 1.6198750794251E-04
4806 (PID.TID 0000.0001) %MON ke_vol = 1.3395912112553E+18
4807 (PID.TID 0000.0001) %MON vort_r_min = -1.2169537851385E-06
4808 (PID.TID 0000.0001) %MON vort_r_max = 1.3705438311723E-06
4809 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4810 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054013911548E-05
4811 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719484499731E-05
4812 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782268719075E-04
4813 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.3557898668425E-08
4814 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8821459009103E-08
4815 (PID.TID 0000.0001) // =======================================================
4816 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4817 (PID.TID 0000.0001) // =======================================================
4818 (PID.TID 0000.0001) // =======================================================
4819 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4820 (PID.TID 0000.0001) // =======================================================
4821 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1105728000000E+09
4822 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4705533343767E+13
4823 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.2008133744738E+13
4824 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2697399599029E+13
4825 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5704225751699E+00
4826 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.6940423647804E+00
4827 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5077973811965E+00
4828 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4829 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4830 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0553613525399E+00
4831 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7961539398663E+00
4832 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5478196253589E-01
4833 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920110700155E+00
4834 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933837398610E+00
4835 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7925464887216E+22
4836 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6860676611376E+01
4837 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.2618544221201E-01
4838 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2686752379269E+01
4839 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3207316990421E+00
4840 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6328624533670E+01
4841 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4842 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -7.6783593043140E+00
4843 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.4026736391094E+00
4844 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1397427775930E+00
4845 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3411717044333E+01
4846 (PI