ViewVC logotype

Contents of /MITgcm/verification/global_ocean.cs32x15/results/output.thsice.txt

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph

Revision 1.1 - (show annotations) (download)
Fri Jul 14 21:47:50 2006 UTC (16 years, 1 month ago) by jmc
Branch: MAIN
CVS Tags: checkpoint58r_post, checkpoint58n_post, checkpoint58q_post, checkpoint58o_post, checkpoint58p_post, checkpoint58m_post
File MIME type: text/plain
move output.txt.thsice & output.txt.viscA4 to output.thsice.txt & output.viscA4.txt

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint58e_post
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: faulks
11 (PID.TID 0000.0001) // Build date: Thu May 25 13:43:48 EDT 2006
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx - No. threads per process in X
19 (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20 (PID.TID 0000.0001) > &EEPARMS
21 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
22 (PID.TID 0000.0001) > nTx=1,
23 (PID.TID 0000.0001) > nTy=1,
24 (PID.TID 0000.0001) > &
25 (PID.TID 0000.0001) ># Note: Some systems use & as the
26 (PID.TID 0000.0001) ># namelist terminator. Other systems
27 (PID.TID 0000.0001) ># use a / character (as shown here).
28 (PID.TID 0000.0001)
29 (PID.TID 0000.0001) // =======================================================
30 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
31 (PID.TID 0000.0001) // ( and "eedata" )
32 (PID.TID 0000.0001) // =======================================================
33 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
34 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
35 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
36 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
37 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
38 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
39 (PID.TID 0000.0001) OLx = 3 ; /* Tile overlap distance in X */
40 (PID.TID 0000.0001) OLy = 3 ; /* Tile overlap distance in Y */
41 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
42 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
43 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
44 (PID.TID 0000.0001) nX = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
45 (PID.TID 0000.0001) nY = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
46 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
47 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
48 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
49 (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
50 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
51 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
52 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
53 (PID.TID 0000.0001) useCoupler= F ; /* Flag used to control communications with */
54 (PID.TID 0000.0001) /* other model components, through a coupler */
55 (PID.TID 0000.0001)
56 (PID.TID 0000.0001) // ======================================================
57 (PID.TID 0000.0001) // Mapping of tiles to threads
58 (PID.TID 0000.0001) // ======================================================
59 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
60 (PID.TID 0000.0001)
61 (PID.TID 0000.0001) // ======================================================
62 (PID.TID 0000.0001) // Tile <-> Tile connectvity table
63 (PID.TID 0000.0001) // ======================================================
64 (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000001)
65 (PID.TID 0000.0001) // WEST: Tile = 000006, Process = 000001, Comm = put
66 (PID.TID 0000.0001) // bi = 000006, bj = 000001
67 (PID.TID 0000.0001) // EAST: Tile = 000002, Process = 000001, Comm = put
68 (PID.TID 0000.0001) // bi = 000002, bj = 000001
69 (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000001, Comm = put
70 (PID.TID 0000.0001) // bi = 000001, bj = 000001
71 (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000001, Comm = put
72 (PID.TID 0000.0001) // bi = 000001, bj = 000001
73 (PID.TID 0000.0001) // Tile number: 000002 (process no. = 000001)
74 (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000001, Comm = put
75 (PID.TID 0000.0001) // bi = 000001, bj = 000001
76 (PID.TID 0000.0001) // EAST: Tile = 000003, Process = 000001, Comm = put
77 (PID.TID 0000.0001) // bi = 000003, bj = 000001
78 (PID.TID 0000.0001) // SOUTH: Tile = 000002, Process = 000001, Comm = put
79 (PID.TID 0000.0001) // bi = 000002, bj = 000001
80 (PID.TID 0000.0001) // NORTH: Tile = 000002, Process = 000001, Comm = put
81 (PID.TID 0000.0001) // bi = 000002, bj = 000001
82 (PID.TID 0000.0001) // Tile number: 000003 (process no. = 000001)
83 (PID.TID 0000.0001) // WEST: Tile = 000002, Process = 000001, Comm = put
84 (PID.TID 0000.0001) // bi = 000002, bj = 000001
85 (PID.TID 0000.0001) // EAST: Tile = 000004, Process = 000001, Comm = put
86 (PID.TID 0000.0001) // bi = 000004, bj = 000001
87 (PID.TID 0000.0001) // SOUTH: Tile = 000003, Process = 000001, Comm = put
88 (PID.TID 0000.0001) // bi = 000003, bj = 000001
89 (PID.TID 0000.0001) // NORTH: Tile = 000003, Process = 000001, Comm = put
90 (PID.TID 0000.0001) // bi = 000003, bj = 000001
91 (PID.TID 0000.0001) // Tile number: 000004 (process no. = 000001)
92 (PID.TID 0000.0001) // WEST: Tile = 000003, Process = 000001, Comm = put
93 (PID.TID 0000.0001) // bi = 000003, bj = 000001
94 (PID.TID 0000.0001) // EAST: Tile = 000005, Process = 000001, Comm = put
95 (PID.TID 0000.0001) // bi = 000005, bj = 000001
96 (PID.TID 0000.0001) // SOUTH: Tile = 000004, Process = 000001, Comm = put
97 (PID.TID 0000.0001) // bi = 000004, bj = 000001
98 (PID.TID 0000.0001) // NORTH: Tile = 000004, Process = 000001, Comm = put
99 (PID.TID 0000.0001) // bi = 000004, bj = 000001
100 (PID.TID 0000.0001) // Tile number: 000005 (process no. = 000001)
101 (PID.TID 0000.0001) // WEST: Tile = 000004, Process = 000001, Comm = put
102 (PID.TID 0000.0001) // bi = 000004, bj = 000001
103 (PID.TID 0000.0001) // EAST: Tile = 000006, Process = 000001, Comm = put
104 (PID.TID 0000.0001) // bi = 000006, bj = 000001
105 (PID.TID 0000.0001) // SOUTH: Tile = 000005, Process = 000001, Comm = put
106 (PID.TID 0000.0001) // bi = 000005, bj = 000001
107 (PID.TID 0000.0001) // NORTH: Tile = 000005, Process = 000001, Comm = put
108 (PID.TID 0000.0001) // bi = 000005, bj = 000001
109 (PID.TID 0000.0001) // Tile number: 000006 (process no. = 000001)
110 (PID.TID 0000.0001) // WEST: Tile = 000005, Process = 000001, Comm = put
111 (PID.TID 0000.0001) // bi = 000005, bj = 000001
112 (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000001, Comm = put
113 (PID.TID 0000.0001) // bi = 000001, bj = 000001
114 (PID.TID 0000.0001) // SOUTH: Tile = 000006, Process = 000001, Comm = put
115 (PID.TID 0000.0001) // bi = 000006, bj = 000001
116 (PID.TID 0000.0001) // NORTH: Tile = 000006, Process = 000001, Comm = put
117 (PID.TID 0000.0001) // bi = 000006, bj = 000001
118 (PID.TID 0000.0001)
119 (PID.TID 0000.0001) ===== W2 TILE TOPLOGY =====
120 (PID.TID 0000.0001) TILE: 1
121 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
122 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
123 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
124 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
125 (PID.TID 0000.0001) TILE: 2
126 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
127 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
128 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
129 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
130 (PID.TID 0000.0001) TILE: 3
131 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
132 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
133 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
134 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
135 (PID.TID 0000.0001) TILE: 4
136 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
137 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
138 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
139 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
140 (PID.TID 0000.0001) TILE: 5
141 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
142 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
143 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
144 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
145 (PID.TID 0000.0001) TILE: 6
146 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
147 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
148 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
149 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
150 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 35: -2, j= 30: 32
151 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 3(proc = 1)
152 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= -2: 35, j= 1: 3
153 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 6(proc = 1)
154 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 30: 32, j= -2: 35
155 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 2(proc = 1)
156 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 1: 3, j= 35: -2
157 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 5(proc = 1)
158 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= -2: 35, j= 30: 32
159 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 3(proc = 1)
160 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 35: -2, j= 1: 3
161 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 6(proc = 1)
162 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 30: 32, j= 35: -2
163 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 4(proc = 1)
164 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 1: 3, j= -2: 35
165 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 1(proc = 1)
166 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 35: -2, j= 30: 32
167 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 5(proc = 1)
168 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= -2: 35, j= 1: 3
169 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 2(proc = 1)
170 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 30: 32, j= -2: 35
171 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 4(proc = 1)
172 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 1: 3, j= 35: -2
173 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 1(proc = 1)
174 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= -2: 35, j= 30: 32
175 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 5(proc = 1)
176 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 35: -2, j= 1: 3
177 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 2(proc = 1)
178 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 30: 32, j= 35: -2
179 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 6(proc = 1)
180 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 1: 3, j= -2: 35
181 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 3(proc = 1)
182 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 35: -2, j= 30: 32
183 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 1(proc = 1)
184 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= -2: 35, j= 1: 3
185 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 4(proc = 1)
186 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 30: 32, j= -2: 35
187 (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 6(proc = 1)
188 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 1: 3, j= 35: -2
189 (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 3(proc = 1)
190 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= -2: 35, j= 30: 32
191 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 1(proc = 1)
192 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 35: -2, j= 1: 3
193 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 4(proc = 1)
194 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 30: 32, j= 35: -2
195 (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 2(proc = 1)
196 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 1: 3, j= -2: 35
197 (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 5(proc = 1)
198 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
199 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
200 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
201 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
202 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
203 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
204 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
205 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
206 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
207 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
208 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
209 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
210 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
211 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
212 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
213 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
214 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
215 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
216 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
217 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
218 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
219 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
220 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
221 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
222 (PID.TID 0000.0001) // =======================================================
223 (PID.TID 0000.0001) // Model parameter file "data"
224 (PID.TID 0000.0001) // =======================================================
225 (PID.TID 0000.0001) ># ====================
226 (PID.TID 0000.0001) ># | Model parameters |
227 (PID.TID 0000.0001) ># ====================
228 (PID.TID 0000.0001) >#
229 (PID.TID 0000.0001) ># Continuous equation parameters
230 (PID.TID 0000.0001) > &PARM01
231 (PID.TID 0000.0001) > tRef=15*20.,
232 (PID.TID 0000.0001) > sRef=15*35.,
233 (PID.TID 0000.0001) > viscAh =3.E5,
234 (PID.TID 0000.0001) > viscAr =1.E-3,
235 (PID.TID 0000.0001) > diffKhT=0.,
236 (PID.TID 0000.0001) > diffK4T=0.,
237 (PID.TID 0000.0001) > diffKrT=3.E-5,
238 (PID.TID 0000.0001) > diffKhS=0.,
239 (PID.TID 0000.0001) > diffK4S=0.,
240 (PID.TID 0000.0001) > diffKrS=3.E-5,
241 (PID.TID 0000.0001) > ivdc_kappa=10.,
242 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
243 (PID.TID 0000.0001) > rotationPeriod=86400.,
244 (PID.TID 0000.0001) > gravity=9.81,
245 (PID.TID 0000.0001) > rhonil=1035.,
246 (PID.TID 0000.0001) > rhoConstFresh=1000.,
247 (PID.TID 0000.0001) > eosType='JMD95Z',
248 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
249 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
250 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
251 (PID.TID 0000.0001) > exactConserv=.TRUE.,
252 (PID.TID 0000.0001) > select_rStar=2,
253 (PID.TID 0000.0001) > nonlinFreeSurf=4,
254 (PID.TID 0000.0001) > hFacInf=0.2,
255 (PID.TID 0000.0001) > hFacSup=2.0,
256 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
257 (PID.TID 0000.0001) > hFacMin=.1,
258 (PID.TID 0000.0001) > hFacMinDr=20.,
259 (PID.TID 0000.0001) > readBinaryPrec=64,
260 (PID.TID 0000.0001) >#writeBinaryPrec=64,
261 (PID.TID 0000.0001) > &
262 (PID.TID 0000.0001) >
263 (PID.TID 0000.0001) ># Elliptic solver parameters
264 (PID.TID 0000.0001) > &PARM02
265 (PID.TID 0000.0001) > cg2dMaxIters=200,
266 (PID.TID 0000.0001) >#cg2dTargetResidual=1.E-9,
267 (PID.TID 0000.0001) > cg2dTargetResWunit=1.E-14,
268 (PID.TID 0000.0001) > &
269 (PID.TID 0000.0001) >
270 (PID.TID 0000.0001) ># Time stepping parameters
271 (PID.TID 0000.0001) > &PARM03
272 (PID.TID 0000.0001) > nIter0=36000,
273 (PID.TID 0000.0001) > nTimeSteps=20,
274 (PID.TID 0000.0001) > deltaTmom =1200.,
275 (PID.TID 0000.0001) > deltaTtracer=86400.,
276 (PID.TID 0000.0001) > deltaTfreesurf=86400.,
277 (PID.TID 0000.0001) > deltaTClock =86400.,
278 (PID.TID 0000.0001) > abEps = 0.1,
279 (PID.TID 0000.0001) >#forcing_In_AB=.FALSE.,
280 (PID.TID 0000.0001) > tracForcingOutAB=1,
281 (PID.TID 0000.0001) > pChkptFreq =31104000.,
282 (PID.TID 0000.0001) > taveFreq =31104000.,
283 (PID.TID 0000.0001) > dumpFreq =31104000.,
284 (PID.TID 0000.0001) > monitorFreq =2592000.,
285 (PID.TID 0000.0001) >#tave_lastIter=0.,
286 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
287 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
288 (PID.TID 0000.0001) > externForcingCycle=31104000.,
289 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
290 (PID.TID 0000.0001) > tauThetaClimRelax = 5184000.,
291 (PID.TID 0000.0001) ># 6 months restoring timescale for salinity
292 (PID.TID 0000.0001) > tauSaltClimRelax = 15552000.,
293 (PID.TID 0000.0001) > latBandClimRelax=50.,
294 (PID.TID 0000.0001) > monitorFreq =1.,
295 (PID.TID 0000.0001) > &
296 (PID.TID 0000.0001) >
297 (PID.TID 0000.0001) ># Gridding parameters
298 (PID.TID 0000.0001) > &PARM04
299 (PID.TID 0000.0001) > usingCartesianGrid=.FALSE.,
300 (PID.TID 0000.0001) > usingSphericalPolarGrid=.FALSE.,
301 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
302 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
303 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
304 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
305 (PID.TID 0000.0001) > &
306 (PID.TID 0000.0001) >
307 (PID.TID 0000.0001) ># Input datasets
308 (PID.TID 0000.0001) > &PARM05
309 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
310 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
311 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
312 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
313 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
314 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
315 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
316 (PID.TID 0000.0001) > &
317 (PID.TID 0000.0001)
318 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM01
319 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM01 : OK
320 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM02
321 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM02 : OK
322 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM03
323 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM03 : OK
324 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM04
325 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM04 : OK
326 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM05
327 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM05 : OK
328 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
329 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
330 (PID.TID 0000.0001) // =======================================================
331 (PID.TID 0000.0001) // Parameter file "data.pkg"
332 (PID.TID 0000.0001) // =======================================================
333 (PID.TID 0000.0001) ># Packages
334 (PID.TID 0000.0001) > &PACKAGES
335 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
336 (PID.TID 0000.0001) > useBulkforce=.TRUE.,
337 (PID.TID 0000.0001) > useThSIce=.TRUE.,
338 (PID.TID 0000.0001) > &
339 (PID.TID 0000.0001)
340 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
341 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
342 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
343 (PID.TID 0000.0001) // =======================================================
344 (PID.TID 0000.0001) // Parameter file "data.gmredi"
345 (PID.TID 0000.0001) // =======================================================
346 (PID.TID 0000.0001) ># GM+Redi package parameters:
347 (PID.TID 0000.0001) >
348 (PID.TID 0000.0001) >#-from MOM :
349 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
350 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
351 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
352 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
353 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
354 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
355 (PID.TID 0000.0001) >
356 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
357 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
358 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
359 (PID.TID 0000.0001) >
360 (PID.TID 0000.0001) > &GM_PARM01
361 (PID.TID 0000.0001) > GM_background_K = 800.,
362 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
363 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
364 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
365 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
366 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
367 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
368 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
369 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
370 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
371 (PID.TID 0000.0001) > &
372 (PID.TID 0000.0001) >
373 (PID.TID 0000.0001) >
374 (PID.TID 0000.0001)
375 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
376 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.blk
377 (PID.TID 0000.0001) // =======================================================
378 (PID.TID 0000.0001) // Parameter file "data.blk"
379 (PID.TID 0000.0001) // =======================================================
380 (PID.TID 0000.0001) > &BULKF_CONST
381 (PID.TID 0000.0001) > Tf0kel = 273.15,
382 (PID.TID 0000.0001) >#p0 = 1013., <- no longer in Namelist, but hard coded
383 (PID.TID 0000.0001) > Rgas = 287.,
384 (PID.TID 0000.0001) > &
385 (PID.TID 0000.0001) >
386 (PID.TID 0000.0001) > &BULKF_PARM01
387 (PID.TID 0000.0001) ># set blk_nIter=0 to use the original FORMULA_LANL:
388 (PID.TID 0000.0001) > blk_nIter= 0,
389 (PID.TID 0000.0001) >#RainFile= 'ncep_precip_cs.bin',
390 (PID.TID 0000.0001) > RainFile= 'ncep_pr_scal_cs.bin',
391 (PID.TID 0000.0001) > SolarFile= 'ncep_downsolar_cs.bin',
392 (PID.TID 0000.0001) > AirTempFile= 'ncep_tair_cs.bin',
393 (PID.TID 0000.0001) > AirhumidityFile='ncep_qair_cs.bin',
394 (PID.TID 0000.0001) > LongwaveFile= 'ncep_downlw_cs.bin',
395 (PID.TID 0000.0001) > UWindFile= ' ',
396 (PID.TID 0000.0001) > VWindFile= ' ',
397 (PID.TID 0000.0001) > WspeedFile= 'ncep_windspeed_cs.bin',
398 (PID.TID 0000.0001) > RunoffFile= ' ',
399 (PID.TID 0000.0001) > QnetFile= ' ',
400 (PID.TID 0000.0001) > EmPFile= ' ',
401 (PID.TID 0000.0001) > CloudFile= ' ',
402 (PID.TID 0000.0001) >#blk_taveFreq=864000.,
403 (PID.TID 0000.0001) > &
404 (PID.TID 0000.0001) >
405 (PID.TID 0000.0001) > &BULKF_PARM02
406 (PID.TID 0000.0001) > qnet_off=0.0,
407 (PID.TID 0000.0001) > empmr_off=0.0,
408 (PID.TID 0000.0001) > conservcycle=311040000.,
409 (PID.TID 0000.0001) > &
410 (PID.TID 0000.0001) >
411 (PID.TID 0000.0001)
412 (PID.TID 0000.0001) BULKF_READPARMS: starts to read BULKF_CONST
414 (PID.TID 0000.0001) BULKF_READPARMS: starts to read BULKF_PARM01
415 (PID.TID 0000.0001) BULKF_READPARMS: read BULKF_PARM01 : OK
416 BlkF: rhoA = 1.3
417 BlkF: rhoFW = 1000.
418 BlkF: cpAir = 1004.
419 BlkF: Lvap = 2500000.
420 BlkF: Lfresh = 334000.
421 BlkF: Tf0kel = 273.15
422 BlkF: Rgas = 287.
423 BlkF: xkar = 0.4
424 BlkF: stefan = 5.67E-08
425 BlkF: zref = 10.
426 BlkF: zwd = 10.
427 BlkF: zth = 10.
428 BlkF: cDrag_1 = 0.0027
429 BlkF: cDrag_2 = 0.000142
430 BlkF: cDrag_3 = 7.64E-05
431 BlkF: cStantonS= 0.018
432 BlkF: cStantonU= 0.0327
433 BlkF: cDalton = 0.0346
434 BlkF: umin = 1.
435 BlkF: humid_fac= 0.606
436 BlkF: saltQsFac= 0.98
437 BlkF: gamma_blk= 0.01
438 BlkF: atm_emissivity = 0.9
439 BlkF: ocean_emissivity= 0.985
440 BlkF: snow_emissivity = 0.98
441 BlkF: ice_emissivity = 0.98
442 BlkF: ocean_albedo = 0.1
443 BlkF: useFluxFormula_AIM= F
444 BlkF: calcWindStress = F
445 BlkF: useQnetch = F
446 BlkF: useEmPch = F
447 BlkF: blk_nIter = 0
448 BlkF: blk_taveFreq= 31104000.
449 (PID.TID 0000.0001) THSICE_READPARMS: opening data.ice
450 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.ice
451 (PID.TID 0000.0001) // =======================================================
452 (PID.TID 0000.0001) // Parameter file "data.ice"
453 (PID.TID 0000.0001) // =======================================================
454 (PID.TID 0000.0001) > &THSICE_CONST
455 (PID.TID 0000.0001) > Tf0kel = 273.15,
456 (PID.TID 0000.0001) >#- with LANL albedo:
457 (PID.TID 0000.0001) >#albWarmSnow=0.75,
458 (PID.TID 0000.0001) >#- for full ice-fraction :
459 (PID.TID 0000.0001) >#icemaskmin = 1.,
460 (PID.TID 0000.0001) >#himin0 = 0.01,
461 (PID.TID 0000.0001) >#frac_energy= 0.,
462 (PID.TID 0000.0001) >#hihig =100.,
463 (PID.TID 0000.0001) >#- with fractional ice:
464 (PID.TID 0000.0001) > icemaskmin = 0.05,
465 (PID.TID 0000.0001) > hiMax = 10.,
466 (PID.TID 0000.0001) > hsMax = 10.,
467 (PID.TID 0000.0001) >#albIceMax =0.7,
468 (PID.TID 0000.0001) >#albIceMin =0.7,
469 (PID.TID 0000.0001) > &
470 (PID.TID 0000.0001) >
471 (PID.TID 0000.0001) > &THSICE_PARM01
472 (PID.TID 0000.0001) >#StartIceModel=1,
473 (PID.TID 0000.0001) > stressReduction=0.,
474 (PID.TID 0000.0001) >#thSIce_taveFreq=2592000.,
475 (PID.TID 0000.0001) >#thSIce_diagFreq=2592000.,
476 (PID.TID 0000.0001) >#thSIce_monFreq=864000.,
477 (PID.TID 0000.0001) > &
478 (PID.TID 0000.0001) >
479 (PID.TID 0000.0001)
482 ThSI: rhos = 330.
483 ThSI: rhoi = 900.
484 ThSI: rhosw = 1035.
485 ThSI: rhofw = 1000.
486 ThSI: rhoiw = 135.
487 ThSI: cpice = 2106.
488 ThSI: cpwater = 3994.
489 ThSI: kice = 2.03
490 ThSI: ksnow = 0.3
491 ThSI: transcoef= 0.006
492 ThSI: Lfresh = 334000.
493 ThSI: qsnow = 334000.
494 ThSI: albColdSnow= 0.85
495 ThSI: albWarmSnow= 0.7
496 ThSI: albOldSnow = 0.55
497 ThSI: albIceMax = 0.65
498 ThSI: albIceMin = 0.2
499 ThSI: hAlbIce = 0.5
500 ThSI: hAlbSnow = 0.3
501 ThSI: hNewSnowAge= 0.002
502 ThSI: snowAgTime = 4320000.
503 ThSI: i0 = 0.3
504 ThSI: ksolar = 1.5
505 ThSI: saltice = 4.
506 ThSI: S_winton= 1.
507 ThSI: mu_Tf = 0.054
508 ThSI: Tf0kel = 273.15
509 ThSI: Tmlt1 = -0.054
510 ThSI: himin = 0.01
511 ThSI: Terrmax = 0.5
512 ThSI: nitMaxTsf= 20
513 ThSI: hiMax = 10.
514 ThSI: hsMax = 10.
515 ThSI: iceMaskmax= 1.
516 ThSI: iceMaskmin= 0.05
517 ThSI: himin0 = 0.2
518 ThSI: frac_energy 0.4
519 ThSI: hihig = 2.5
520 ThSI: stressReduction = 0.
521 ThSI: thSIce_deltaT = 86400.
522 ThSI: ocean_deltaT = 86400.
523 ThSI: stepFwd_oceMxL= F
524 ThSI: tauRelax_MxL = 0.
525 ThSI: hMxL_default = 50.
526 ThSI: sMxL_default = 35.
527 ThSI: vMxL_default = 0.05
528 ThSI: thSIce_taveFreq= 31104000.
529 ThSI: thSIce_diagFreq= 31104000.
530 ThSI: thSIce_monFreq = 1.
531 ThSI: startIceModel = 0
532 (PID.TID 0000.0001) SET_PARMS: done
533 (PID.TID 0000.0001) tile: 1 ; Read from file tile001.mitgrid
535 (PID.TID 0000.0001) tile: 2 ; Read from file tile002.mitgrid
537 (PID.TID 0000.0001) tile: 3 ; Read from file tile003.mitgrid
539 (PID.TID 0000.0001) tile: 4 ; Read from file tile004.mitgrid
541 (PID.TID 0000.0001) tile: 5 ; Read from file tile005.mitgrid
543 (PID.TID 0000.0001) tile: 6 ; Read from file tile006.mitgrid
545 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
546 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
547 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
548 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
549 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
550 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
551 (PID.TID 0000.0001) %MON XG_mean = 1.8796250616675E+00
552 (PID.TID 0000.0001) %MON XG_sd = 1.0410625309932E+02
553 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
554 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
555 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
556 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
557 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
558 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
559 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
560 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
561 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
562 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
563 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
564 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
565 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
566 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
567 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
568 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
569 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
570 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
571 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
572 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
573 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
574 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
575 (PID.TID 0000.0001) %MON YG_mean = -1.2094344438470E-15
576 (PID.TID 0000.0001) %MON YG_sd = 3.9086186579984E+01
577 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
578 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
579 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
580 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
581 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
582 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
583 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
584 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
585 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
586 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
587 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
588 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
589 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
590 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
591 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
592 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
593 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
594 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
595 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
596 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
597 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
598 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
599 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
600 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
601 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
602 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
603 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
604 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
605 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
606 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
607 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
608 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
609 (PID.TID 0000.0001) %MON AngleCS_max = 1.0000000000000E+00
610 (PID.TID 0000.0001) %MON AngleCS_min = 1.0000000000000E+00
611 (PID.TID 0000.0001) %MON AngleCS_mean = 1.0000000000000E+00
612 (PID.TID 0000.0001) %MON AngleCS_sd = 0.0000000000000E+00
613 (PID.TID 0000.0001) %MON AngleSN_max = 0.0000000000000E+00
614 (PID.TID 0000.0001) %MON AngleSN_min = 0.0000000000000E+00
615 (PID.TID 0000.0001) %MON AngleSN_mean = 0.0000000000000E+00
616 (PID.TID 0000.0001) %MON AngleSN_sd = 0.0000000000000E+00
617 (PID.TID 0000.0001) MDSREADFIELD: opening global file: bathy_Hmin50.bin
618 (PID.TID 0000.0001) // =======================================================
619 (PID.TID 0000.0001) // Field Bottom depths (ini_depths) at iteration 1
620 (PID.TID 0000.0001) // CMIN = -6.004000000000000E+03
621 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
622 (PID.TID 0000.0001) // CINT = 2.205185185185185E+02
623 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
624 (PID.TID 0000.0001) // 0.0: .
625 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
626 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
627 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
628 (PID.TID 0000.0001) // =======================================================
629 (PID.TID 0000.0001) K = 1
630 (PID.TID 0000.0001) // I=7 I=17 I=27 I=31 I=41 I=51 I=61 I=65 I=75 I=85 I=95 I=99 I=109 I=119 I=129 I=133 I=143 I=153 I=163 I=167 I=177 I=187
631 (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123450|234567890|234567890|234567890|234567234|678901234|678901234|678901234|678945678|012345678|012345678|012345678|016789012|456789012|456789012|456789012|890123456|890123456|890123456|89012345
632 (PID.TID 0000.0001) // 35 fefcdfeehhimnihix+..........zrv......................................mrpzsrrdedgedccdfeeeiv..............igggffeeggffeegfgggfeeeefgggfffgiiiijkiiiiigghinkjiknlieebbceeigghky...rxwnkiiifeejiffeejiffhhiiiimnmljeddddfiwjhhnpddhtedd
633 (PID.TID 0000.0001) // 34 ddeedeefhjmongffn++........tqqt.....................................wmrp+xppeeefeeecceeeiv+..............jfeededdfededdffgffeeeeeeggggffgiiiiikihhhhhghikiihiknkifeeeefifhhl.......zpojiigehgeigehgeefggghiknkkhffddfeeemihjdddhtihh
634 (PID.TID 0000.0001) // 33 ceffeffghlpomigffg+.......+t........................................ytsxzz+zgfggedcccddgv+...............kgeedddefedddeffggfeddeeegggggfgiiijjjhhhgggghgihggijknkiiigijffiiw........zpkkjheeeejheeeeeeefggiknkihhgfffeefmhiedeeiqqtt
635 (PID.TID 0000.0001) // 32 degghijkmrrnjidemrz..w.+..+.......................................++..u+....jigfecccdegv+................mgfeeddefeeddeffgfedddeeefggggghiiijjihhhgffffffefgfgiijkkkkkgfhkx.........+zpljheeedjheeedddeefffikmnkhffffffeeefeegimnpsr
636 (PID.TID 0000.0001) // 31 eefiikmoqprphedeu..voss+t.z.......................................+++++.zutwkiheddgigiv+................+nmgfeddeefeddeefffeddceeeegggghiiinkihhhhffffeeedeeeefffgfhiiefix+..........++vmiedddmieddddddddefiiknljiiiffebbegikmnkkkkk
637 (PID.TID 0000.0001) // 30 degjknnmmmkifegfx.yoorzrlnwport...................................+++++xnhiunkifefgnsx+++...............onkjhedddehedddefefeccceedegggghhgmohgghigeeeedefdcdedddeeeefeeeo..............+wlfdddwlfddddddccefghikponjkkhebfkpppononjii
638 (PID.TID 0000.0001) // 29 dfiknlkiilgddhigpzy...+yloqoovz....................................+++yrggkrnmjfeefjz+......++.........+oojihfdccdhfdccdeeedbccddddfggggffkphggigeddddddggccecccbbbdddei+...............+rhdcd+rhdcdddcccdhghhjmponjlljfgikrpmmlonig
639 (PID.TID 0000.0001) // 28 dfinkigffhddeghl........u..........................................+++xjifinmokgfefkxxz.....+++........+pmihhgdccchgdcccbeedbccccddeggfdefpigghifedddcccnicccccb--accdgm+................+mdbb.+mdbbddadeiiggghjigddehgddfikrpnkjklk
640 (PID.TID 0000.0001) // 27 efjkieeeeedefkoy............................+++....................++wpffefnmqmhhhginorxy....++........+nkihhffdcchffdccbdccccccceeegffdffikggggfeddccccsgdccdcb--adcktx.................++hba.++hbaa-aokokmgggedccbddbbekjikpmjhghj
641 (PID.TID 0000.0001) // 26 egkifeb--cdeilw.............................++ty...................+urcigeenmprljhgghikkmtz++++........znkigffedcbffedcbcccdcddccddegfeeddghggffedcccccdxiedefedaaabwww...................+wda..+wda--ononlmjgddddcbdcbcflliikkhedde
642 (PID.TID 0000.0001) // 25 efkiebbbdcdfk+..................x.....x.......olp+................+xdbcabefjkrrpmihiklllloy.++.........zmjigeddccbeddccbccbdgeeccdeffgddddffffedccbbddde+vgdeeffdbbbuhk...................++rg..++rghspiklnlfeedekgeeddccehhghhfeddf
643 (PID.TID 0000.0001) // 24 ehkiebbefefhl...................x.....x.......nlmp+.....++.....++zpqdbb--fegipnoomkkpnmtttx............rkihfedddbbedddbbaabeggfbcdhhidddddeffeddccbcdddf++vgeeeedcbcwho....................++y...++yzwpijnnfeeeehjmhfeedccdggggfeefg
644 (PID.TID 0000.0001) // 23 fikgecdefgjlm...................zz....zz.....pkjklz....urr.....+vljzjgcaaeeffhjmnnmmoqnt..xvv..........+ihgeddcccaddcccaaabeggcbbdiidddgiieeeeddcccdddff+.+viedccccn.ix...........t.........++....++zzmilnifgffqz..vnmggdddffgpigggg
645 (PID.TID 0000.0001) // 22 eikieebbceijl....................zz..s.zz..somiijjo...onop+....+tiizydbaeeefeeiigiklosor...yvv.++.......zugfedcbbaedcbbaabcegfbbcggeddgiihbdedcccccdddde...+vifceddrwjj..........gfihhj......+.....++zjjrvkhhikz......zqfedfgiwuiihh
646 (PID.TID 0000.0001) // 21 eegjfebbbceeh.....................yttu..yttunjhhhhpz..lmmnu+....nilzzibaaegigddgfhjnnqur....yy++++zt.....++fedcbbbedcbbbabcfggcddedbcbcgicbcdbbcbccdddde....+vqlgfy.wpjr.......+lgfghhhhixz...ixz....+kjp.wmnpy.........jgfgilxskjii
647 (PID.TID 0000.0001) // 20 efffiifeecdeh+.......................n.....ngjigggkr.+kklnoz++.+qrvxyzaaehjmfeeffiouppyxz......+yvkky....++jecaaabecaaabaacgggfebebbbbcegeeebabbbdefdddd.......ywyy.nvnq.nw...nfgjggiihiiiknyxiiknyx+iiim.+yyzy.........ojhkowtmlmnn
648 (PID.TID 0000.0001) // 19 oihffgjkihhjffu......................d.....ddikiggipszjjkmty.+++tt+nr.bbhginxumfnxoptr.ww......tmkjju...+++udcaaabdcaaabaadfgeicbbbccccdhggcaacbbbdgnddd..........wpkzy.unnrkhgffgkiiiijiikliiiikliihfegjy..yz..........yljsqqkklmnk
649 (PID.TID 0000.0001) // 18 .xkihgimkihjeegkwnsiqz..............me....meefikkjipmhhiiju..++++..jjnighghm..rg++.zxxutuuz..zttmkpu++++++zkica--bica--bcbcfddidbabcccbbhirrrdeaabdisfdd........+mmskx.wronokhggfghkjjjiijljhgijljhgfeefhky.............zlnsgghikmmk
650 (PID.TID 0000.0001) // 17 .+xihhikmjjfeeffeeefio.............lfe...lfeeffikjiphggghhgy..++...pprwjihhmy.z++..+ztllnnnnnmnnrmqt+++.++kjlcaaablcaaabhcddbdhdcabcccbciqrrqrrpcbjnwjhd........+om+..yllqppkihigghikkjijkjigfjkjigfedefgjy..............okhgghikmnj
651 (PID.TID 0000.0001) // 16 ...wlkhgghffgikifeegin............lgee..lgeeggggikimffffgggg+.++..++ypwz.ummov....++zytnnnnnmkiimnqz++...kjjlcaabclcaabchedbbiheaabbcdcefpqqkijjmpwowpvf.........rkv..jjkmqmjiiihhijkkkkllhhgellhhgeedeefgy..............yjgghijlnmj
652 (PID.TID 0000.0001) // 15 .....ynhecbdfikkhfffeht..........tifee.tifeepjiiikifeeeegffef+.+++++zjoqx...oo....++..ztnxz.ykkjjpz+++...sjjgdabcegdabcefddaakjhbbbdefedennnnggiky..ytwx.........ukm.yjjklnljijjihijkkkkljhhgfljhhgfgfedegoz.............zighiklnmki
653 (PID.TID 0000.0001) // 14 .......fcbbefimkgffcdgk..........piggf.piggfkpkiikmeddeefedddew+.+ytpjjqy++.rsw..........zzzzzslkn+++....rjjgcacbbgcacbbecc-ackcbdfffghdfnnnngkprtty..xx..........+y.vkjklmljjijjhijkkkkjhhhhhjhhhhhggedegkw.............phghjklmkih
654 (PID.TID 0000.0001) // 13 ......+ecbbbfimkhfdcceiz.........pjigi.pjigiikpnjkmeddeeeddddccinnmvtwyy++++zs...........zzzzz++sz++......ygbaacbcbaacbcbaa--bdcdhhfghkgimmrprnorrvvmrro.............llkllllkihijhijlkkkiijjjiiijjjiihfddehnx...........zlhghjkmkihf
655 (PID.TID 0000.0001) // 12 ......hfcbbcfkmkhfcccdj..........tmlrg.tmlrgghlkkkiedeeehcbdcdcggcbkv+++.+++r++..........+++++++.+++....++.tbbacddbbacdd---a-bddfhffghljnnnmrnmmnttkffgh............wlmmmlllljhhiiijllkljjklkkjjklkkkjgddegiijjuyy......oiffhkmliige
656 (PID.TID 0000.0001) // 11 .....rggecbdfknkhfdccdk..........pmp.i.pmp.ighokllgeeedekdbca--bebbs+....++.lt...........+++++..........+zzzedcbbfedcbbfc--abdddfffgggmkkhhmnqttttifeeff...........pmmlljjkkllkjjjjjmmllllmnnnllmnnnllkgddfgghhiqy.....yigffhjmjhggd
657 (PID.TID 0000.0001) // 10 .....xigecbdfjnkhedccdp.........vpt..gvpt..gfhokmmigfedfkdcb-abbhsu+........n...........................zywvrcbbbfrcbbbffdaaddbccgfikmqqrlhlttsprieefffg.........+tnljjkjjjjkmmlkkjkmnnmmmmmmmmmmmmmnmmhhffghhhhkqz..zxkffffgkjhggfd
658 (PID.TID 0000.0001) // 9 .....wjhfdbcfikmfeccfln+.......+pow.+fpow.+ffiikmmkggeegkeda-ddet++.........wz++........................zxvvmccaabmccaabcd--bdbbbdglorsspnnntqkhgfffffgl........+zmllkijiijiiklmmmllnnnlkkjjjjkkjjjjkkkjjghhiijjjlopoljhfeefgiihffee
659 (PID.TID 0000.0001) // 8 ....znhfdcbbeilifdcdkgiz.......wmmy.lfmmy.lfhgghikliigggkecbddeiv...........p..tt.........................+ymudba-mudba-aa-acbbbachlprsrppkppskurgfffjmo.......wlkjjkjhiiiihhiklmmmmnllkjhhiihjhhiihiiikmkkkmmnnnlmnokiihhhijigffeey
660 (PID.TID 0000.0001) // 7 ..+zpkhfdcdefimkhfefkegy.......rlku.ielku.ieeedfgjlliihghgfgfedi+...........o...qz.........................+zucba-zucba----bbbdaachghisirggtz+......+yvgo+....ukjiiijihhhhihhhikklllmkkkjhggggjhggggggggmmnnnlkljimoommmljkljgfeddcr
661 (PID.TID 0000.0001) // 6 .+zpoiggfeeehinkhgfkddgu......urghltfdghltfddddgihijliiinnnngfddw...........r...qr.........................w.ydcb-.ydcb---abbecaadieerrizhpx+........zgfnnmkjiiiiiiiiihhhhhhhhijkkkklkkjiiggffiiggffefegjkkkkhgggedfikkkmmmlhfddcbb+
662 (PID.TID 0000.0001) // 5 .+pkjiimjjffiknkhhjgedfm+....vpkefkondefkondeefifggillkklhhkicddf...........t...tv.........................sm.zkbbm.zkbb--cbbikebilggst+xmsz.........rdekmggfghhhhhhhggghgggggijjjkklkjjiiffeeiiffeeddeggihihffdddddgihhijiihedbbbc+
663 (PID.TID 0000.0001) // 4 +vlkiinnijgiijmiiifeddegy...nnpeegpqhfegpqhffgigfgghknkjjigggccot..........................................pmp.zgamp.zgaaahfkkkkfinhhry.ytz..........pcdjgfeeghgghgfgfffgggfggiijjjjkjiiiigeediigeeddcdefgfffeedddfwihghhigffddbbbe+
664 (PID.TID 0000.0001) // 3 wmjjiffhhiiiimnmljeddddfiwjhhnpddhtrkidhtrkigkjefgghinkkjjihfeddeyr+++++...................................mrpz.wurpz.wurnnnjgffimnmmm..++..........+ibbhfeeegfgggfeeeefgggfffgiiiijkiiiiigfeeiigfeedccdeffeeddddfxxohfglogfedbbbbs+
665 (PID.TID 0000.0001) // 2 lihhgeefggghiknkkhffddfeeemihjdddhtskidhtskiilhddfghinnmnmkihggfeecbcesy+.................................wmrp+.tirp+.tikifefeeegjihhm.++++.........+nbbeeeddffgffeeeeeeggggffgiiiiikihhhhhfedhhhfeddcccddfdddddhvwxrgffgmvgdcbbbty+
666 (PID.TID 0000.0001) // 1 feeeeeeeefggiknkihhgfffeefmhiedeeiqpkjeiqpkjnkgddegijmmmmnmkiiggfedbbbbt++++..............................ytsxz.uhsxz.uhgfeeefeeehgghu.++++.........+nbbddddeffggfeddeeegggggfgiiijjjhhhgggffegggffedcccdddddddfjpt.rfeffjyzrpinn++.
667 (PID.TID 0000.0001) // 0 ddeeedddeefffikmnkhffffffeeefeegimnnknimnnknojheeegikllkklnmkihgffdcbbbbnnni............................++..u+..znu+..zngifgb-aeaehhi.xy+..........+++tbddddeffgfedddeeefggggghiiijjihhhgffffegffffeddccddddddnswwy.mfefff+...++++..
668 (PID.TID 0000.0001) // -1 ddeddddddddefiiknljiiiffebbegikmnkkmkonkkmkolkjhffiusmkiijllmljhhfedbbbbnbbb............................+++++.z+.x+.z+.xrjfia-aaaabgjzqqy+........+yt+ysdeedeefffeddceeeegggghiiinkihhhhfffffefffffedddcbcdddfgino.yvkfeff.......+..
669 (PID.TID 0000.0001) // -2 dddddddddccefghikponjkkhebfkpppononinnnoninnmnmkhgpwxtkhhikkkmmjigfdddbbibbb............................+++++xnu+++xnu++yxpccbcbbabiwwojy+........+sb.++eefddefefeccceedegggghhgmohgghigeeegfeeeegfedddcbbccceddjw.tvtieff.......+..
670 (PID.TID 0000.0001) // =======================================================
671 (PID.TID 0000.0001) // END OF FIELD =
672 (PID.TID 0000.0001) // =======================================================
673 (PID.TID 0000.0001)
674 (PID.TID 0000.0001) // =======================================================
675 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc) at iteration 1
676 (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
677 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
678 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
679 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
680 (PID.TID 0000.0001) // 0.0: .
681 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
682 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
683 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
684 (PID.TID 0000.0001) // =======================================================
685 (PID.TID 0000.0001) K = 1
686 (PID.TID 0000.0001) // I=7 I=17 I=27 I=31 I=41 I=51 I=61 I=65 I=75 I=85 I=95 I=99 I=109 I=119 I=129 I=133 I=143 I=153 I=163 I=167 I=177 I=187
687 (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123450|234567890|234567890|234567890|234567234|678901234|678901234|678901234|678945678|012345678|012345678|012345678|016789012|456789012|456789012|456789012|890123456|890123456|890123456|89012345
688 (PID.TID 0000.0001) // 35 cac--cbbeefjkfefw+..........zpu......................................kqnzrqq-b-da----bbbbfu..............fdddccaaddccaadcdddcbbbbcdddcccdffffghgffffddefligfiljfba---aafddehy...pwvlhfffcbagfccbagfcceeffffjlkjgaa---bfvheeln-aesaaa
689 (PID.TID 0000.0001) // 34 --ba-abcehjnldcclz+........spps.....................................vkqn+xnnabbcbba--aabfu+..............hcbaaaaacaaaaaccdccbaaabbddddccdffffghfeeeeedefiffefilhfcaaaacgceei.......zomggfcaecbfcaecbbccddefilihecbaacbaajfega-aesfee
690 (PID.TID 0000.0001) // 33 -abbbccceiomkfdbbc+.......+s........................................xsrxzz+zdcddb-----adu+...............hcbaa--acaa--accddba--bbbddddccdfffhhgfeeddccedfeddfgikhfffdfgccffw........zohhgebbaagebbaaaaaccdfhlhfefdcccaabjefbaaafooss
691 (PID.TID 0000.0001) // 32 -bddefhhkqqlgfaakqz..v.+..+.......................................++..u+....gfdba----adu+................kdcaaa-acaaa-accdcb---bbbcdddddefffggfeeedccccccbbdcdfgghhiihcbeiw.........+ynjgebaaagebaaaa-aacccfikkhecccbbbaaabaadfklnqp
692 (PID.TID 0000.0001) // 31 bbcffijnpnqneaaat..umrr+s.z.......................................+++++.ztsvifeb--dfdfu+................+lkdca--abca--abcccb---bbbbddddeffflhfeeeecbbbbaa-abbacbcdceffbbfw+..........++ujfbaaajfbaaa----aacffiljgfffcca--adfikkiihhh
693 (PID.TID 0000.0001) // 30 -adgillkkkifcadcx.ymmqzqikvnnps...................................+++++wmegtlifcacdlqx+++...............mligea---aea---abbbb---abaaddddeedkmeddefdbbbaaac---b--aaaaabaabm..............+viba--viba-------acdefinmlgiieb-chnnnmlmlgff
694 (PID.TID 0000.0001) // 29 -cfiljigfjd--efdozy...+ximpnnuz....................................+++yqddhpljhcbbchz+......++.........+mmhffc----fc----aaba------acdddcbcineddgdbaaa---dd--a------aa-bfz...............+qe---+qe---aa---aedeegknmlgiigcdfhpokkimlfd
695 (PID.TID 0000.0001) // 28 abgkhfcccea-bdei........t..........................................++zwgfcfkknhccbbhwwy.....+++........+njfeed----ed-----aa-------abddcabcnfddegcaaa----lf------------dk+................+ja--.+ja------bffdddehfd--bedaacfhpnligiih
696 (PID.TID 0000.0001) // 27 acghfbaaaa-achmy............................+++....................++vnbbbclkpkeeecflmqxy....++........+lhfeecc---ecc------------aaadcbabcfhddccba------qd-----------irw.................++e--.++e-----mhmijddda--------ahhfiokhedeg
697 (PID.TID 0000.0001) // 26 adhfca-----bfiv.............................++sy...................+tq-fdbblknqiheddefhiksz++++........zkhfdccb---ccb------------aabdcaaaacfddbca-------xfa-abb-----vvv...................+wa-..+wa---mlmkijhc----------cjjffiheb-aa
698 (PID.TID 0000.0001) // 25 achfa------ch+..................w.....w.......njo+................+x-----bcgiqqojfefiiiijmy.++.........zkhfdbaa---baa-------daa---acccaaaacccca--------a+udaabbb----tei...................++qd..++qdeqnghiljcaaaaidaa----beedeeca--b
699 (PID.TID 0000.0001) // 24 aeifa--acbcei...................w.....w.......likn+.....++.....++znpa----bbdfnlmnjhinlksssw............qhfeca-----a--------addc--aeffaaaaaaccb-a----a--b++udbbaba---ven....................++x...++xywnfgllcbbabegkecba----ddddcaacd
700 (PID.TID 0000.0001) // 23 bfida-aabchjk...................zz....zz.....nhhijz....tqq.....+ujgzgd---abccegklkkknols..xuu..........zgfdba-----a--------bcd---affaaadffabbb-----aa-bc+.+ufb-----l.gx...........s.........++....++zzkfilfccccoz..ulkcd---bccnfdddd
701 (PID.TID 0000.0001) // 22 afhfaa---bfgi....................zz..r.zz..rnjffggm...nlmn+....+sffzya--aabcaaffdfhimrmp...yuu.++.......zudba-----a--------adc---dda-adffe-aa--------aaa...+ufc-baaqvhh..........dcfeeh......+.....++zggqvifefhz......zobbaccfwuffee
702 (PID.TID 0000.0001) // 21 abcgca----abe.....................ysst..ysstlgeeeeoz..ijklt+....lfjzzf---adfdaadcehllotq....yy+++zzs.....+zcba----ba-------cdd--aaa----df------------aaa....+upjdcy.vohq.......+idcdfeeefwz...fwz....+hhn.vklox.........gdccfjwrigff
703 (PID.TID 0000.0001) // 20 bbbcgfcaa-aae+.......................l.....lcgfdddhq.+hiilnz++.+oquxyz--adgkcaabcfmtooyxz......+yuiiy....++gb-----b--------ddcca-a-----acbaa------bbaaaa.......ywxy.lulo.lv...kcdgddffefffilyxffilyx+fffk.+xyyy.........mgeimvskjkll
704 (PID.TID 0000.0001) // 19 mfeccdghfeegcbt......................a.....aafifccgnrzgghjry.+++sr+lq.--edfkxtkblwnnsp.vv......skhggt...+++t---------------bdaf---------edd-------adlaaa..........vnhzy.tllqiedccdhggfggffiiggffiiggfcbdgy..yz..........xigqophijkki
705 (PID.TID 0000.0001) // 18 .wifedfkhfegbbcivlqfoz..............ja....jaacfihggokeeffgt..++++..hhlfdeddk..qcz+.zwxtsttz..ysrkhot++++++zig-----g--------b--f---------egqqqaa----frb--........+kkrhw.vqmlnieddcdehgggffgigedfgigedbaaceiy.............zilrddefikkh
706 (PID.TID 0000.0001) // 17 .+wfeefikhgcbbccaaacgn.............ica...icaaccfihfoedddeedy..++...nnqwgfeeky.z++..+zsjjllllljllpjos+++.+zhhi-----i-----e-----ea--------foqqoqqo--hlwgea........+nk+..xiioonhfefddegihhghigfdbhigfdbaaabdgx..............nheddefiklh
707 (PID.TID 0000.0001) // 16 ...wiheddeccdfhfbabdfl............jdba..jdbaddddgifkccccdccd+.++..++ynvz.tkkmu....++zyslllllkhggkmpy++...ihhi-----i-----ea---feb-----a-acnoohfghknvmwnuc.........qhu..hhhkojgffgeefghihhiieedbiieedbaaabcdy..............ygddeghiljg
708 (PID.TID 0000.0001) // 15 .....ylea--acfihebcbbes..........sfcbb.sfcbbngfffigcaaabdbcac+.+++++zgmpx...mm....++..zslwz.yhhhhnz+++...rhgc----ac----ab----ige----acaaalllkddfiy..yswx.........thk.xgghiligfghfefhhhhiiheedciheedcdbbabdmz.............zfdeghikkif
709 (PID.TID 0000.0001) // 14 .......c---acgkhdcc--di..........ofddc.ofddchohffikaaaaabaaa-aw+.+ysnggox++.qrv..........yzzzzrjil+++....qhgd-----d-----a-----i---cccdeabkklldinqssy..xx..........+y.uhghikihgfghefgihhhgeeeeegeeeeeddbaadhw.............nedeghjjhfe
710 (PID.TID 0000.0001) // 13 ......+b----cfkhec---afz.........nhfdf.nhfdffholghkaaaaaba-a---flkkuswyy++++zr...........zzzzz++ry++......yd--------------------aeecdeidfkkqnqlmqquukqqm.............iihiijjhfefgefhjihiffgggfffgggffecaabelx...........zjecehijhfec
711 (PID.TID 0000.0001) // 12 ......ec----chjhec---ag..........skiqd.skiqddeiiiifaaabae--a---dd--iu+++.+++q++..........+z+++++.+++....++.s------------------a-ceccdejhlllkqlkklssiccde............wjkkkjjjigeefffgjiiighiiihghiiihhhdaabdffghtxx......mfccehjiffdb
712 (PID.TID 0000.0001) // 11 .....pdca--achlheba--ai..........nkn.f.nkn.fdemijidaaaabi-------a--q+....++.is...........+++++..........+yyza----ba----b-----a--ccccddkhieekkossssfbbbbc...........njjijhhihijhgggggjjjjijkkkkijkkkkjjhcaacddeegpy.....xfdccdhjgfdda
713 (PID.TID 0000.0001) // 10 .....wfdb--achlhea---an.........uos..duos..dcemikkfdcaabi-------equ+........k...........................zyvuq----cq----cc----a---dcfhkopqjeissrnpfbbcccd.........zslihhigghgijjihhhhkllkkkkkkjkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddca
714 (PID.TID 0000.0001) // 9 .....vgec---bfikca--cjl+.......+nnv.+cnnv.+ccffhkkiddaadha-----as++.........vz++........................zxuuk-----k------a---a----djmqrrnlllsoiddcccccdj........+zjijhfgfggffhjkkkiillljihhghgihhghgihighdeeffgghimnnjgecbbcdgfeccba
715 (PID.TID 0000.0001) // 8 ....zleca---afjfca--hdfz.......vkky.jckky.jceddefijffdddhb--a-afv...........n..ss.........................+yku----ku--------------ejnpqqnninnritqdccchkm.......wihgghgeffffeefhijkjkljiigeeffegeeffefffhjhhikkklljklmhffeeeggfdcbaay
716 (PID.TID 0000.0001) // 7 ..+zohec--abcfkhecbchbdx.......qiht.faiht.faaaabdgijgfededcdcb-f+...........n...pz.........................+zu----zu--------------edefqgqddsz+......+yudm+....tiggfggfeeeefeeefiiiijkiihheddddheddddddddjjllliijhfkmmkkjjhijgdcba--q
717 (PID.TID 0000.0001) // 6 .+yomfddcaabefkifdchaadt......uqdeisc-deisc----dfefgifffkklldc--v...........p...pp.........................v.x----.x---------a----fbbpqgzenx+........zdbllkhhfffffffgfeeeeeeeefhhhhijihhffddcbffddcbbbbdhhiihedddb-cfhhhjjjieca----+
718 (PID.TID 0000.0001) // 5 .+nhgffkghccfhkhffgdaackz....uoibcimlabcimlaaacfbddfjjhijeehf-a-c...........s...su.........................qk.yi--k.yi-------gha-fjddqs+xkrz.........q-bikdccdeeeeeeedddedddddgghhhhjhhgffcbbaffcbbaaaaddfegecca----dfeefhfgdb-----+
719 (PID.TID 0000.0001) // 4 +ujhgfllfhdffhkfffca-aady...llnabdopfcbdopfcbdgdbcdehlihgfddc--ms..........................................okn.zd-kn.zd---eciiiicfkeeqy.ysz..........n-agdcbbdeddedcdcccdddcddffggghiggfffdbaaffdbaa---acdcccba--abvfedeffdcca----b+
720 (PID.TID 0000.0001) // 3 vjggfcceeffffjlkjgaa---bfvheeln-aesphfaesphfdhgabddeflihhgfecbaaayq+++++...................................kqnz.vtqnz.vtpkllgdccfkkkkk..++..........+g--ecaaadcdddcbbbbcdddcccdffffghgffffdcaaffdcaa----abcaaaa-acxxmecdjmdbba----r+
721 (PID.TID 0000.0001) // 2 ifeecbbccddefilihecbaacbaajfega-aesqhfaesqhffiea-cdeflkkljifeddcba---bry+.................................vkqn+.sgqn+.sghfcbcbbbdgfdek.++++.........+l--aaaaaccdccbaaabbddddccdffffghfeeeeecbaeeecba------baaaa-euwxqdbcdkud-----sy+
722 (PID.TID 0000.0001) // 1 bbbbaaaaaccdfhlhfefdcccaabjefbaaafonhgafonhglid--adfgkkkklkhffddca-----s++++..............................xsrxz.terxz.tedcbbbbaaadddet.++++.........+l----a-accddba--bbbddddccdfffhhgfeeddccbaddccba-------aaaabgns.qcbcchyzqngll++.
723 (PID.TID 0000.0001) // 0 aaaaaaa-aacccfikkhecccbbbaaabaadfkllilfkllilmgebaadfijjiiikjhffdcba-----lllg............................++..u+..zmu+..zmdfbd---a-aeef.xx+..........+++s-----accdcb---bbbcdddddefffggfeeedcccbbdcccbba----aa--alrwwy.kcbccc+...++++..
724 (PID.TID 0000.0001) // -1 -aaaaa----aacffiljgfffcca--adfikkiikimkiikimiiheccfurkiffhijjigfecb-----l---............................+++++.z+.w+.z+.wqgbf-------dgzpoy+........+ys+yr-aa-abcccb---bbbbddddeffflhfeeeecbbcbbcbbcbbaa----a--bdflm.yuibbcc.......+..
725 (PID.TID 0000.0001) // -2 -aaa-------acdefinmlgiieb-chnnnmlmlfkllmlfklklkhednwwsheeghhijjgfdca----g---............................+++++wmu+++wmu++ywn--------fwvmgy+........+r-.++abc--abbbb---abaaddddeedkmeddefdbbbdcbbbbdcbaa-------ba-hv.susfbcc.......+..
726 (PID.TID 0000.0001) // =======================================================
727 (PID.TID 0000.0001) // END OF FIELD =
728 (PID.TID 0000.0001) // =======================================================
729 (PID.TID 0000.0001)
730 (PID.TID 0000.0001) // =======================================================
731 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc) at iteration 1
732 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
733 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
734 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
735 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
736 (PID.TID 0000.0001) // 0.0: .
737 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
738 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
739 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
740 (PID.TID 0000.0001) // =======================================================
741 (PID.TID 0000.0001) // =======================================================
742 (PID.TID 0000.0001) // END OF FIELD =
743 (PID.TID 0000.0001) // =======================================================
744 (PID.TID 0000.0001)
745 (PID.TID 0000.0001) // =======================================================
746 (PID.TID 0000.0001) // Field hFacC at iteration 1
747 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
748 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
749 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
750 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
751 (PID.TID 0000.0001) // 0.0: .
752 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
753 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
754 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
755 (PID.TID 0000.0001) // =======================================================
756 (PID.TID 0000.0001) // =======================================================
757 (PID.TID 0000.0001) // END OF FIELD =
758 (PID.TID 0000.0001) // =======================================================
759 (PID.TID 0000.0001)
760 (PID.TID 0000.0001) // =======================================================
761 (PID.TID 0000.0001) // Field hFacW at iteration 1
762 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
763 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
764 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
765 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
766 (PID.TID 0000.0001) // 0.0: .
767 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
768 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
769 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
770 (PID.TID 0000.0001) // =======================================================
771 (PID.TID 0000.0001) // =======================================================
772 (PID.TID 0000.0001) // END OF FIELD =
773 (PID.TID 0000.0001) // =======================================================
774 (PID.TID 0000.0001)
775 (PID.TID 0000.0001) // =======================================================
776 (PID.TID 0000.0001) // Field hFacS at iteration 1
777 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
778 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
779 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
780 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
781 (PID.TID 0000.0001) // 0.0: .
782 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
783 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
784 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
785 (PID.TID 0000.0001) // =======================================================
786 (PID.TID 0000.0001) // =======================================================
787 (PID.TID 0000.0001) // END OF FIELD =
788 (PID.TID 0000.0001) // =======================================================
789 (PID.TID 0000.0001)
790 (PID.TID 0000.0001)
791 (PID.TID 0000.0001) // ===================================
792 (PID.TID 0000.0001) // GAD parameters :
793 (PID.TID 0000.0001) // ===================================
794 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
795 (PID.TID 0000.0001) 2
796 (PID.TID 0000.0001) ;
797 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
798 (PID.TID 0000.0001) 2
799 (PID.TID 0000.0001) ;
800 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
801 (PID.TID 0000.0001) F
802 (PID.TID 0000.0001) ;
803 (PID.TID 0000.0001) AdamsBashforthGt = /* apply Adams-Bashforth extrapolation on Gt */
804 (PID.TID 0000.0001) T
805 (PID.TID 0000.0001) ;
806 (PID.TID 0000.0001) AdamsBashforth_T = /* apply Adams-Bashforth extrapolation on Temp */
807 (PID.TID 0000.0001) F
808 (PID.TID 0000.0001) ;
809 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
810 (PID.TID 0000.0001) 2
811 (PID.TID 0000.0001) ;
812 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
813 (PID.TID 0000.0001) 2
814 (PID.TID 0000.0001) ;
815 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
816 (PID.TID 0000.0001) F
817 (PID.TID 0000.0001) ;
818 (PID.TID 0000.0001) AdamsBashforthGs = /* apply Adams-Bashforth extrapolation on Gs */
819 (PID.TID 0000.0001) T
820 (PID.TID 0000.0001) ;
821 (PID.TID 0000.0001) AdamsBashforth_S = /* apply Adams-Bashforth extrapolation on Salt */
822 (PID.TID 0000.0001) F
823 (PID.TID 0000.0001) ;
824 (PID.TID 0000.0001) // ===================================
825 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
826 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
827 (PID.TID 0000.0001) F
828 (PID.TID 0000.0001) ;
829 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
830 (PID.TID 0000.0001) F
831 (PID.TID 0000.0001) ;
832 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
833 (PID.TID 0000.0001) F
834 (PID.TID 0000.0001) ;
835 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity ( m^2/s ) */
836 (PID.TID 0000.0001) 8.000000000000000E+02
837 (PID.TID 0000.0001) ;
838 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity ( m^2/s ) */
839 (PID.TID 0000.0001) 8.000000000000000E+02
840 (PID.TID 0000.0001) ;
841 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity ( m^2/s ) */
842 (PID.TID 0000.0001) 0.000000000000000E+00
843 (PID.TID 0000.0001) ;
844 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. ( ) */
845 (PID.TID 0000.0001) 0.000000000000000E+00
846 (PID.TID 0000.0001) ;
847 (PID.TID 0000.0001) Tapering/Cliping : gkw91
848 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
849 (PID.TID 0000.0001) 1.000000000000000E-12
850 (PID.TID 0000.0001) ;
851 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
852 (PID.TID 0000.0001) 1.000000000000000E+48
853 (PID.TID 0000.0001) ;
854 (PID.TID 0000.0001) %MON fCori_max = 1.4535016908525E-04
855 (PID.TID 0000.0001) %MON fCori_min = -1.4535016908525E-04
856 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
857 (PID.TID 0000.0001) %MON fCori_sd = 8.3972192788621E-05
858 (PID.TID 0000.0001) %MON fCoriG_max = 1.4544410433286E-04
859 (PID.TID 0000.0001) %MON fCoriG_min = -1.4544410433286E-04
860 (PID.TID 0000.0001) %MON fCoriG_mean = 0.0000000000000E+00
861 (PID.TID 0000.0001) %MON fCoriG_sd = 8.4860812167727E-05
862 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4540341538469E-04
863 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2264550201501E-06
864 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1482595466044E-04
865 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0292878037194E-05
866 (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
867 (PID.TID 0000.0001) INI_CG2D: cg2dTolerance = 5.809016360175293E-07 (Area=3.6388673751E+14)
868 (PID.TID 0000.0001)
869 (PID.TID 0000.0001) CONFIG_CHECK: OK
870 (PID.TID 0000.0001) // =======================================================
871 (PID.TID 0000.0001) // Model configuration
872 (PID.TID 0000.0001) // =======================================================
873 (PID.TID 0000.0001) //
874 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
875 (PID.TID 0000.0001) //
876 (PID.TID 0000.0001) buoyancyRelation = OCEANIC
877 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
878 (PID.TID 0000.0001) F
879 (PID.TID 0000.0001) ;
880 (PID.TID 0000.0001) fluidIsWater= /* fuild major constituent is Water */
881 (PID.TID 0000.0001) T
882 (PID.TID 0000.0001) ;
883 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
884 (PID.TID 0000.0001) F
885 (PID.TID 0000.0001) ;
886 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
887 (PID.TID 0000.0001) T
888 (PID.TID 0000.0001) ;
889 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or K ) */
890 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
891 (PID.TID 0000.0001) ;
892 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( psu ) */
893 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
894 (PID.TID 0000.0001) ;
895 (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
896 (PID.TID 0000.0001) 3.000000000000000E+05
897 (PID.TID 0000.0001) ;
898 (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
899 (PID.TID 0000.0001) 1.000000000000000E+21
900 (PID.TID 0000.0001) ;
901 (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
902 (PID.TID 0000.0001) 0.000000000000000E+00
903 (PID.TID 0000.0001) ;
904 (PID.TID 0000.0001) useFullLeith = /* Use Full Form of Leith Viscosity on/off flag*/
905 (PID.TID 0000.0001) F
906 (PID.TID 0000.0001) ;
907 (PID.TID 0000.0001) useStrainTensionVisc = /* Use StrainTension Form of Viscous Operator on/off flag*/
908 (PID.TID 0000.0001) F
909 (PID.TID 0000.0001) ;
910 (PID.TID 0000.0001) useAreaViscLength = /* Use area for visc length instead of geom. mean*/
911 (PID.TID 0000.0001) F
912 (PID.TID 0000.0001) ;
913 (PID.TID 0000.0001) viscC2leith = /* Leith harmonic visc. factor (on grad(vort),non-dim.) */
914 (PID.TID 0000.0001) 0.000000000000000E+00
915 (PID.TID 0000.0001) ;
916 (PID.TID 0000.0001) viscC2leithD = /* Leith harmonic viscosity factor (on grad(div),non-dim.) */
917 (PID.TID 0000.0001) 0.000000000000000E+00
918 (PID.TID 0000.0001) ;
919 (PID.TID 0000.0001) viscC2smag = /* Smagorinsky harmonic viscosity factor (non-dim.) */
920 (PID.TID 0000.0001) 0.000000000000000E+00
921 (PID.TID 0000.0001) ;
922 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
923 (PID.TID 0000.0001) 0.000000000000000E+00
924 (PID.TID 0000.0001) ;
925 (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
926 (PID.TID 0000.0001) 1.000000000000000E+21
927 (PID.TID 0000.0001) ;
928 (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
929 (PID.TID 0000.0001) 0.000000000000000E+00
930 (PID.TID 0000.0001) ;
931 (PID.TID 0000.0001) viscC4leith = /* Leith biharm viscosity factor (on grad(vort), non-dim.) */
932 (PID.TID 0000.0001) 0.000000000000000E+00
933 (PID.TID 0000.0001) ;
934 (PID.TID 0000.0001) viscC4leithD = /* Leith biharm viscosity factor (on grad(div), non-dim.) */
935 (PID.TID 0000.0001) 0.000000000000000E+00
936 (PID.TID 0000.0001) ;
937 (PID.TID 0000.0001) viscC4Smag = /* Smagorinsky biharm viscosity factor (non-dim) */
938 (PID.TID 0000.0001) 0.000000000000000E+00
939 (PID.TID 0000.0001) ;
940 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
941 (PID.TID 0000.0001) T
942 (PID.TID 0000.0001) ;
943 (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
944 (PID.TID 0000.0001) 2.000000000000000E+00
945 (PID.TID 0000.0001) ;
946 (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
947 (PID.TID 0000.0001) 1.000000000000000E-03
948 (PID.TID 0000.0001) ;
949 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
950 (PID.TID 0000.0001) T
951 (PID.TID 0000.0001) ;
952 (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( 1/s ) */
953 (PID.TID 0000.0001) 0.000000000000000E+00
954 (PID.TID 0000.0001) ;
955 (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coeff. ( 1/m ) */
956 (PID.TID 0000.0001) 0.000000000000000E+00
957 (PID.TID 0000.0001) ;
958 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
959 (PID.TID 0000.0001) 0.000000000000000E+00
960 (PID.TID 0000.0001) ;
961 (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
962 (PID.TID 0000.0001) 0.000000000000000E+00
963 (PID.TID 0000.0001) ;
964 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
965 (PID.TID 0000.0001) 0.000000000000000E+00
966 (PID.TID 0000.0001) ;
967 (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
968 (PID.TID 0000.0001) 0.000000000000000E+00
969 (PID.TID 0000.0001) ;
970 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
971 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
972 (PID.TID 0000.0001) ;
973 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
974 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
975 (PID.TID 0000.0001) ;
976 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 1979 ( m^2/s ) */
977 (PID.TID 0000.0001) 0.000000000000000E+00
978 (PID.TID 0000.0001) ;
979 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
980 (PID.TID 0000.0001) 0.000000000000000E+00
981 (PID.TID 0000.0001) ;
982 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
983 (PID.TID 0000.0001) 2.000000000000000E+02
984 (PID.TID 0000.0001) ;
985 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
986 (PID.TID 0000.0001) -2.000000000000000E+03
987 (PID.TID 0000.0001) ;
988 (PID.TID 0000.0001) Equation of State : eosType = JMD95Z ;
989 (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/oC ) */
990 (PID.TID 0000.0001) 1.234567000000000E+05
991 (PID.TID 0000.0001) ;
992 (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/psu ) */
993 (PID.TID 0000.0001) 1.234567000000000E+05
994 (PID.TID 0000.0001) ;
995 (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
996 (PID.TID 0000.0001) 1.035000000000000E+03
997 (PID.TID 0000.0001) ;
998 (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
999 (PID.TID 0000.0001) 1.035000000000000E+03
1000 (PID.TID 0000.0001) ;
1001 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
1002 (PID.TID 0000.0001) 1.000000000000000E+03
1003 (PID.TID 0000.0001) ;
1004 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
1005 (PID.TID 0000.0001) 9.810000000000000E+00
1006 (PID.TID 0000.0001) ;
1007 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
1008 (PID.TID 0000.0001) 9.810000000000000E+00
1009 (PID.TID 0000.0001) ;
1010 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
1011 (PID.TID 0000.0001) 8.640000000000000E+04
1012 (PID.TID 0000.0001) ;
1013 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
1014 (PID.TID 0000.0001) 7.272205216643040E-05
1015 (PID.TID 0000.0001) ;
1016 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
1017 (PID.TID 0000.0001) 1.000000000000000E-04
1018 (PID.TID 0000.0001) ;
1019 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
1020 (PID.TID 0000.0001) 9.999999999999999E-12
1021 (PID.TID 0000.0001) ;
1022 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
1023 (PID.TID 0000.0001) 1.000000000000000E+00
1024 (PID.TID 0000.0001) ;
1025 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
1026 (PID.TID 0000.0001) T
1027 (PID.TID 0000.0001) ;
1028 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
1029 (PID.TID 0000.0001) F
1030 (PID.TID 0000.0001) ;
1031 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
1032 (PID.TID 0000.0001) 1.000000000000000E+00
1033 (PID.TID 0000.0001) ;
1034 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
1035 (PID.TID 0000.0001) 1.000000000000000E+00
1036 (PID.TID 0000.0001) ;
1037 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
1038 (PID.TID 0000.0001) T
1039 (PID.TID 0000.0001) ;
1040 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
1041 (PID.TID 0000.0001) T
1042 (PID.TID 0000.0001) ;
1043 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
1044 (PID.TID 0000.0001) 4
1045 (PID.TID 0000.0001) ;
1046 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
1047 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
1048 (PID.TID 0000.0001) 2.000000000000000E-01
1049 (PID.TID 0000.0001) ;
1050 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
1051 (PID.TID 0000.0001) 2.000000000000000E+00
1052 (PID.TID 0000.0001) ;
1053 (PID.TID 0000.0001) select_rStar = /* r* Coordinate options (not yet implemented)*/
1054 (PID.TID 0000.0001) 2
1055 (PID.TID 0000.0001) ;
1056 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
1057 (PID.TID 0000.0001) T
1058 (PID.TID 0000.0001) ;
1059 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
1060 (PID.TID 0000.0001) 1.234567000000000E+05
1061 (PID.TID 0000.0001) ;
1062 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(ppt)*/
1063 (PID.TID 0000.0001) 0.000000000000000E+00
1064 (PID.TID 0000.0001) ;
1065 (PID.TID 0000.0001) use3Dsolver = /* use 3-D pressure solver on/off flag */
1066 (PID.TID 0000.0001) F
1067 (PID.TID 0000.0001) ;
1068 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
1069 (PID.TID 0000.0001) F
1070 (PID.TID 0000.0001) ;
1071 (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
1072 (PID.TID 0000.0001) 1.000000000000000E+00
1073 (PID.TID 0000.0001) ;
1074 (PID.TID 0000.0001) quasiHydrostatic = /* Quasi-Hydrostatic on/off flag */
1075 (PID.TID 0000.0001) F
1076 (PID.TID 0000.0001) ;
1077 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
1078 (PID.TID 0000.0001) T
1079 (PID.TID 0000.0001) ;
1080 (PID.TID 0000.0001) vectorInvariantMomentum= /* Vector-Invariant Momentum on/off */
1081 (PID.TID 0000.0001) T
1082 (PID.TID 0000.0001) ;
1083 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
1084 (PID.TID 0000.0001) T
1085 (PID.TID 0000.0001) ;
1086 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
1087 (PID.TID 0000.0001) T
1088 (PID.TID 0000.0001) ;
1089 (PID.TID 0000.0001) momImplVertAdv =/* Momentum implicit vert. advection on/off*/
1090 (PID.TID 0000.0001) F
1091 (PID.TID 0000.0001) ;
1092 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
1093 (PID.TID 0000.0001) F
1094 (PID.TID 0000.0001) ;
1095 (PID.TID 0000.0001) metricTerms = /* metric-Terms on/off flag */
1096 (PID.TID 0000.0001) F
1097 (PID.TID 0000.0001) ;
1098 (PID.TID 0000.0001) useNHMTerms = /* Non-Hydrostatic Metric-Terms on/off */
1099 (PID.TID 0000.0001) F
1100 (PID.TID 0000.0001) ;
1101 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
1102 (PID.TID 0000.0001) T
1103 (PID.TID 0000.0001) ;
1104 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
1105 (PID.TID 0000.0001) F
1106 (PID.TID 0000.0001) ;
1107 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
1108 (PID.TID 0000.0001) F
1109 (PID.TID 0000.0001) ;
1110 (PID.TID 0000.0001) useJamartMomAdv= /* V.I. Non-linear terms Jamart flag */
1111 (PID.TID 0000.0001) F
1112 (PID.TID 0000.0001) ;
1113 (PID.TID 0000.0001) SadournyCoriolis= /* Sadourny Coriolis discr. flag */
1114 (PID.TID 0000.0001) F
1115 (PID.TID 0000.0001) ;
1116 (PID.TID 0000.0001) upwindVorticity= /* Upwind bias vorticity flag */
1117 (PID.TID 0000.0001) F
1118 (PID.TID 0000.0001) ;
1119 (PID.TID 0000.0001) useAbsVorticity= /* Work with f+zeta in Coriolis */
1120 (PID.TID 0000.0001) F
1121 (PID.TID 0000.0001) ;
1122 (PID.TID 0000.0001) highOrderVorticity= /* High order interp. of vort. flag */
1123 (PID.TID 0000.0001) F
1124 (PID.TID 0000.0001) ;
1125 (PID.TID 0000.0001) upwindShear= /* Upwind vertical Shear advection flag */
1126 (PID.TID 0000.0001) F
1127 (PID.TID 0000.0001) ;
1128 (PID.TID 0000.0001) selectKEscheme= /* Kinetic Energy scheme selector */
1129 (PID.TID 0000.0001) 0
1130 (PID.TID 0000.0001) ;
1131 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
1132 (PID.TID 0000.0001) T
1133 (PID.TID 0000.0001) ;
1134 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
1135 (PID.TID 0000.0001) T
1136 (PID.TID 0000.0001) ;
1137 (PID.TID 0000.0001) implicitIntGravWave= /* Implicit Internal Gravity Wave flag */
1138 (PID.TID 0000.0001) F
1139 (PID.TID 0000.0001) ;
1140 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
1141 (PID.TID 0000.0001) T
1142 (PID.TID 0000.0001) ;
1143 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
1144 (PID.TID 0000.0001) T
1145 (PID.TID 0000.0001) ;
1146 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
1147 (PID.TID 0000.0001) F
1148 (PID.TID 0000.0001) ;
1149 (PID.TID 0000.0001) implicitDiffusion =/* Implicit Diffusion on/off flag */
1150 (PID.TID 0000.0001) T
1151 (PID.TID 0000.0001) ;
1152 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
1153 (PID.TID 0000.0001) T
1154 (PID.TID 0000.0001) ;
1155 (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
1156 (PID.TID 0000.0001) T
1157 (PID.TID 0000.0001) ;
1158 (PID.TID 0000.0001) tempImplVertAdv =/* Temp. implicit vert. advection on/off */
1159 (PID.TID 0000.0001) F
1160 (PID.TID 0000.0001) ;
1161 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
1162 (PID.TID 0000.0001) T
1163 (PID.TID 0000.0001) ;
1164 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
1165 (PID.TID 0000.0001) T
1166 (PID.TID 0000.0001) ;
1167 (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
1168 (PID.TID 0000.0001) T
1169 (PID.TID 0000.0001) ;
1170 (PID.TID 0000.0001) saltImplVertAdv =/* Sali. implicit vert. advection on/off */
1171 (PID.TID 0000.0001) F
1172 (PID.TID 0000.0001) ;
1173 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
1174 (PID.TID 0000.0001) T
1175 (PID.TID 0000.0001) ;
1176 (PID.TID 0000.0001) readBinaryPrec = /* Precision used for reading binary files */
1177 (PID.TID 0000.0001) 64
1178 (PID.TID 0000.0001) ;
1179 (PID.TID 0000.0001) writeBinaryPrec = /* Precision used for writing binary files */
1180 (PID.TID 0000.0001) 32
1181 (PID.TID 0000.0001) ;
1182 (PID.TID 0000.0001) globalFiles = /* write "global" (=not per tile) files */
1183 (PID.TID 0000.0001) F
1184 (PID.TID 0000.0001) ;
1185 (PID.TID 0000.0001) useSingleCpuIO = /* only master MPI process does I/O */
1186 (PID.TID 0000.0001) F
1187 (PID.TID 0000.0001) ;
1188 (PID.TID 0000.0001) debugMode = /* Debug Mode on/off flag */
1189 (PID.TID 0000.0001) F
1190 (PID.TID 0000.0001) ;
1191 (PID.TID 0000.0001) debLevA = /* 1rst level of debugging */
1192 (PID.TID 0000.0001) 1
1193 (PID.TID 0000.0001) ;
1194 (PID.TID 0000.0001) debLevB = /* 2nd level of debugging */
1195 (PID.TID 0000.0001) 2
1196 (PID.TID 0000.0001) ;
1197 (PID.TID 0000.0001) debugLevel = /* select debugging level */
1198 (PID.TID 0000.0001) 1
1199 (PID.TID 0000.0001) ;
1200 (PID.TID 0000.0001) //
1201 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
1202 (PID.TID 0000.0001) //
1203 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
1204 (PID.TID 0000.0001) 200
1205 (PID.TID 0000.0001) ;
1206 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
1207 (PID.TID 0000.0001) 1
1208 (PID.TID 0000.0001) ;
1209 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
1210 (PID.TID 0000.0001) 1.000000000000000E-07
1211 (PID.TID 0000.0001) ;
1212 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
1213 (PID.TID 0000.0001) 1.000000000000000E-14
1214 (PID.TID 0000.0001) ;
1215 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
1216 (PID.TID 0000.0001) 1
1217 (PID.TID 0000.0001) ;
1218 (PID.TID 0000.0001) //
1219 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
1220 (PID.TID 0000.0001) //
1221 (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
1222 (PID.TID 0000.0001) 36000
1223 (PID.TID 0000.0001) ;
1224 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
1225 (PID.TID 0000.0001) 20
1226 (PID.TID 0000.0001) ;
1227 (PID.TID 0000.0001) deltatTmom = /* Momentum equation timestep ( s ) */
1228 (PID.TID 0000.0001) 1.200000000000000E+03
1229 (PID.TID 0000.0001) ;
1230 (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
1231 (PID.TID 0000.0001) 8.640000000000000E+04
1232 (PID.TID 0000.0001) ;
1233 (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
1234 (PID.TID 0000.0001) 15 @ 8.640000000000000E+04 /* K = 1: 15 */
1235 (PID.TID 0000.0001) ;
1236 (PID.TID 0000.0001) deltatTClock = /* Model clock timestep ( s ) */
1237 (PID.TID 0000.0001) 8.640000000000000E+04
1238 (PID.TID 0000.0001) ;
1239 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1240 (PID.TID 0000.0001) 0.000000000000000E+00
1241 (PID.TID 0000.0001) ;
1242 (PID.TID 0000.0001) momForcingOutAB = /* =1: take Momentum Forcing out of Adams-Bash. stepping */
1243 (PID.TID 0000.0001) 0
1244 (PID.TID 0000.0001) ;
1245 (PID.TID 0000.0001) tracForcingOutAB = /* =1: take T,S,pTr Forcing out of Adams-Bash. stepping */
1246 (PID.TID 0000.0001) 1
1247 (PID.TID 0000.0001) ;
1248 (PID.TID 0000.0001) momDissip_In_AB = /* put Dissipation Tendency in Adams-Bash. stepping */
1249 (PID.TID 0000.0001) T
1250 (PID.TID 0000.0001) ;
1251 (PID.TID 0000.0001) doAB_onGtGs = /* apply AB on Tendencies (rather than on T,S)*/
1252 (PID.TID 0000.0001) T
1253 (PID.TID 0000.0001) ;
1254 (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
1255 (PID.TID 0000.0001) 1.000000000000000E-01
1256 (PID.TID 0000.0001) ;
1257 (PID.TID 0000.0001) baseTime = /* Model base time ( s ). */
1258 (PID.TID 0000.0001) 0.000000000000000E+00
1259 (PID.TID 0000.0001) ;
1260 (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
1261 (PID.TID 0000.0001) 3.110400000000000E+09
1262 (PID.TID 0000.0001) ;
1263 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
1264 (PID.TID 0000.0001) 3.112128000000000E+09
1265 (PID.TID 0000.0001) ;
1266 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
1267 (PID.TID 0000.0001) 3.110400000000000E+07
1268 (PID.TID 0000.0001) ;
1269 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
1270 (PID.TID 0000.0001) 0.000000000000000E+00
1271 (PID.TID 0000.0001) ;
1272 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1273 (PID.TID 0000.0001) T
1274 (PID.TID 0000.0001) ;
1275 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1276 (PID.TID 0000.0001) T
1277 (PID.TID 0000.0001) ;
1278 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1279 (PID.TID 0000.0001) F
1280 (PID.TID 0000.0001) ;
1281 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1282 (PID.TID 0000.0001) 3.110400000000000E+07
1283 (PID.TID 0000.0001) ;
1284 (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1285 (PID.TID 0000.0001) T
1286 (PID.TID 0000.0001) ;
1287 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1288 (PID.TID 0000.0001) T
1289 (PID.TID 0000.0001) ;
1290 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1291 (PID.TID 0000.0001) 1.000000000000000E+00
1292 (PID.TID 0000.0001) ;
1293 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1294 (PID.TID 0000.0001) T
1295 (PID.TID 0000.0001) ;
1296 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1297 (PID.TID 0000.0001) 2.592000000000000E+06
1298 (PID.TID 0000.0001) ;
1299 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1300 (PID.TID 0000.0001) 3.110400000000000E+07
1301 (PID.TID 0000.0001) ;
1302 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1303 (PID.TID 0000.0001) 5.184000000000000E+06
1304 (PID.TID 0000.0001) ;
1305 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1306 (PID.TID 0000.0001) 1.555200000000000E+07
1307 (PID.TID 0000.0001) ;
1308 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1309 (PID.TID 0000.0001) 5.000000000000000E+01
1310 (PID.TID 0000.0001) ;
1311 (PID.TID 0000.0001) //
1312 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1313 (PID.TID 0000.0001) //
1314 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True / False ) */
1315 (PID.TID 0000.0001) F
1316 (PID.TID 0000.0001) ;
1317 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True / False ) */
1318 (PID.TID 0000.0001) F
1319 (PID.TID 0000.0001) ;
1320 (PID.TID 0000.0001) usingCylindricalGrid = /* Spherical coordinates flag ( True / False ) */
1321 (PID.TID 0000.0001) F
1322 (PID.TID 0000.0001) ;
1323 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r ) */
1324 (PID.TID 0000.0001) 0.000000000000000E+00
1325 (PID.TID 0000.0001) ;
1326 (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1327 (PID.TID 0000.0001) -1.000000000000000E+00
1328 (PID.TID 0000.0001) ;
1329 (PID.TID 0000.0001) horiVertRatio = /* Ratio on units : Horiz - Vertical */
1330 (PID.TID 0000.0001) 1.000000000000000E+00
1331 (PID.TID 0000.0001) ;
1332 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1333 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1334 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1335 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1336 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1337 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1338 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1339 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1340 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1341 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1342 (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1343 (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1344 (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1345 (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1346 (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1347 (PID.TID 0000.0001) 6.650000000000000E+02 /* K = 15 */
1348 (PID.TID 0000.0001) ;
1349 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1350 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1351 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1352 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1353 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1354 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1355 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1356 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1357 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1358 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1359 (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1360 (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1361 (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1362 (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1363 (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1364 (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1365 (PID.TID 0000.0001) ;
1366 (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
1367 (PID.TID 0000.0001) 192 @ 1.234567000000000E+05 /* I = 1:192 */
1368 (PID.TID 0000.0001) ;
1369 (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
1370 (PID.TID 0000.0001) 32 @ 1.234567000000000E+05 /* J = 1: 32 */
1371 (PID.TID 0000.0001) ;
1372 (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
1373 (PID.TID 0000.0001) 0.000000000000000E+00
1374 (PID.TID 0000.0001) ;
1375 (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
1376 (PID.TID 0000.0001) 0.000000000000000E+00
1377 (PID.TID 0000.0001) ;
1378 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1379 (PID.TID 0000.0001) 6.370000000000000E+06
1380 (PID.TID 0000.0001) ;
1381 (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
1382 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1383 (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1384 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1385 (PID.TID 0000.0001) -3.923446288487304E+01, /* I = 4 */
1386 (PID.TID 0000.0001) -3.702585158682200E+01, /* I = 5 */
1387 (PID.TID 0000.0001) -3.461179367094151E+01, /* I = 6 */
1388 (PID.TID 0000.0001) -3.200434569041793E+01, /* I = 7 */
1389 (PID.TID 0000.0001) -2.921355965632675E+01, /* I = 8 */
1390 (PID.TID 0000.0001) -2.624932223028290E+01, /* I = 9 */
1391 (PID.TID 0000.0001) -2.312261250426344E+01, /* I = 10 */
1392 (PID.TID 0000.0001) -1.984640717127058E+01, /* I = 11 */
1393 (PID.TID 0000.0001) -1.643630800555134E+01, /* I = 12 */
1394 (PID.TID 0000.0001) -1.291089806302069E+01, /* I = 13 */
1395 (PID.TID 0000.0001) -9.291807802719402E+00, /* I = 14 */
1396 (PID.TID 0000.0001) -5.603475335822332E+00, /* I = 15 */
1397 (PID.TID 0000.0001) -1.872608513033445E+00, /* I = 16 */
1398 (PID.TID 0000.0001) 1.872608513033445E+00, /* I = 17 */
1399 (PID.TID 0000.0001) 5.603475335822332E+00, /* I = 18 */
1400 (PID.TID 0000.0001) 9.291807802719402E+00, /* I = 19 */
1401 (PID.TID 0000.0001) 1.291089806302069E+01, /* I = 20 */
1402 (PID.TID 0000.0001) 1.643630800555134E+01, /* I = 21 */
1403 (PID.TID 0000.0001) 1.984640717127058E+01, /* I = 22 */
1404 (PID.TID 0000.0001) 2.312261250426344E+01, /* I = 23 */
1405 (PID.TID 0000.0001) 2.624932223028290E+01, /* I = 24 */
1406 (PID.TID 0000.0001) 2.921355965632675E+01, /* I = 25 */
1407 (PID.TID 0000.0001) 3.200434569041793E+01, /* I = 26 */
1408 (PID.TID 0000.0001) 3.461179367094151E+01, /* I = 27 */
1409 (PID.TID 0000.0001) 3.702585158682200E+01, /* I = 28 */
1410 (PID.TID 0000.0001) 3.923446288487304E+01, /* I = 29 */
1411 (PID.TID 0000.0001) 4.122055553388957E+01, /* I = 30 */
1412 (PID.TID 0000.0001) 4.295641272275883E+01, /* I = 31 */
1413 (PID.TID 0000.0001) 4.439521994760536E+01, /* I = 32 */
1414 (PID.TID 0000.0001) 4.560478005239464E+01, /* I = 33 */
1415 (PID.TID 0000.0001) 4.704358727724117E+01, /* I = 34 */
1416 (PID.TID 0000.0001) 4.877944446611043E+01, /* I = 35 */
1417 (PID.TID 0000.0001) 5.076553711512697E+01, /* I = 36 */
1418 (PID.TID 0000.0001) 5.297414841317801E+01, /* I = 37 */
1419 (PID.TID 0000.0001) 5.538820632905850E+01, /* I = 38 */
1420 (PID.TID 0000.0001) 5.799565430958209E+01, /* I = 39 */
1421 (PID.TID 0000.0001) 6.078644034367325E+01, /* I = 40 */
1422 (PID.TID 0000.0001) 6.375067776971711E+01, /* I = 41 */
1423 (PID.TID 0000.0001) 6.687738749573657E+01, /* I = 42 */
1424 (PID.TID 0000.0001) 7.015359282872943E+01, /* I = 43 */
1425 (PID.TID 0000.0001) 7.356369199444866E+01, /* I = 44 */
1426 (PID.TID 0000.0001) 7.708910193697932E+01, /* I = 45 */
1427 (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1428 (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1429 (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1430 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1431 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1432 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1433 (PID.TID 0000.0001) 1.029108980630207E+02, /* I = 52 */
1434 (PID.TID 0000.0001) 1.064363080055513E+02, /* I = 53 */
1435 (PID.TID 0000.0001) 1.098464071712706E+02, /* I = 54 */
1436 (PID.TID 0000.0001) 1.131226125042634E+02, /* I = 55 */
1437 (PID.TID 0000.0001) 1.162493222302829E+02, /* I = 56 */
1438 (PID.TID 0000.0001) 1.192135596563268E+02, /* I = 57 */
1439 (PID.TID 0000.0001) 1.220043456904179E+02, /* I = 58 */
1440 (PID.TID 0000.0001) 1.246117936709415E+02, /* I = 59 */
1441 (PID.TID 0000.0001) 1.270258515868220E+02, /* I = 60 */
1442 (PID.TID 0000.0001) 1.292344628848730E+02, /* I = 61 */
1443 (PID.TID 0000.0001) 1.312205555338896E+02, /* I = 62 */
1444 (PID.TID 0000.0001) 1.329564127227588E+02, /* I = 63 */
1445 (PID.TID 0000.0001) 1.343952199476053E+02, /* I = 64 */
1446 (PID.TID 0000.0001) 4.500000000000000E+01, /* I = 65 */
1447 (PID.TID 0000.0001) 4.620805468796297E+01, /* I = 66 */
1448 (PID.TID 0000.0001) 4.781369642513039E+01, /* I = 67 */
1449 (PID.TID 0000.0001) 4.971767671143929E+01, /* I = 68 */
1450 (PID.TID 0000.0001) 5.187738319787235E+01, /* I = 69 */
1451 (PID.TID 0000.0001) 5.427004371478710E+01, /* I = 70 */
1452 (PID.TID 0000.0001) 5.688128325334060E+01, /* I = 71 */
1453 (PID.TID 0000.0001) 5.970018167786760E+01, /* I = 72 */
1454 (PID.TID 0000.0001) 6.271654991792347E+01, /* I = 73 */
1455 (PID.TID 0000.0001) 6.591914604853015E+01, /* I = 74 */
1456 (PID.TID 0000.0001) 6.929439270484148E+01, /* I = 75 */
1457 (PID.TID 0000.0001) 7.282545807616151E+01, /* I = 76 */
1458 (PID.TID 0000.0001) 7.649168830618933E+01, /* I = 77 */
1459 (PID.TID 0000.0001) 8.026842803787176E+01, /* I = 78 */
1460 (PID.TID 0000.0001) 8.412726743124185E+01, /* I = 79 */
1461 (PID.TID 0000.0001) 8.803672008547504E+01, /* I = 80 */
1462 (PID.TID 0000.0001) 9.196327991452496E+01, /* I = 81 */
1463 (PID.TID 0000.0001) 9.587273256875815E+01, /* I = 82 */
1464 (PID.TID 0000.0001) 9.973157196212824E+01, /* I = 83 */
1465 (PID.TID 0000.0001) 1.035083116938107E+02, /* I = 84 */
1466 (PID.TID 0000.0001) 1.071745419238385E+02, /* I = 85 */
1467 (PID.TID 0000.0001) 1.107056072951585E+02, /* I = 86 */
1468 (PID.TID 0000.0001) 1.140808539514698E+02, /* I = 87 */
1469 (PID.TID 0000.0001) 1.172834500820765E+02, /* I = 88 */
1470 (PID.TID 0000.0001) 1.202998183221324E+02, /* I = 89 */
1471 (PID.TID 0000.0001) 1.231187167466594E+02, /* I = 90 */
1472 (PID.TID 0000.0001) 1.257299562852129E+02, /* I = 91 */
1473 (PID.TID 0000.0001) 1.281226168021277E+02, /* I = 92 */
1474 (PID.TID 0000.0001) 1.302823232885607E+02, /* I = 93 */
1475 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1476 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1477 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1478 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1479 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1480 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1481 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =100 */
1482 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =101 */
1483 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =102 */
1484 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =103 */
1485 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =104 */
1486 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =105 */
1487 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =106 */
1488 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =107 */
1489 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =108 */
1490 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =109 */
1491 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =110 */
1492 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =111 */
1493 (PID.TID 0000.0001) 2 @ 1.363550967500717E+02, /* I =112:113 */
1494 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =114 */
1495 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =115 */
1496 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =116 */
1497 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =117 */
1498 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =118 */
1499 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =119 */
1500 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =120 */
1501 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =121 */
1502 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =122 */
1503 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =123 */
1504 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =124 */
1505 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =125 */
1506 (PID.TID 0000.0001) 1.359720382181193E+02, /* I =126 */
1507 (PID.TID 0000.0001) 1.358367907661329E+02, /* I =127 */
1508 (PID.TID 0000.0001) 1.356047800523947E+02, /* I =128 */
1509 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =129 */
1510 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =130 */
1511 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =131 */
1512 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =132 */
1513 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =133 */
1514 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =134 */
1515 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =135 */
1516 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =136 */
1517 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =137 */
1518 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =138 */
1519 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =139 */
1520 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =140 */
1521 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =141 */
1522 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1523 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1524 (PID.TID 0000.0001) 2 @ -1.336449032499283E+02, /* I =144:145 */
1525 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1526 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1527 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =148 */
1528 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =149 */
1529 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =150 */
1530 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =151 */
1531 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =152 */
1532 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =153 */
1533 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =154 */
1534 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =155 */
1535 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =156 */
1536 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =157 */
1537 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =158 */
1538 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =159 */
1539 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =160 */
1540 (PID.TID 0000.0001) -1.350000000000000E+02, /* I =161 */
1541 (PID.TID 0000.0001) -1.362080546879630E+02, /* I =162 */
1542 (PID.TID 0000.0001) -1.378136964251304E+02, /* I =163 */
1543 (PID.TID 0000.0001) -1.397176767114393E+02, /* I =164 */
1544 (PID.TID 0000.0001) -1.418773831978723E+02, /* I =165 */
1545 (PID.TID 0000.0001) -1.442700437147871E+02, /* I =166 */
1546 (PID.TID 0000.0001) -1.468812832533406E+02, /* I =167 */
1547 (PID.TID 0000.0001) -1.497001816778676E+02, /* I =168 */
1548 (PID.TID 0000.0001) -1.527165499179235E+02, /* I =169 */
1549 (PID.TID 0000.0001) -1.559191460485302E+02, /* I =170 */
1550 (PID.TID 0000.0001) -1.592943927048415E+02, /* I =171 */
1551 (PID.TID 0000.0001) -1.628254580761615E+02, /* I =172 */
1552 (PID.TID 0000.0001) -1.664916883061893E+02, /* I =173 */
1553 (PID.TID 0000.0001) -1.702684280378718E+02, /* I =174 */
1554 (PID.TID 0000.0001) -1.741272674312418E+02, /* I =175 */
1555 (PID.TID 0000.0001) -1.780367200854751E+02, /* I =176 */
1556 (PID.TID 0000.0001) 1.780367200854751E+02, /* I =177 */
1557 (PID.TID 0000.0001) 1.741272674312418E+02, /* I =178 */
1558 (PID.TID 0000.0001) 1.702684280378718E+02, /* I =179 */
1559 (PID.TID 0000.0001) 1.664916883061893E+02, /* I =180 */
1560 (PID.TID 0000.0001) 1.628254580761615E+02, /* I =181 */
1561 (PID.TID 0000.0001) 1.592943927048415E+02, /* I =182 */
1562 (PID.TID 0000.0001) 1.559191460485302E+02, /* I =183 */
1563 (PID.TID 0000.0001) 1.527165499179235E+02, /* I =184 */
1564 (PID.TID 0000.0001) 1.497001816778676E+02, /* I =185 */
1565 (PID.TID 0000.0001) 1.468812832533406E+02, /* I =186 */
1566 (PID.TID 0000.0001) 1.442700437147871E+02, /* I =187 */
1567 (PID.TID 0000.0001) 1.418773831978723E+02, /* I =188 */
1568 (PID.TID 0000.0001) 1.397176767114393E+02, /* I =189 */
1569 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1570 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1571 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1572 (PID.TID 0000.0001) ;
1573 (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
1574 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1575 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1576 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1577 (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1578 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1579 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1580 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1581 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1582 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1583 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1584 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1585 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1586 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1587 (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1588 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1589 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1590 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1591 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1592 (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1593 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1594 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1595 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1596 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1597 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1598 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1599 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1600 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1601 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1602 (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1603 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1604 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1605 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1606 (PID.TID 0000.0001) ;
1607 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1608 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1609 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1610 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1611 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1612 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1613 (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1614 (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1615 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1616 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1617 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1618 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1619 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1620 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1621 (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1622 (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1623 (PID.TID 0000.0001) ;
1624 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1625 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1626 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1627 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1628 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1629 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1630 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1631 (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1632 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1633 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1634 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1635 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1636 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1637 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1638 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1639 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1640 (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1641 (PID.TID 0000.0001) ;
1642 (PID.TID 0000.0001) dBdrRef = /* Vertical gradient of reference boyancy [(m/s/r)^2)] */
1643 (PID.TID 0000.0001) 15 @ 0.000000000000000E+00 /* K = 1: 15 */
1644 (PID.TID 0000.0001) ;
1645 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1646 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1647 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1648 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1649 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 4 */
1650 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 5 */
1651 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 6 */
1652 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 7 */
1653 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 8 */
1654 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 9 */
1655 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 10 */
1656 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 11 */
1657 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 12 */
1658 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 13 */
1659 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 14 */
1660 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 15 */
1661 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 16: 17 */
1662 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 18 */
1663 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 19 */
1664 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 20 */
1665 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 21 */
1666 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 22 */
1667 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 23 */
1668 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 24 */
1669 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 25 */
1670 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 26 */
1671 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 27 */
1672 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 28 */
1673 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 29 */
1674 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 30 */
1675 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 31 */
1676 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1677 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 34 */
1678 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 35 */
1679 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 36 */
1680 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 37 */
1681 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 38 */
1682 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 39 */
1683 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 40 */
1684 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 41 */
1685 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 42 */
1686 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 43 */
1687 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 44 */
1688 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 45 */
1689 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1690 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1691 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 48: 49 */
1692 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1693 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1694 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 52 */
1695 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 53 */
1696 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 54 */
1697 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 55 */
1698 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 56 */
1699 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 57 */
1700 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 58 */
1701 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 59 */
1702 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 60 */
1703 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 61 */
1704 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 62 */
1705 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 63 */
1706 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1707 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 66 */
1708 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 67 */
1709 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 68 */
1710 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 69 */
1711 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 70 */
1712 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 71 */
1713 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 72 */
1714 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 73 */
1715 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 74 */
1716 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 75 */
1717 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 76 */
1718 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 77 */
1719 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 78 */
1720 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 79 */
1721 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 80: 81 */
1722 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 82 */
1723 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 83 */
1724 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 84 */
1725 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 85 */
1726 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 86 */
1727 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 87 */
1728 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 88 */
1729 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 89 */
1730 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 90 */
1731 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 91 */
1732 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 92 */
1733 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 93 */
1734 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1735 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1736 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1737 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1738 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1739 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =100 */
1740 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =101 */
1741 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =102 */
1742 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =103 */
1743 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =104 */
1744 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =105 */
1745 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =106 */
1746 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =107 */
1747 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =108 */
1748 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =109 */
1749 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =110 */
1750 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =111 */
1751 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =112:113 */
1752 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =114 */
1753 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =115 */
1754 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =116 */
1755 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =117 */
1756 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =118 */
1757 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =119 */
1758 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =120 */
1759 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =121 */
1760 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =122 */
1761 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =123 */
1762 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =124 */
1763 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =125 */
1764 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =126 */
1765 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =127 */
1766 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1767 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =130 */
1768 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =131 */
1769 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =132 */
1770 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =133 */
1771 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =134 */
1772 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =135 */
1773 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =136 */
1774 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =137 */
1775 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =138 */
1776 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =139 */
1777 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =140 */
1778 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =141 */
1779 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
1780 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
1781 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =144:145 */
1782 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
1783 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
1784 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =148 */
1785 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =149 */
1786 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =150 */
1787 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =151 */
1788 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =152 */
1789 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =153 */
1790 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =154 */
1791 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =155 */
1792 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =156 */
1793 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =157 */
1794 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =158 */
1795 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =159 */
1796 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1797 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =162 */
1798 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =163 */
1799 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =164 */
1800 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =165 */
1801 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =166 */
1802 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =167 */
1803 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =168 */
1804 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =169 */
1805 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =170 */
1806 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =171 */
1807 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =172 */
1808 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =173 */
1809 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =174 */
1810 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =175 */
1811 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =176:177 */
1812 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =178 */
1813 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =179 */
1814 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =180 */
1815 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =181 */
1816 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =182 */
1817 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =183 */
1818 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =184 */
1819 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =185 */
1820 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =186 */
1821 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =187 */
1822 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =188 */
1823 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =189 */
1824 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
1825 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
1826 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1827 (PID.TID 0000.0001) ;
1828 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( m - cartesian, degrees - spherical ) */
1829 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1830 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
1831 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
1832 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
1833 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
1834 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
1835 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
1836 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
1837 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
1838 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
1839 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
1840 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
1841 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
1842 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
1843 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
1844 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
1845 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
1846 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
1847 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
1848 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
1849 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
1850 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
1851 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
1852 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
1853 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
1854 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
1855 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
1856 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
1857 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
1858 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
1859 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1860 (PID.TID 0000.0001) ;
1861 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1862 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1863 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
1864 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
1865 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 4 */
1866 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 5 */
1867 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 6 */
1868 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 7 */
1869 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 8 */
1870 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 9 */
1871 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 10 */
1872 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 11 */
1873 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 12 */
1874 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 13 */
1875 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 14 */
1876 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 15 */
1877 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 16: 17 */
1878 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 18 */
1879 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 19 */
1880 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 20 */
1881 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 21 */
1882 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 22 */
1883 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 23 */
1884 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 24 */
1885 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 25 */
1886 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 26 */
1887 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 27 */
1888 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 28 */
1889 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 29 */
1890 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 30 */
1891 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 31 */
1892 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1893 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 34 */
1894 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 35 */
1895 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 36 */
1896 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 37 */
1897 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 38 */
1898 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 39 */
1899 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 40 */
1900 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 41 */
1901 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 42 */
1902 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 43 */
1903 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 44 */
1904 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 45 */
1905 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
1906 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
1907 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 48: 49 */
1908 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
1909 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
1910 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 52 */
1911 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 53 */
1912 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 54 */
1913 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 55 */
1914 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 56 */
1915 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 57 */
1916 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 58 */
1917 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 59 */
1918 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 60 */
1919 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 61 */
1920 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 62 */
1921 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 63 */
1922 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1923 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 66 */
1924 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 67 */
1925 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 68 */
1926 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 69 */
1927 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 70 */
1928 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 71 */
1929 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 72 */
1930 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 73 */
1931 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 74 */
1932 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 75 */
1933 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 76 */
1934 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 77 */
1935 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 78 */
1936 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 79 */
1937 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 80: 81 */
1938 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 82 */
1939 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 83 */
1940 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 84 */
1941 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 85 */
1942 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 86 */
1943 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 87 */
1944 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 88 */
1945 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 89 */
1946 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 90 */
1947 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 91 */
1948 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 92 */
1949 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 93 */
1950 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
1951 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
1952 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1953 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
1954 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
1955 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =100 */
1956 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =101 */
1957 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =102 */
1958 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =103 */
1959 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =104 */
1960 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =105 */
1961 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =106 */
1962 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =107 */
1963 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =108 */
1964 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =109 */
1965 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =110 */
1966 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =111 */
1967 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =112:113 */
1968 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =114 */
1969 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =115 */
1970 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =116 */
1971 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =117 */
1972 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =118 */
1973 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =119 */
1974 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =120 */
1975 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =121 */
1976 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =122 */
1977 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =123 */
1978 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =124 */
1979 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =125 */
1980 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =126 */
1981 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =127 */
1982 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1983 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =130 */
1984 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =131 */
1985 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =132 */
1986 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =133 */
1987 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =134 */
1988 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =135 */
1989 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =136 */
1990 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =137 */
1991 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =138 */
1992 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =139 */
1993 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =140 */
1994 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =141 */
1995 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
1996 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
1997 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =144:145 */
1998 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
1999 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
2000 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =148 */
2001 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =149 */
2002 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =150 */
2003 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =151 */
2004 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =152 */
2005 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =153 */
2006 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =154 */
2007 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =155 */
2008 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =156 */
2009 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =157 */
2010 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =158 */
2011 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =159 */
2012 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
2013 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =162 */
2014 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =163 */
2015 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =164 */
2016 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =165 */
2017 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =166 */
2018 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =167 */
2019 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =168 */
2020 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =169 */
2021 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =170 */
2022 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =171 */
2023 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =172 */
2024 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =173 */
2025 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =174 */
2026 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =175 */
2027 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =176:177 */
2028 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =178 */
2029 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =179 */
2030 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =180 */
2031 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =181 */
2032 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =182 */
2033 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =183 */
2034 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =184 */
2035 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =185 */
2036 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =186 */
2037 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =187 */
2038 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =188 */
2039 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =189 */
2040 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
2041 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
2042 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
2043 (PID.TID 0000.0001) ;
2044 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2045 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
2046 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
2047 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
2048 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
2049 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
2050 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
2051 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
2052 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
2053 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
2054 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
2055 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
2056 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
2057 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
2058 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
2059 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
2060 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
2061 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
2062 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
2063 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
2064 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
2065 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
2066 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
2067 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
2068 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
2069 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
2070 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
2071 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
2072 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
2073 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
2074 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
2075 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
2076 (PID.TID 0000.0001) ;
2077 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2078 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2079 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
2080 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
2081 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 4 */
2082 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 5 */
2083 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 6 */
2084 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 7 */
2085 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 8 */
2086 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 9 */
2087 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 10 */
2088 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 11 */
2089 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 12 */
2090 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 13 */
2091 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 14 */
2092 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 15 */
2093 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 16: 17 */
2094 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 18 */
2095 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 19 */
2096 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 20 */
2097 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 21 */
2098 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 22 */
2099 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 23 */
2100 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 24 */
2101 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 25 */
2102 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 26 */
2103 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 27 */
2104 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 28 */
2105 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 29 */
2106 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 30 */
2107 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 31 */
2108 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 32: 33 */
2109 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 34 */
2110 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 35 */
2111 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 36 */
2112 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 37 */
2113 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 38 */
2114 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 39 */
2115 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 40 */
2116 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 41 */
2117 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 42 */
2118 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 43 */
2119 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 44 */
2120 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 45 */
2121 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
2122 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
2123 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 48: 49 */
2124 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
2125 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
2126 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 52 */
2127 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 53 */
2128 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 54 */
2129 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 55 */
2130 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 56 */
2131 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 57 */
2132 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 58 */
2133 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 59 */
2134 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 60 */
2135 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 61 */
2136 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 62 */
2137 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 63 */
2138 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 64: 65 */
2139 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 66 */
2140 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 67 */
2141 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 68 */
2142 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 69 */
2143 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 70 */
2144 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 71 */
2145 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 72 */
2146 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 73 */
2147 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 74 */
2148 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 75 */
2149 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 76 */
2150 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 77 */
2151 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 78 */
2152 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 79 */
2153 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 80: 81 */
2154 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 82 */
2155 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 83 */
2156 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 84 */
2157 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 85 */
2158 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 86 */
2159 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 87 */
2160 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 88 */
2161 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 89 */
2162 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 90 */
2163 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 91 */
2164 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 92 */
2165 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 93 */
2166 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
2167 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
2168 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 96: 97 */
2169 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
2170 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
2171 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =100 */
2172 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =101 */
2173 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =102 */
2174 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =103 */
2175 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =104 */
2176 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =105 */
2177 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =106 */
2178 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =107 */
2179 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =108 */
2180 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =109 */
2181 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =110 */
2182 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =111 */
2183 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =112:113 */
2184 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =114 */
2185 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =115 */
2186 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =116 */
2187 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =117 */
2188 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =118 */
2189 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =119 */
2190 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =120 */
2191 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =121 */
2192 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =122 */
2193 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =123 */
2194 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =124 */
2195 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =125 */
2196 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =126 */
2197 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =127 */
2198 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =128:129 */
2199 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =130 */
2200 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =131 */
2201 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =132 */
2202 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =133 */
2203 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =134 */
2204 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =135 */
2205 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =136 */
2206 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =137 */
2207 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =138 */
2208 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =139 */
2209 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =140 */
2210 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =141 */
2211 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
2212 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
2213 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =144:145 */
2214 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
2215 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
2216 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =148 */
2217 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =149 */
2218 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =150 */
2219 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =151 */
2220 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =152 */
2221 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =153 */
2222 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =154 */
2223 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =155 */
2224 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =156 */
2225 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =157 */
2226 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =158 */
2227 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =159 */
2228 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =160:161 */
2229 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =162 */
2230 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =163 */
2231 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =164 */
2232 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =165 */
2233 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =166 */
2234 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =167 */
2235 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =168 */
2236 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =169 */
2237 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =170 */
2238 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =171 */
2239 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =172 */
2240 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =173 */
2241 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =174 */
2242 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =175 */
2243 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =176:177 */
2244 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =178 */
2245 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =179 */
2246 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =180 */
2247 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =181 */
2248 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =182 */
2249 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =183 */
2250 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =184 */
2251 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =185 */
2252 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =186 */
2253 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =187 */
2254 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =188 */
2255 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =189 */
2256 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
2257 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
2258 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
2259 (PID.TID 0000.0001) ;
2260 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2261 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2262 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
2263 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
2264 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
2265 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
2266 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
2267 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
2268 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
2269 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
2270 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
2271 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
2272 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
2273 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
2274 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
2275 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
2276 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
2277 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
2278 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
2279 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
2280 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
2281 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
2282 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
2283 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
2284 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
2285 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
2286 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
2287 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
2288 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
2289 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
2290 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
2291 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
2292 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
2293 (PID.TID 0000.0001) ;
2294 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2295 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2296 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
2297 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
2298 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 4 */
2299 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 5 */
2300 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 6 */
2301 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 7 */
2302 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 8 */
2303 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 9 */
2304 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 10 */
2305 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 11 */
2306 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 12 */
2307 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 13 */
2308 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 14 */
2309 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 15 */
2310 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 16 */
2311 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 17 */
2312 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 18 */
2313 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 19 */
2314 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 20 */
2315 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 21 */
2316 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 22 */
2317 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 23 */
2318 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 24 */
2319 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 25 */
2320 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 26 */
2321 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 27 */
2322 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 28 */
2323 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 29 */
2324 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 30 */
2325 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 31 */
2326 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 32 */
2327 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 33 */
2328 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 34 */
2329 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 35 */
2330 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 36 */
2331 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 37 */
2332 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 38 */
2333 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 39 */
2334 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 40 */
2335 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 41 */
2336 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 42 */
2337 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 43 */
2338 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 44 */
2339 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 45 */
2340 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
2341 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
2342 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
2343 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
2344 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
2345 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
2346 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 52 */
2347 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 53 */
2348 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 54 */
2349 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 55 */
2350 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 56 */
2351 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 57 */
2352 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 58 */
2353 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 59 */
2354 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 60 */
2355 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 61 */
2356 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 62 */
2357 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 63 */
2358 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 64 */
2359 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 65 */
2360 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 66 */
2361 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 67 */
2362 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 68 */
2363 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 69 */
2364 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 70 */
2365 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 71 */
2366 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 72 */
2367 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 73 */
2368 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 74 */
2369 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 75 */
2370 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 76 */
2371 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 77 */
2372 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 78 */
2373 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 79 */
2374 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 80 */
2375 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 81 */
2376 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 82 */
2377 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 83 */
2378 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 84 */
2379 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 85 */
2380 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 86 */
2381 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 87 */
2382 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 88 */
2383 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 89 */
2384 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 90 */
2385 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 91 */
2386 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 92 */
2387 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 93 */
2388 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
2389 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
2390 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
2391 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
2392 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
2393 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
2394 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =100 */
2395 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =101 */
2396 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =102 */
2397 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =103 */
2398 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =104 */
2399 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =105 */
2400 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =106 */
2401 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =107 */
2402 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =108 */
2403 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =109 */
2404 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =110 */
2405 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =111 */
2406 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =112 */
2407 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =113 */
2408 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =114 */
2409 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =115 */
2410 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =116 */
2411 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =117 */
2412 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =118 */
2413 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =119 */
2414 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =120 */
2415 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =121 */
2416 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =122 */
2417 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =123 */
2418 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =124 */
2419 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =125 */
2420 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =126 */
2421 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =127 */
2422 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =128 */
2423 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =129 */
2424 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =130 */
2425 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =131 */
2426 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =132 */
2427 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =133 */
2428 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =134 */
2429 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =135 */
2430 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =136 */
2431 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =137 */
2432 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =138 */
2433 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =139 */
2434 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =140 */
2435 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =141 */
2436 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
2437 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
2438 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
2439 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
2440 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
2441 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
2442 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =148 */
2443 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =149 */
2444 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =150 */
2445 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =151 */
2446 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =152 */
2447 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =153 */
2448 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =154 */
2449 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =155 */
2450 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =156 */
2451 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =157 */
2452 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =158 */
2453 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =159 */
2454 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =160 */
2455 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =161 */
2456 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =162 */
2457 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =163 */
2458 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =164 */
2459 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =165 */
2460 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =166 */
2461 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =167 */
2462 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =168 */
2463 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =169 */
2464 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =170 */
2465 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =171 */
2466 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =172 */
2467 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =173 */
2468 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =174 */
2469 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =175 */
2470 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =176 */
2471 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =177 */
2472 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =178 */
2473 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =179 */
2474 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =180 */
2475 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =181 */
2476 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =182 */
2477 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =183 */
2478 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =184 */
2479 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =185 */
2480 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =186 */
2481 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =187 */
2482 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =188 */
2483 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =189 */
2484 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
2485 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
2486 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
2487 (PID.TID 0000.0001) ;
2488 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2489 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2490 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
2491 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
2492 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
2493 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
2494 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
2495 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
2496 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
2497 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
2498 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
2499 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
2500 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
2501 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
2502 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
2503 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
2504 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
2505 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
2506 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
2507 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
2508 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
2509 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
2510 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
2511 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
2512 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
2513 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
2514 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
2515 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
2516 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
2517 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
2518 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
2519 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
2520 (PID.TID 0000.0001) ;
2521 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2522 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2523 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
2524 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
2525 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 4 */
2526 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 5 */
2527 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 6 */
2528 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 7 */
2529 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 8 */
2530 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 9 */
2531 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 10 */
2532 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 11 */
2533 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 12 */
2534 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 13 */
2535 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 14 */
2536 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 15 */
2537 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 16 */
2538 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 17 */
2539 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 18 */
2540 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 19 */
2541 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 20 */
2542 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 21 */
2543 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 22 */
2544 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 23 */
2545 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 24 */
2546 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 25 */
2547 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 26 */
2548 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 27 */
2549 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 28 */
2550 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 29 */
2551 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 30 */
2552 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 31 */
2553 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 32 */
2554 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 33 */
2555 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 34 */
2556 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 35 */
2557 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 36 */
2558 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 37 */
2559 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 38 */
2560 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 39 */
2561 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 40 */
2562 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 41 */
2563 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 42 */
2564 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 43 */
2565 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 44 */
2566 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 45 */
2567 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
2568 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
2569 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
2570 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
2571 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
2572 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
2573 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 52 */
2574 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 53 */
2575 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 54 */
2576 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 55 */
2577 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 56 */
2578 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 57 */
2579 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 58 */
2580 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 59 */
2581 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 60 */
2582 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 61 */
2583 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 62 */
2584 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 63 */
2585 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 64 */
2586 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 65 */
2587 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 66 */
2588 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 67 */
2589 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 68 */
2590 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 69 */
2591 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 70 */
2592 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 71 */
2593 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 72 */
2594 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 73 */
2595 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 74 */
2596 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 75 */
2597 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 76 */
2598 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 77 */
2599 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 78 */
2600 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 79 */
2601 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 80 */
2602 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 81 */
2603 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 82 */
2604 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 83 */
2605 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 84 */
2606 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 85 */
2607 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 86 */
2608 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 87 */
2609 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 88 */
2610 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 89 */
2611 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 90 */
2612 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 91 */
2613 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 92 */
2614 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 93 */
2615 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
2616 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
2617 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
2618 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
2619 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
2620 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
2621 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =100 */
2622 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =101 */
2623 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =102 */
2624 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =103 */
2625 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =104 */
2626 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =105 */
2627 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =106 */
2628 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =107 */
2629 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =108 */
2630 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =109 */
2631 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =110 */
2632 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =111 */
2633 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =112 */
2634 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =113 */
2635 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =114 */
2636 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =115 */
2637 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =116 */
2638 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =117 */
2639 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =118 */
2640 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =119 */
2641 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =120 */
2642 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =121 */
2643 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =122 */
2644 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =123 */
2645 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =124 */
2646 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =125 */
2647 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =126 */
2648 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =127 */
2649 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =128 */
2650 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =129 */
2651 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =130 */
2652 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =131 */
2653 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =132 */
2654 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =133 */
2655 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =134 */
2656 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =135 */
2657 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =136 */
2658 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =137 */
2659 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =138 */
2660 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =139 */
2661 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =140 */
2662 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =141 */
2663 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
2664 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
2665 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
2666 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
2667 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
2668 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
2669 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =148 */
2670 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =149 */
2671 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =150 */
2672 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =151 */
2673 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =152 */
2674 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =153 */
2675 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =154 */
2676 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =155 */
2677 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =156 */
2678 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =157 */
2679 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =158 */
2680 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =159 */
2681 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =160 */
2682 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =161 */
2683 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =162 */
2684 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =163 */
2685 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =164 */
2686 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =165 */
2687 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =166 */
2688 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =167 */
2689 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =168 */
2690 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =169 */
2691 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =170 */
2692 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =171 */
2693 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =172 */
2694 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =173 */
2695 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =174 */
2696 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =175 */
2697 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =176 */
2698 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =177 */
2699 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =178 */
2700 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =179 */
2701 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =180 */
2702 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =181 */
2703 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =182 */
2704 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =183 */
2705 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =184 */
2706 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =185 */
2707 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =186 */
2708 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =187 */
2709 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =188 */
2710 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =189 */
2711 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
2712 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
2713 (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
2714 (PID.TID 0000.0001) ;
2715 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2716 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2717 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
2718 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
2719 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
2720 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
2721 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
2722 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
2723 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
2724 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
2725 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
2726 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
2727 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
2728 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
2729 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
2730 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
2731 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
2732 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
2733 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
2734 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
2735 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
2736 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
2737 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
2738 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
2739 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
2740 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
2741 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
2742 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
2743 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
2744 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
2745 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
2746 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
2747 (PID.TID 0000.0001) ;
2748 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2749 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2750 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
2751 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
2752 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 4 */
2753 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 5 */
2754 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 6 */
2755 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 7 */
2756 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 8 */
2757 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 9 */
2758 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 10 */
2759 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 11 */
2760 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 12 */
2761 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 13 */
2762 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 14 */
2763 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 15 */
2764 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 16: 17 */
2765 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 18 */
2766 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 19 */
2767 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 20 */
2768 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 21 */
2769 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 22 */
2770 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 23 */
2771 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 24 */
2772 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 25 */
2773 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 26 */
2774 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 27 */
2775 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 28 */
2776 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 29 */
2777 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 30 */
2778 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 31 */
2779 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 32: 33 */
2780 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 34 */
2781 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 35 */
2782 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 36 */
2783 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 37 */
2784 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 38 */
2785 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 39 */
2786 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 40 */
2787 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 41 */
2788 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 42 */
2789 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 43 */
2790 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 44 */
2791 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 45 */
2792 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
2793 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
2794 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 48: 49 */
2795 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
2796 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
2797 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 52 */
2798 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 53 */
2799 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 54 */
2800 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 55 */
2801 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 56 */
2802 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 57 */
2803 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 58 */
2804 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 59 */
2805 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 60 */
2806 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 61 */
2807 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 62 */
2808 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 63 */
2809 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 64: 65 */
2810 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 66 */
2811 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 67 */
2812 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 68 */
2813 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 69 */
2814 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 70 */
2815 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 71 */
2816 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 72 */
2817 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 73 */
2818 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 74 */
2819 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 75 */
2820 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 76 */
2821 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 77 */
2822 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 78 */
2823 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 79 */
2824 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 80: 81 */
2825 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 82 */
2826 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 83 */
2827 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 84 */
2828 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 85 */
2829 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 86 */
2830 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 87 */
2831 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 88 */
2832 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 89 */
2833 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 90 */
2834 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 91 */
2835 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 92 */
2836 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 93 */
2837 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
2838 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
2839 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 96: 97 */
2840 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
2841 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
2842 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =100 */
2843 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =101 */
2844 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =102 */
2845 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =103 */
2846 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =104 */
2847 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =105 */
2848 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =106 */
2849 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =107 */
2850 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =108 */
2851 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =109 */
2852 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =110 */
2853 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =111 */
2854 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =112:113 */
2855 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =114 */
2856 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =115 */
2857 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =116 */
2858 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =117 */
2859 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =118 */
2860 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =119 */
2861 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =120 */
2862 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =121 */
2863 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =122 */
2864 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =123 */
2865 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =124 */
2866 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =125 */
2867 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =126 */
2868 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =127 */
2869 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =128:129 */
2870 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =130 */
2871 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =131 */
2872 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =132 */
2873 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =133 */
2874 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =134 */
2875 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =135 */
2876 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =136 */
2877 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =137 */
2878 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =138 */
2879 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =139 */
2880 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =140 */
2881 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =141 */
2882 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
2883 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
2884 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =144:145 */
2885 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
2886 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
2887 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =148 */
2888 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =149 */
2889 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =150 */
2890 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =151 */
2891 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =152 */
2892 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =153 */
2893 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =154 */
2894 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =155 */
2895 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =156 */
2896 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =157 */
2897 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =158 */
2898 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =159 */
2899 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =160:161 */
2900 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =162 */
2901 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =163 */
2902 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =164 */
2903 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =165 */
2904 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =166 */
2905 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =167 */
2906 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =168 */
2907 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =169 */
2908 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =170 */
2909 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =171 */
2910 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =172 */
2911 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =173 */
2912 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =174 */
2913 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =175 */
2914 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =176:177 */
2915 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =178 */
2916 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =179 */
2917 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =180 */
2918 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =181 */
2919 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =182 */
2920 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =183 */
2921 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =184 */
2922 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =185 */
2923 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =186 */
2924 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =187 */
2925 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =188 */
2926 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =189 */
2927 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
2928 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
2929 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
2930 (PID.TID 0000.0001) ;
2931 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2932 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2933 (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
2934 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
2935 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
2936 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
2937 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
2938 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
2939 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
2940 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
2941 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
2942 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
2943 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
2944 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
2945 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
2946 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
2947 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
2948 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
2949 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
2950 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
2951 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
2952 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
2953 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
2954 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
2955 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
2956 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
2957 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
2958 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
2959 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
2960 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
2961 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
2962 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
2963 (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
2964 (PID.TID 0000.0001) ;
2965 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2966 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
2967 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
2968 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
2969 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 4 */
2970 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 5 */
2971 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 6 */
2972 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 7 */
2973 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 8 */
2974 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 9 */
2975 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 10 */
2976 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 11 */
2977 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 12 */
2978 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 13 */
2979 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 14 */
2980 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 15 */
2981 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 16 */
2982 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 17 */
2983 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 18 */
2984 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 19 */
2985 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 20 */
2986 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 21 */
2987 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 22 */
2988 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 23 */
2989 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 24 */
2990 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 25 */
2991 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 26 */
2992 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 27 */
2993 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 28 */
2994 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 29 */
2995 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 30 */
2996 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 31 */
2997 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 32 */
2998 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
2999 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 34 */
3000 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 35 */
3001 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 36 */
3002 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 37 */
3003 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 38 */
3004 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 39 */
3005 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 40 */
3006 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 41 */
3007 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 42 */
3008 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 43 */
3009 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 44 */
3010 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 45 */
3011 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
3012 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
3013 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
3014 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
3015 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
3016 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
3017 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 52 */
3018 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 53 */
3019 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 54 */
3020 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 55 */
3021 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 56 */
3022 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 57 */
3023 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 58 */
3024 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 59 */
3025 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 60 */
3026 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 61 */
3027 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 62 */
3028 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 63 */
3029 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 64 */
3030 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3031 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 66 */
3032 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 67 */
3033 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 68 */
3034 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 69 */
3035 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 70 */
3036 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 71 */
3037 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 72 */
3038 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 73 */
3039 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 74 */
3040 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 75 */
3041 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 76 */
3042 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 77 */
3043 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 78 */
3044 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 79 */
3045 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 80 */
3046 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 81 */
3047 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 82 */
3048 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 83 */
3049 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 84 */
3050 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 85 */
3051 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 86 */
3052 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 87 */
3053 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 88 */
3054 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 89 */
3055 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 90 */
3056 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 91 */
3057 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 92 */
3058 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 93 */
3059 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
3060 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
3061 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
3062 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3063 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
3064 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
3065 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =100 */
3066 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =101 */
3067 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =102 */
3068 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =103 */
3069 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =104 */
3070 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =105 */
3071 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =106 */
3072 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =107 */
3073 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =108 */
3074 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =109 */
3075 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =110 */
3076 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =111 */
3077 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =112 */
3078 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =113 */
3079 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =114 */
3080 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =115 */
3081 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =116 */
3082 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =117 */
3083 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =118 */
3084 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =119 */
3085 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =120 */
3086 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =121 */
3087 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =122 */
3088 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =123 */
3089 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =124 */
3090 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =125 */
3091 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =126 */
3092 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =127 */
3093 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =128 */
3094 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3095 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =130 */
3096 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =131 */
3097 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =132 */
3098 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =133 */
3099 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =134 */
3100 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =135 */
3101 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =136 */
3102 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =137 */
3103 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =138 */
3104 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =139 */
3105 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =140 */
3106 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =141 */
3107 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
3108 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
3109 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
3110 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
3111 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
3112 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
3113 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =148 */
3114 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =149 */
3115 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =150 */
3116 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =151 */
3117 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =152 */
3118 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =153 */
3119 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =154 */
3120 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =155 */
3121 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =156 */
3122 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =157 */
3123 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =158 */
3124 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =159 */
3125 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =160 */
3126 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3127 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =162 */
3128 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =163 */
3129 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =164 */
3130 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =165 */
3131 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =166 */
3132 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =167 */
3133 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =168 */
3134 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =169 */
3135 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =170 */
3136 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =171 */
3137 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =172 */
3138 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =173 */
3139 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =174 */
3140 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =175 */
3141 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =176 */
3142 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =177 */
3143 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =178 */
3144 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =179 */
3145 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =180 */
3146 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =181 */
3147 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =182 */
3148 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =183 */
3149 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =184 */
3150 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =185 */
3151 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =186 */
3152 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =187 */
3153 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =188 */
3154 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =189 */
3155 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
3156 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
3157 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
3158 (PID.TID 0000.0001) ;
3159 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3160 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3161 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
3162 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
3163 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
3164 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
3165 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
3166 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
3167 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
3168 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
3169 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
3170 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
3171 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
3172 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
3173 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
3174 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
3175 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
3176 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
3177 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
3178 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
3179 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
3180 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
3181 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
3182 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
3183 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
3184 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
3185 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
3186 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
3187 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
3188 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
3189 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
3190 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
3191 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
3192 (PID.TID 0000.0001) ;
3193 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3194 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
3195 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
3196 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
3197 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 4 */
3198 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 5 */
3199 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 6 */
3200 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 7 */
3201 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 8 */
3202 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 9 */
3203 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 10 */
3204 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 11 */
3205 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 12 */
3206 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 13 */
3207 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 14 */
3208 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 15 */
3209 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 16 */
3210 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 17 */
3211 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 18 */
3212 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 19 */
3213 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 20 */
3214 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 21 */
3215 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 22 */
3216 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 23 */
3217 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 24 */
3218 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 25 */
3219 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 26 */
3220 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 27 */
3221 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 28 */
3222 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 29 */
3223 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 30 */
3224 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 31 */
3225 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 32 */
3226 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
3227 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 34 */
3228 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 35 */
3229 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 36 */
3230 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 37 */
3231 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 38 */
3232 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 39 */
3233 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 40 */
3234 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 41 */
3235 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 42 */
3236 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 43 */
3237 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 44 */
3238 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 45 */
3239 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
3240 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
3241 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
3242 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
3243 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
3244 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
3245 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 52 */
3246 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 53 */
3247 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 54 */
3248 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 55 */
3249 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 56 */
3250 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 57 */
3251 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 58 */
3252 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 59 */
3253 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 60 */
3254 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 61 */
3255 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 62 */
3256 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 63 */
3257 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 64 */
3258 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3259 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 66 */
3260 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 67 */
3261 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 68 */
3262 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 69 */
3263 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 70 */
3264 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 71 */
3265 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 72 */
3266 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 73 */
3267 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 74 */
3268 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 75 */
3269 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 76 */
3270 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 77 */
3271 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 78 */
3272 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 79 */
3273 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 80 */
3274 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 81 */
3275 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 82 */
3276 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 83 */
3277 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 84 */
3278 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 85 */
3279 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 86 */
3280 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 87 */
3281 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 88 */
3282 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 89 */
3283 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 90 */
3284 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 91 */
3285 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 92 */
3286 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 93 */
3287 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
3288 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
3289 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
3290 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3291 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
3292 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
3293 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =100 */
3294 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =101 */
3295 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =102 */
3296 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =103 */
3297 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =104 */
3298 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =105 */
3299 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =106 */
3300 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =107 */
3301 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =108 */
3302 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =109 */
3303 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =110 */
3304 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =111 */
3305 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =112 */
3306 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =113 */
3307 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =114 */
3308 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =115 */
3309 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =116 */
3310 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =117 */
3311 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =118 */
3312 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =119 */
3313 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =120 */
3314 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =121 */
3315 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =122 */
3316 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =123 */
3317 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =124 */
3318 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =125 */
3319 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =126 */
3320 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =127 */
3321 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =128 */
3322 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3323 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =130 */
3324 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =131 */
3325 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =132 */
3326 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =133 */
3327 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =134 */
3328 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =135 */
3329 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =136 */
3330 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =137 */
3331 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =138 */
3332 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =139 */
3333 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =140 */
3334 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =141 */
3335 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
3336 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
3337 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
3338 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
3339 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
3340 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
3341 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =148 */
3342 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =149 */
3343 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =150 */
3344 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =151 */
3345 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =152 */
3346 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =153 */
3347 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =154 */
3348 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =155 */
3349 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =156 */
3350 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =157 */
3351 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =158 */
3352 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =159 */
3353 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =160 */
3354 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3355 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =162 */
3356 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =163 */
3357 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =164 */
3358 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =165 */
3359 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =166 */
3360 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =167 */
3361 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =168 */
3362 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =169 */
3363 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =170 */
3364 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =171 */
3365 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =172 */
3366 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =173 */
3367 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =174 */
3368 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =175 */
3369 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =176 */
3370 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =177 */
3371 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =178 */
3372 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =179 */
3373 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =180 */
3374 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =181 */
3375 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =182 */
3376 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =183 */
3377 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =184 */
3378 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =185 */
3379 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =186 */
3380 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =187 */
3381 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =188 */
3382 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =189 */
3383 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
3384 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
3385 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
3386 (PID.TID 0000.0001) ;
3387 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3388 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3389 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
3390 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
3391 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 4 */
3392 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
3393 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
3394 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 7 */
3395 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
3396 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
3397 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 10 */
3398 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
3399 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
3400 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
3401 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
3402 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
3403 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
3404 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
3405 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
3406 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
3407 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
3408 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
3409 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
3410 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
3411 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 24 */
3412 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
3413 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
3414 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 27 */
3415 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
3416 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
3417 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 30 */
3418 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
3419 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
3420 (PID.TID 0000.0001) ;
3421 (PID.TID 0000.0001) rA = /* rA(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3422 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
3423 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
3424 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
3425 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 4 */
3426 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 5 */
3427 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 6 */
3428 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 7 */
3429 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 8 */
3430 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 9 */
3431 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 10 */
3432 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 11 */
3433 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 12 */
3434 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 13 */
3435 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 14 */
3436 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 15 */
3437 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 16 */
3438 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 17 */
3439 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 18 */
3440 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 19 */
3441 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 20 */
3442 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 21 */
3443 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 22 */
3444 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 23 */
3445 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 24 */
3446 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 25 */
3447 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 26 */
3448 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 27 */
3449 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 28 */
3450 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 29 */
3451 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 30 */
3452 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 31 */
3453 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 32 */
3454 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 33 */
3455 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 34 */
3456 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 35 */
3457 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 36 */
3458 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 37 */
3459 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 38 */
3460 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 39 */
3461 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 40 */
3462 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 41 */
3463 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 42 */
3464 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 43 */
3465 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 44 */
3466 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 45 */
3467 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 46 */
3468 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 47 */
3469 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 48 */
3470 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 49 */
3471 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
3472 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 51 */
3473 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 52 */
3474 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 53 */
3475 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 54 */
3476 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 55 */
3477 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 56 */
3478 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 57 */
3479 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 58 */
3480 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 59 */
3481 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 60 */
3482 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 61 */
3483 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 62 */
3484 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 63 */
3485 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 64 */
3486 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 65 */
3487 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 66 */
3488 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 67 */
3489 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 68 */
3490 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 69 */
3491 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 70 */
3492 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 71 */
3493 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 72 */
3494 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 73 */
3495 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 74 */
3496 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 75 */
3497 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 76 */
3498 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 77 */
3499 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 78 */
3500 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 79 */
3501 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 80 */
3502 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 81 */
3503 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 82 */
3504 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 83 */
3505 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 84 */
3506 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 85 */
3507 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 86 */
3508 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 87 */
3509 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 88 */
3510 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 89 */
3511 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 90 */
3512 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 91 */
3513 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 92 */
3514 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 93 */
3515 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
3516 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
3517 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
3518 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
3519 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
3520 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
3521 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =100 */
3522 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =101 */
3523 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =102 */
3524 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =103 */
3525 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =104 */
3526 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =105 */
3527 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =106 */
3528 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =107 */
3529 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =108 */
3530 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =109 */
3531 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =110 */
3532 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =111 */
3533 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =112 */
3534 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =113 */
3535 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =114 */
3536 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =115 */
3537 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =116 */
3538 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =117 */
3539 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =118 */
3540 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =119 */
3541 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =120 */
3542 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =121 */
3543 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =122 */
3544 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =123 */
3545 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =124 */
3546 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =125 */
3547 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =126 */
3548 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =127 */
3549 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =128 */
3550 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =129 */
3551 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =130 */
3552 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =131 */
3553 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =132 */
3554 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =133 */
3555 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =134 */
3556 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =135 */
3557 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =136 */
3558 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =137 */
3559 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =138 */
3560 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =139 */
3561 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =140 */
3562 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =141 */
3563 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =142 */
3564 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =143 */
3565 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =144 */
3566 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =145 */
3567 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
3568 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =147 */
3569 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =148 */
3570 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =149 */
3571 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =150 */
3572 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =151 */
3573 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =152 */
3574 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =153 */
3575 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =154 */
3576 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =155 */
3577 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =156 */
3578 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =157 */
3579 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =158 */
3580 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =159 */
3581 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =160 */
3582 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =161 */
3583 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =162 */
3584 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =163 */
3585 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =164 */
3586 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =165 */
3587 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =166 */
3588 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =167 */
3589 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =168 */
3590 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =169 */
3591 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =170 */
3592 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =171 */
3593 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =172 */
3594 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =173 */
3595 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =174 */
3596 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =175 */
3597 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =176 */
3598 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =177 */
3599 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =178 */
3600 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =179 */
3601 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =180 */
3602 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =181 */
3603 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =182 */
3604 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =183 */
3605 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =184 */
3606 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =185 */
3607 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =186 */
3608 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =187 */
3609 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =188 */
3610 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =189 */
3611 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
3612 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
3613 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
3614 (PID.TID 0000.0001) ;
3615 (PID.TID 0000.0001) rA = /* rA(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3616 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
3617 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
3618 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
3619 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
3620 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
3621 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 6 */
3622 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
3623 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
3624 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
3625 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
3626 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 11 */
3627 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 12 */
3628 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
3629 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 14 */
3630 (PID.TID 0000.0001) 9.008620045350865E+10, /* J = 15 */
3631 (PID.TID 0000.0001) 9.076111290418457E+10, /* J = 16 */
3632 (PID.TID 0000.0001) 9.076111290422060E+10, /* J = 17 */
3633 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
3634 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 19 */
3635 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
3636 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 21 */
3637 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 22 */
3638 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
3639 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
3640 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
3641 (PID.TID 0000.0001) 6.203683527772523E+10, /* J = 26 */
3642 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 27 */
3643 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
3644 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
3645 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
3646 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
3647 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
3648 (PID.TID 0000.0001) ;
3649 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3650 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3651 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
3652 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
3653 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 4 */
3654 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 5 */
3655 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 6 */
3656 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 7 */
3657 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 8 */
3658 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 9 */
3659 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 10 */
3660 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 11 */
3661 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 12 */
3662 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 13 */
3663 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 14 */
3664 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 15 */
3665 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 16 */
3666 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 17 */
3667 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 18 */
3668 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 19 */
3669 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 20 */
3670 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 21 */
3671 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 22 */
3672 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 23 */
3673 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 24 */
3674 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 25 */
3675 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 26 */
3676 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 27 */
3677 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 28 */
3678 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 29 */
3679 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 30 */
3680 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 31 */
3681 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 32 */
3682 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 33 */
3683 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 34 */
3684 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 35 */
3685 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 36 */
3686 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 37 */
3687 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 38 */
3688 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 39 */
3689 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 40 */
3690 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 41 */
3691 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 42 */
3692 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 43 */
3693 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 44 */
3694 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 45 */
3695 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
3696 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 47 */
3697 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
3698 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
3699 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 50 */
3700 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
3701 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 52 */
3702 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 53 */
3703 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 54 */
3704 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 55 */
3705 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 56 */
3706 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 57 */
3707 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 58 */
3708 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 59 */
3709 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 60 */
3710 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 61 */
3711 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 62 */
3712 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 63 */
3713 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 64 */
3714 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 65 */
3715 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 66 */
3716 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 67 */
3717 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 68 */
3718 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 69 */
3719 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 70 */
3720 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 71 */
3721 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 72 */
3722 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 73 */
3723 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 74 */
3724 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 75 */
3725 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 76 */
3726 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 77 */
3727 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 78 */
3728 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 79 */
3729 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 80 */
3730 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 81 */
3731 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 82 */
3732 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 83 */
3733 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 84 */
3734 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 85 */
3735 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 86 */
3736 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 87 */
3737 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 88 */
3738 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 89 */
3739 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 90 */
3740 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 91 */
3741 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 92 */
3742 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 93 */
3743 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
3744 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
3745 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
3746 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
3747 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
3748 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
3749 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =100 */
3750 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =101 */
3751 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =102 */
3752 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =103 */
3753 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =104 */
3754 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =105 */
3755 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =106 */
3756 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =107 */
3757 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =108 */
3758 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =109 */
3759 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =110 */
3760 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =111 */
3761 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =112 */
3762 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =113 */
3763 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =114 */
3764 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =115 */
3765 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =116 */
3766 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =117 */
3767 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =118 */
3768 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =119 */
3769 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =120 */
3770 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =121 */
3771 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =122 */
3772 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =123 */
3773 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =124 */
3774 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =125 */
3775 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =126 */
3776 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =127 */
3777 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =128 */
3778 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =129 */
3779 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =130 */
3780 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =131 */
3781 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =132 */
3782 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =133 */
3783 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =134 */
3784 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =135 */
3785 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =136 */
3786 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =137 */
3787 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =138 */
3788 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =139 */
3789 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =140 */
3790 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =141 */
3791 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
3792 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =143 */
3793 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
3794 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
3795 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =146 */
3796 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
3797 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =148 */
3798 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =149 */
3799 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =150 */
3800 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =151 */
3801 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =152 */
3802 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =153 */
3803 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =154 */
3804 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =155 */
3805 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =156 */
3806 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =157 */
3807 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =158 */
3808 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =159 */
3809 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =160 */
3810 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =161 */
3811 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =162 */
3812 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =163 */
3813 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =164 */
3814 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =165 */
3815 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =166 */
3816 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =167 */
3817 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =168 */
3818 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =169 */
3819 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =170 */
3820 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =171 */
3821 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =172 */
3822 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =173 */
3823 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =174 */
3824 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =175 */
3825 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =176 */
3826 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =177 */
3827 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =178 */
3828 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =179 */
3829 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =180 */
3830 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =181 */
3831 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =182 */
3832 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =183 */
3833 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =184 */
3834 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =185 */
3835 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =186 */
3836 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =187 */
3837 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =188 */
3838 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =189 */
3839 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
3840 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
3841 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
3842 (PID.TID 0000.0001) ;
3843 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3844 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3845 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
3846 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
3847 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
3848 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 5 */
3849 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 6 */
3850 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 7 */
3851 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
3852 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 9 */
3853 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
3854 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 11 */
3855 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
3856 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 13 */
3857 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 14 */
3858 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
3859 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* J = 16: 17 */
3860 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
3861 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 19 */
3862 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 20 */
3863 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
3864 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 22 */
3865 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
3866 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 24 */
3867 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
3868 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 26 */
3869 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 27 */
3870 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 28 */
3871 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
3872 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
3873 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
3874 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
3875 (PID.TID 0000.0001) ;
3876 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3877 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3878 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
3879 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
3880 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 4 */
3881 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 5 */
3882 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 6 */
3883 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 7 */
3884 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 8 */
3885 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 9 */
3886 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 10 */
3887 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 11 */
3888 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 12 */
3889 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 13 */
3890 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 14 */
3891 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 15 */
3892 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 16: 17 */
3893 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 18 */
3894 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 19 */
3895 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 20 */
3896 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 21 */
3897 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 22 */
3898 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 23 */
3899 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 24 */
3900 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 25 */
3901 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 26 */
3902 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 27 */
3903 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 28 */
3904 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 29 */
3905 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 30 */
3906 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 31 */
3907 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 32: 33 */
3908 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 34 */
3909 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 35 */
3910 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 36 */
3911 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 37 */
3912 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 38 */
3913 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 39 */
3914 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 40 */
3915 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 41 */
3916 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 42 */
3917 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 43 */
3918 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 44 */
3919 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 45 */
3920 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 46 */
3921 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
3922 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 48: 49 */
3923 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
3924 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 51 */
3925 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 52 */
3926 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 53 */
3927 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 54 */
3928 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 55 */
3929 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 56 */
3930 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 57 */
3931 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 58 */
3932 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 59 */
3933 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 60 */
3934 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 61 */
3935 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 62 */
3936 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 63 */
3937 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 64: 65 */
3938 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 66 */
3939 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 67 */
3940 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 68 */
3941 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 69 */
3942 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 70 */
3943 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 71 */
3944 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 72 */
3945 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 73 */
3946 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 74 */
3947 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 75 */
3948 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 76 */
3949 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 77 */
3950 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 78 */
3951 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 79 */
3952 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 80: 81 */
3953 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 82 */
3954 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 83 */
3955 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 84 */
3956 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 85 */
3957 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 86 */
3958 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 87 */
3959 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 88 */
3960 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 89 */
3961 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 90 */
3962 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 91 */
3963 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 92 */
3964 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 93 */
3965 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
3966 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
3967 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 96: 97 */
3968 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
3969 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
3970 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =100 */
3971 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =101 */
3972 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =102 */
3973 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =103 */
3974 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =104 */
3975 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =105 */
3976 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =106 */
3977 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =107 */
3978 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =108 */
3979 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =109 */
3980 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =110 */
3981 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =111 */
3982 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =112:113 */
3983 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =114 */
3984 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =115 */
3985 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =116 */
3986 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =117 */
3987 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =118 */
3988 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =119 */
3989 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =120 */
3990 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =121 */
3991 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =122 */
3992 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =123 */
3993 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =124 */
3994 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =125 */
3995 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =126 */
3996 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =127 */
3997 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =128:129 */
3998 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =130 */
3999 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =131 */
4000 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =132 */
4001 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =133 */
4002 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =134 */
4003 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =135 */
4004 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =136 */
4005 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =137 */
4006 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =138 */
4007 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =139 */
4008 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =140 */
4009 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =141 */
4010 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =142 */
4011 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
4012 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =144:145 */
4013 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
4014 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =147 */
4015 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =148 */
4016 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =149 */
4017 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =150 */
4018 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =151 */
4019 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =152 */
4020 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =153 */
4021 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =154 */
4022 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =155 */
4023 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =156 */
4024 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =157 */
4025 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =158 */
4026 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =159 */
4027 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =160:161 */
4028 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =162 */
4029 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =163 */
4030 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =164 */
4031 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =165 */
4032 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =166 */
4033 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =167 */
4034 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =168 */
4035 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =169 */
4036 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =170 */
4037 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =171 */
4038 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =172 */
4039 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =173 */
4040 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =174 */
4041 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =175 */
4042 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =176:177 */
4043 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =178 */
4044 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =179 */
4045 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =180 */
4046 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =181 */
4047 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =182 */
4048 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =183 */
4049 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =184 */
4050 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =185 */
4051 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =186 */
4052 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =187 */
4053 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =188 */
4054 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =189 */
4055 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
4056 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
4057 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
4058 (PID.TID 0000.0001) ;
4059 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( m - cartesian, degrees - spherical ) */
4060 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
4061 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
4062 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
4063 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
4064 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
4065 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
4066 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 7 */
4067 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 8 */
4068 (PID.TID 0000.0001) 7.014205907741882E+10, /* J = 9 */
4069 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
4070 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
4071 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
4072 (PID.TID 0000.0001) 8.549360686473492E+10, /* J = 13 */
4073 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
4074 (PID.TID 0000.0001) 8.948571540392021E+10, /* J = 15 */
4075 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
4076 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
4077 (PID.TID 0000.0001) 9.049530583087070E+10, /* J = 18 */
4078 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
4079 (PID.TID 0000.0001) 8.781353403174185E+10, /* J = 20 */
4080 (PID.TID 0000.0001) 8.549360686467184E+10, /* J = 21 */
4081 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
4082 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
4083 (PID.TID 0000.0001) 7.484854821844795E+10, /* J = 24 */
4084 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
4085 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 26 */
4086 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 27 */
4087 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
4088 (PID.TID 0000.0001) 4.571243814190767E+10, /* J = 29 */
4089 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
4090 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
4091 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
4092 (PID.TID 0000.0001) ;
4093 (PID.TID 0000.0001) // =======================================================
4094 (PID.TID 0000.0001) // End of Model config. summary
4095 (PID.TID 0000.0001) // =======================================================
4096 (PID.TID 0000.0001)
4097 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4098 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4099 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4100 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4101 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4102 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4103 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4104 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4105 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4106 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4107 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup.0000036000
4108 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4109 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4110 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4111 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4112 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4113 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4114 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4115 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4116 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4117 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4118 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4119 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4120 (PID.TID 0000.0001) MDSREADFIELD: opening global file: pickup_ic.0000036000
4121 (PID.TID 0000.0001) // =======================================================
4122 (PID.TID 0000.0001) // Model current state
4123 (PID.TID 0000.0001) // =======================================================
4124 (PID.TID 0000.0001)
4125 (PID.TID 0000.0001) // =======================================================
4126 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4127 (PID.TID 0000.0001) // =======================================================
4128 (PID.TID 0000.0001) %MON time_tsnumber = 36000
4129 (PID.TID 0000.0001) %MON time_secondsf = 3.1104000000000E+09
4130 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3500434503471E-01
4131 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1986891348601E+01
4132 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8045564487853E-01
4133 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6994311255501E+00
4134 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6453306471101E-02
4135 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7235154042170E-01
4136 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7145887709522E-01
4137 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2887824837157E-04
4138 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2989468965472E-02
4139 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7920186340225E-03
4140 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9306786753954E-01
4141 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1050631286072E-01
4142 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2470116939793E-04
4143 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3472945317820E-02
4144 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8319026986974E-03
4145 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3888727589247E-05
4146 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7681850941337E-04
4147 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.2631701181818E-09
4148 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6274614748344E-06
4149 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1378775396729E-06
4150 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0162021109834E+01
4151 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.5087736803077E+00
4152 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5027154873320E+00
4153 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7490175075967E+00
4154 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5106365389722E-02
4155 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0815425249776E+01
4156 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8030178312691E+01
4157 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756092396968E+01
4158 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1193688315107E-01
4159 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0020089713970E-02
4160 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6990886762546E-02
4161 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4155563479013E-02
4162 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7649506465342E-02
4163 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3178433447991E-01
4164 (PID.TID 0000.0001) %MON pe_b_mean = 4.2969665467446E-03
4165 (PID.TID 0000.0001) %MON ke_max = 3.6920742855791E-02
4166 (PID.TID 0000.0001) %MON ke_mean = 1.6194090277160E-04
4167 (PID.TID 0000.0001) %MON ke_vol = 1.3395912415612E+18
4168 (PID.TID 0000.0001) %MON vort_r_min = -1.2103928619458E-06
4169 (PID.TID 0000.0001) %MON vort_r_max = 1.3658356323918E-06
4170 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4171 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054014221264E-05
4172 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719485005016E-05
4173 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782267184684E-04
4174 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.4664546923379E-08
4175 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 2.0573162615946E-08
4176 (PID.TID 0000.0001) // =======================================================
4177 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4178 (PID.TID 0000.0001) // =======================================================
4179 (PID.TID 0000.0001) // =======================================================
4180 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4181 (PID.TID 0000.0001) // =======================================================
4182 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1104000000000E+09
4183 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4716044426698E+13
4184 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.2123515471256E+13
4185 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2592528955442E+13
4186 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5665991101486E+00
4187 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.6548113929333E+00
4188 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5189177037341E+00
4189 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4190 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4191 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0642325960795E+00
4192 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.8039252994821E+00
4193 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5209002603598E-01
4194 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920173287519E+00
4195 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933581672150E+00
4196 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7927617991529E+22
4197 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6644740861567E+01
4198 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.2271804409750E-01
4199 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2551394715834E+01
4200 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.2879155123950E+00
4201 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6099403861095E+01
4202 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4203 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -1.7223298637424E+00
4204 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.3503593345479E+00
4205 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1859254669298E+00
4206 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3246125323351E+01
4207 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.7372153208148E+01
4208 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0584120855350E+01
4209 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -1.5363024655854E-01
4210 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -5.8630083767312E-01
4211 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.7701031784537E+00
4212 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1173552909385E+00
4213 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.7799839472262E+00
4214 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.8326933331569E+00
4215 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.3985906582730E+00
4216 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.1778332319913E+00
4217 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.1561961802541E+00
4218 (PID.TID 0000.0001) // =======================================================
4219 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4220 (PID.TID 0000.0001) // =======================================================
4221 S/R BULKF_FIELDS_LOAD: Reading new data: 12 1 36000 3.110400000000E+09
4222 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_tair_cs.bin
4223 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_tair_cs.bin
4224 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_qair_cs.bin
4225 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_qair_cs.bin
4226 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downsolar_cs.bin
4227 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downsolar_cs.bin
4228 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downlw_cs.bin
4229 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_downlw_cs.bin
4230 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_windspeed_cs.bin
4231 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_windspeed_cs.bin
4232 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_pr_scal_cs.bin
4233 (PID.TID 0000.0001) MDSREADFIELD: opening global file: ncep_pr_scal_cs.bin
4234 S/R EXTERNAL_FIELDS_LOAD: Reading new data: 12 1 36000 3.110400000000E+09
4235 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4236 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4237 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4238 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4239 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4240 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4241 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4242 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4243 cg2d: Sum(rhs),rhsMax = 3.90289325938286E+02 2.29381049687594E+02
4244 (PID.TID 0000.0001) cg2d_init_res = 2.72226824003654E+00
4245 (PID.TID 0000.0001) cg2d_iters = 70
4246 (PID.TID 0000.0001) cg2d_res = 5.23489116409899E-07
4247 (PID.TID 0000.0001) // =======================================================
4248 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4249 (PID.TID 0000.0001) // =======================================================
4250 (PID.TID 0000.0001) %MON time_tsnumber = 36001
4251 (PID.TID 0000.0001) %MON time_secondsf = 3.1104864000000E+09
4252 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3364164879862E-01
4253 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1985262839272E+01
4254 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8049410898974E-01
4255 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6988083963297E+00
4256 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6452590000759E-02
4257 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7283785322873E-01
4258 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7114247823162E-01
4259 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2855026675769E-04
4260 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2989432141127E-02
4261 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7920769731559E-03
4262 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9354675233826E-01
4263 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1061392972789E-01
4264 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2479013027779E-04
4265 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3474904197754E-02
4266 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8307943717889E-03
4267 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3873825771363E-05
4268 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7706104088122E-04
4269 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.1123915672725E-09
4270 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6270069344646E-06
4271 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1368855083104E-06
4272 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0146913789449E+01
4273 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.5027137017355E+00
4274 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5027708413056E+00
4275 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7490710016378E+00
4276 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5258934667259E-02
4277 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0818099758811E+01
4278 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8030808752363E+01
4279 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756093444270E+01
4280 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1192753002860E-01
4281 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0043601737515E-02
4282 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6901150043157E-02
4283 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4364302616145E-02
4284 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7728580875990E-02
4285 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3123583025944E-01
4286 (PID.TID 0000.0001) %MON pe_b_mean = -1.9133641844718E-03
4287 (PID.TID 0000.0001) %MON ke_max = 3.6816950973246E-02
4288 (PID.TID 0000.0001) %MON ke_mean = 1.6196482659883E-04
4289 (PID.TID 0000.0001) %MON ke_vol = 1.3395912252519E+18
4290 (PID.TID 0000.0001) %MON vort_r_min = -1.2135055973192E-06
4291 (PID.TID 0000.0001) %MON vort_r_max = 1.3680147941269E-06
4292 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4293 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054014056508E-05
4294 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719484734269E-05
4295 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782267838298E-04
4296 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.2657406153314E-08
4297 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8729880162545E-08
4298 (PID.TID 0000.0001) // =======================================================
4299 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4300 (PID.TID 0000.0001) // =======================================================
4301 (PID.TID 0000.0001) // =======================================================
4302 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4303 (PID.TID 0000.0001) // =======================================================
4304 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1104864000000E+09
4305 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4728883099595E+13
4306 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.2065961868429E+13
4307 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2662921231167E+13
4308 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5654407614691E+00
4309 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.6742582922090E+00
4310 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5088954508955E+00
4311 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4312 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4313 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0588371685031E+00
4314 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7996814543254E+00
4315 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5291799393107E-01
4316 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920142046519E+00
4317 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933709551204E+00
4318 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7928505610144E+22
4319 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6732848320405E+01
4320 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.0597900522313E-01
4321 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2575888602023E+01
4322 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3043441467213E+00
4323 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6213990021686E+01
4324 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4325 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -6.7474323125520E+00
4326 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.3787022045759E+00
4327 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1656406927223E+00
4328 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3329620458183E+01
4329 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.7216897768510E+01
4330 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0666395739877E+01
4331 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -2.1831092533945E-01
4332 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -5.9497842414135E-01
4333 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.7829629711607E+00
4334 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1140487668830E+00
4335 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.8136745002859E+00
4336 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.8094598422842E+00
4337 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.4380986141887E+00
4338 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.1539915958877E+00
4339 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.1753502729289E+00
4340 (PID.TID 0000.0001) // =======================================================
4341 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4342 (PID.TID 0000.0001) // =======================================================
4343 cg2d: Sum(rhs),rhsMax = 3.90298796408743E+02 2.29444544707321E+02
4344 (PID.TID 0000.0001) cg2d_init_res = 2.71308605029517E+00
4345 (PID.TID 0000.0001) cg2d_iters = 70
4346 (PID.TID 0000.0001) cg2d_res = 4.90256327944899E-07
4347 (PID.TID 0000.0001) // =======================================================
4348 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4349 (PID.TID 0000.0001) // =======================================================
4350 (PID.TID 0000.0001) %MON time_tsnumber = 36002
4351 (PID.TID 0000.0001) %MON time_secondsf = 3.1105728000000E+09
4352 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3228517042763E-01
4353 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1983690939174E+01
4354 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8050819482798E-01
4355 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6981894458467E+00
4356 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6466435880584E-02
4357 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7327218931753E-01
4358 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7081469137613E-01
4359 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2815246466662E-04
4360 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2989186453492E-02
4361 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7921141167682E-03
4362 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9396956883914E-01
4363 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1072476095831E-01
4364 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2477305633567E-04
4365 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3476968635429E-02
4366 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8296602694059E-03
4367 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3825772543284E-05
4368 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7739767363231E-04
4369 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.1695329633534E-09
4370 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6271943561189E-06
4371 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1367604859388E-06
4372 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0130334922152E+01
4373 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.4965484170856E+00
4374 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5028259663660E+00
4375 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7491309249140E+00
4376 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5345806817354E-02
4377 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0820622897724E+01
4378 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8031424297812E+01
4379 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756094316126E+01
4380 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1191960987484E-01
4381 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0051733059192E-02
4382 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6808183473254E-02
4383 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4548602372150E-02
4384 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7838335855969E-02
4385 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3061251564728E-01
4386 (PID.TID 0000.0001) %MON pe_b_mean = -1.9120546454300E-03
4387 (PID.TID 0000.0001) %MON ke_max = 3.6710234873888E-02
4388 (PID.TID 0000.0001) %MON ke_mean = 1.6198750794251E-04
4389 (PID.TID 0000.0001) %MON ke_vol = 1.3395912112553E+18
4390 (PID.TID 0000.0001) %MON vort_r_min = -1.2169537851385E-06
4391 (PID.TID 0000.0001) %MON vort_r_max = 1.3705438311723E-06
4392 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4393 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054013911548E-05
4394 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719484499731E-05
4395 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782268719075E-04
4396 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.3557898668329E-08
4397 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8821459006141E-08
4398 (PID.TID 0000.0001) // =======================================================
4399 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4400 (PID.TID 0000.0001) // =======================================================
4401 (PID.TID 0000.0001) // =======================================================
4402 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4403 (PID.TID 0000.0001) // =======================================================
4404 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1105728000000E+09
4405 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4705533343767E+13
4406 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.2008133744738E+13
4407 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2697399599029E+13
4408 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5704225751699E+00
4409 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.6940423647804E+00
4410 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5077973811965E+00
4411 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4412 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4413 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0553613525399E+00
4414 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7961539398663E+00
4415 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5478196253589E-01
4416 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920110700155E+00
4417 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933837398610E+00
4418 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7925464887216E+22
4419 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6860676611376E+01
4420 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.2618544221201E-01
4421 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2686752379269E+01
4422 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3207316990421E+00
4423 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6328624533670E+01
4424 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4425 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -7.6783593043140E+00
4426 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.4026736391094E+00
4427 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1397427775930E+00
4428 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3411717044333E+01
4429 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.6709878458336E+01
4430 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0745814204814E+01
4431 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -2.1539207746412E-01
4432 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -6.0389629796181E-01
4433 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.7954240388789E+00
4434 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1106987821032E+00
4435 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.8465705931301E+00
4436 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.7846354017726E+00
4437 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.4763916476458E+00
4438 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.2642148384105E+00
4439 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.1939219607007E+00
4440 (PID.TID 0000.0001) // =======================================================
4441 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4442 (PID.TID 0000.0001) // =======================================================
4443 cg2d: Sum(rhs),rhsMax = 3.90304646713363E+02 2.29518028670760E+02
4444 (PID.TID 0000.0001) cg2d_init_res = 2.71765809423845E+00
4445 (PID.TID 0000.0001) cg2d_iters = 70
4446 (PID.TID 0000.0001) cg2d_res = 4.79439269895701E-07
4447 (PID.TID 0000.0001) // =======================================================
4448 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4449 (PID.TID 0000.0001) // =======================================================
4450 (PID.TID 0000.0001) %MON time_tsnumber = 36003
4451 (PID.TID 0000.0001) %MON time_secondsf = 3.1106592000000E+09
4452 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.3098011605882E-01
4453 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1981956397916E+01
4454 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8051689623778E-01
4455 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6975668583847E+00
4456 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6482489297053E-02
4457 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7365113885862E-01
4458 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7047568468655E-01
4459 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2766610499522E-04
4460 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2988703715777E-02
4461 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7921047793636E-03
4462 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9433339792970E-01
4463 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1082782201404E-01
4464 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2458185674365E-04
4465 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3479069361029E-02
4466 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8285250394292E-03
4467 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3754062844373E-05
4468 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7768596930259E-04
4469 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.1813407433400E-09
4470 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6269819741369E-06
4471 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1365242555306E-06
4472 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0113090998318E+01
4473 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.4903237757647E+00
4474 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5028812735437E+00
4475 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7491961483678E+00
4476 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5392522102804E-02
4477 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0822997008373E+01
4478 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8032025862680E+01
4479 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756095165729E+01
4480 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1191187138538E-01
4481 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0051399938518E-02
4482 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6712034745578E-02
4483 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4707190347024E-02
4484 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.7932331123562E-02
4485 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2991684442302E-01
4486 (PID.TID 0000.0001) %MON pe_b_mean = -1.9107292852902E-03
4487 (PID.TID 0000.0001) %MON ke_max = 3.6600858640782E-02
4488 (PID.TID 0000.0001) %MON ke_mean = 1.6200770941528E-04
4489 (PID.TID 0000.0001) %MON ke_vol = 1.3395912061296E+18
4490 (PID.TID 0000.0001) %MON vort_r_min = -1.2207069364970E-06
4491 (PID.TID 0000.0001) %MON vort_r_max = 1.3733576128944E-06
4492 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4493 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054013782783E-05
4494 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719484102415E-05
4495 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782269309007E-04
4496 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.4043849769075E-08
4497 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8902781776197E-08
4498 (PID.TID 0000.0001) // =======================================================
4499 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4500 (PID.TID 0000.0001) // =======================================================
4501 (PID.TID 0000.0001) // =======================================================
4502 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4503 (PID.TID 0000.0001) // =======================================================
4504 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1106592000000E+09
4505 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4677890708385E+13
4506 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.1953979322509E+13
4507 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2723911385876E+13
4508 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5760597306578E+00
4509 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.7123356271406E+00
4510 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5085406196479E+00
4511 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4512 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4513 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0522118269486E+00
4514 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7923282221559E+00
4515 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5688035093890E-01
4516 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920079241251E+00
4517 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0933965216221E+00
4518 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7921747609200E+22
4519 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.6942913674625E+01
4520 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.0897359954174E-01
4521 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2758221206338E+01
4522 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3370784703156E+00
4523 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6443308336923E+01
4524 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4525 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -8.2047521155984E+00
4526 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.4290283173012E+00
4527 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.1189385606264E+00
4528 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3492155564189E+01
4529 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.6561945359315E+01
4530 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0822485827160E+01
4531 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -2.1257251484126E-01
4532 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -6.1306443817098E-01
4533 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.8076074567995E+00
4534 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1072531762399E+00
4535 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.8788723169819E+00
4536 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.7595626480508E+00
4537 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.5135005201979E+00
4538 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.2267372080291E+00
4539 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.2119487281801E+00
4540 (PID.TID 0000.0001) // =======================================================
4541 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4542 (PID.TID 0000.0001) // =======================================================
4543 cg2d: Sum(rhs),rhsMax = 3.90319916878030E+02 2.29601158274975E+02
4544 (PID.TID 0000.0001) cg2d_init_res = 2.78773982617101E+00
4545 (PID.TID 0000.0001) cg2d_iters = 70
4546 (PID.TID 0000.0001) cg2d_res = 4.83272699345748E-07
4547 (PID.TID 0000.0001) // =======================================================
4548 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4549 (PID.TID 0000.0001) // =======================================================
4550 (PID.TID 0000.0001) %MON time_tsnumber = 36004
4551 (PID.TID 0000.0001) %MON time_secondsf = 3.1107456000000E+09
4552 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.2971432185661E-01
4553 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1980154678747E+01
4554 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8053960821078E-01
4555 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6969377953860E+00
4556 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6487740773787E-02
4557 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7397151760540E-01
4558 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.7012558277954E-01
4559 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2715365536768E-04
4560 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2988047268517E-02
4561 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7920298728640E-03
4562 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9463706228198E-01
4563 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1092331364691E-01
4564 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2423492565550E-04
4565 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3481135691697E-02
4566 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8275232839593E-03
4567 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.3857932882690E-05
4568 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7791298224622E-04
4569 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.0976687065306E-09
4570 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6265393938258E-06
4571 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1361141299879E-06
4572 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0095304079539E+01
4573 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.4840114809560E+00
4574 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5029369743098E+00
4575 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7492656307652E+00
4576 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5427720694963E-02
4577 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0825224245091E+01
4578 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8032614601284E+01
4579 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756096154508E+01
4580 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1190368128052E-01
4581 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0053281217082E-02
4582 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6612739203778E-02
4583 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4839553360093E-02
4584 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.8006345909710E-02
4585 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2915071385800E-01
4586 (PID.TID 0000.0001) %MON pe_b_mean = -1.9094599872445E-03
4587 (PID.TID 0000.0001) %MON ke_max = 3.6488943749877E-02
4588 (PID.TID 0000.0001) %MON ke_mean = 1.6202534062968E-04
4589 (PID.TID 0000.0001) %MON ke_vol = 1.3395912029633E+18
4590 (PID.TID 0000.0001) %MON vort_r_min = -1.2247375588026E-06
4591 (PID.TID 0000.0001) %MON vort_r_max = 1.3764054535182E-06
4592 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4593 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054013667563E-05
4594 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719483687646E-05
4595 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782269696129E-04
4596 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.3960187589369E-08
4597 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8793721810765E-08
4598 (PID.TID 0000.0001) // =======================================================
4599 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4600 (PID.TID 0000.0001) // =======================================================
4601 (PID.TID 0000.0001) // =======================================================
4602 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4603 (PID.TID 0000.0001) // =======================================================
4604 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1107456000000E+09
4605 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4670337606619E+13
4606 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.1902013912793E+13
4607 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2768323693827E+13
4608 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5781687972171E+00
4609 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.7299575924757E+00
4610 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.5045269790358E+00
4611 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4612 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4613 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0483089906894E+00
4614 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7883489343456E+00
4615 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5847954113703E-01
4616 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920047672533E+00
4617 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0934093004358E+00
4618 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7918951955716E+22
4619 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.7028659182352E+01
4620 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.2961840530616E-01
4621 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2781127812082E+01
4622 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3533847628703E+00
4623 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6558042372634E+01
4624 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4625 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -1.8311116004096E+00
4626 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.4509294633214E+00
4627 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.0923066907802E+00
4628 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3569748753411E+01
4629 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.6066572330472E+01
4630 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0896515527637E+01
4631 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -1.9814646394424E-01
4632 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -6.2249332951434E-01
4633 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.8193865624287E+00
4634 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.1036629089371E+00
4635 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.9102086916118E+00
4636 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.7329604792463E+00
4637 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.5494561695916E+00
4638 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.2608429900059E+00
4639 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.2294517935967E+00
4640 (PID.TID 0000.0001) // =======================================================
4641 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4642 (PID.TID 0000.0001) // =======================================================
4643 cg2d: Sum(rhs),rhsMax = 3.90354537828784E+02 2.29693632718721E+02
4644 (PID.TID 0000.0001) cg2d_init_res = 2.75812954039599E+00
4645 (PID.TID 0000.0001) cg2d_iters = 69
4646 (PID.TID 0000.0001) cg2d_res = 5.75587243924421E-07
4647 (PID.TID 0000.0001) // =======================================================
4648 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4649 (PID.TID 0000.0001) // =======================================================
4650 (PID.TID 0000.0001) %MON time_tsnumber = 36005
4651 (PID.TID 0000.0001) %MON time_secondsf = 3.1108320000000E+09
4652 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.2845921389781E-01
4653 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1978299407517E+01
4654 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8059110144061E-01
4655 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6962926336336E+00
4656 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6461424269296E-02
4657 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7423077568995E-01
4658 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.6976437876037E-01
4659 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2666544444890E-04
4660 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2987274860584E-02
4661 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7919254688521E-03
4662 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9488015431419E-01
4663 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1101142203993E-01
4664 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2376002396772E-04
4665 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3483108092717E-02
4666 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8265752626281E-03
4667 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.4549939944469E-05
4668 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7808036127154E-04
4669 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.0935268823861E-09
4670 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6260859343821E-06
4671 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1356552321677E-06
4672 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0077061090975E+01
4673 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.4775877014206E+00
4674 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5029935182717E+00
4675 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7493391497217E+00
4676 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5416068616993E-02
4677 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0827306781604E+01
4678 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8033191954618E+01
4679 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756097379382E+01
4680 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1189433382522E-01
4681 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0034293378237E-02
4682 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6510294892375E-02
4683 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.4945513752199E-02
4684 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.8060917788154E-02
4685 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2831606094182E-01
4686 (PID.TID 0000.0001) %MON pe_b_mean = -1.9082220652982E-03
4687 (PID.TID 0000.0001) %MON ke_max = 3.6374567716028E-02
4688 (PID.TID 0000.0001) %MON ke_mean = 1.6204038127155E-04
4689 (PID.TID 0000.0001) %MON ke_vol = 1.3395911946987E+18
4690 (PID.TID 0000.0001) %MON vort_r_min = -1.2290177945458E-06
4691 (PID.TID 0000.0001) %MON vort_r_max = 1.3796425180111E-06
4692 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4693 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054013565059E-05
4694 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719483388452E-05
4695 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782270234673E-04
4696 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.4012298173829E-08
4697 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.8851797841228E-08
4698 (PID.TID 0000.0001) // =======================================================
4699 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4700 (PID.TID 0000.0001) // =======================================================
4701 (PID.TID 0000.0001) // =======================================================
4702 (PID.TID 0000.0001) // Begin MONITOR Therm.SeaIce statistics
4703 (PID.TID 0000.0001) // =======================================================
4704 (PID.TID 0000.0001) %MON thSI_time_sec = 3.1108320000000E+09
4705 (PID.TID 0000.0001) %MON thSI_Ice_Area_G = 2.4722516614622E+13
4706 (PID.TID 0000.0001) %MON thSI_Ice_Area_S = 1.1856993034361E+13
4707 (PID.TID 0000.0001) %MON thSI_Ice_Area_N = 1.2865523580261E+13
4708 (PID.TID 0000.0001) %MON thSI_IceH_ave_G = 4.5696762998660E+00
4709 (PID.TID 0000.0001) %MON thSI_IceH_ave_S = 5.7444574285110E+00
4710 (PID.TID 0000.0001) %MON thSI_IceH_ave_N = 3.4869864604402E+00
4711 (PID.TID 0000.0001) %MON thSI_IceH_max_S = 1.0000000000000E+01
4712 (PID.TID 0000.0001) %MON thSI_IceH_max_N = 1.0000000000000E+01
4713 (PID.TID 0000.0001) %MON thSI_SnwH_ave_G = 1.0419222389595E+00
4714 (PID.TID 0000.0001) %MON thSI_SnwH_ave_S = 1.7833555298996E+00
4715 (PID.TID 0000.0001) %MON thSI_SnwH_ave_N = 3.5861002774039E-01
4716 (PID.TID 0000.0001) %MON thSI_SnwH_max_S = 4.0920697517832E+00
4717 (PID.TID 0000.0001) %MON thSI_SnwH_max_N = 4.0934220762947E+00
4718 (PID.TID 0000.0001) %MON thSI_TotEnerg_G = -3.7920066904658E+22
4719 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_G = -1.7062941480124E+01
4720 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_S = -1.1187067010218E-01
4721 (PID.TID 0000.0001) %MON thSI_Tsrf_ave_N = -3.2685215013379E+01
4722 (PID.TID 0000.0001) %MON thSI_Tsrf_min_S = -5.3696508804391E+00
4723 (PID.TID 0000.0001) %MON thSI_Tsrf_min_N = -4.6672827582881E+01
4724 (PID.TID 0000.0001) %MON thSI_Tsrf_max_S = 0.0000000000000E+00
4725 (PID.TID 0000.0001) %MON thSI_Tsrf_max_N = -1.6927841997550E+00
4726 (PID.TID 0000.0001) %MON thSI_Tic1_ave_G = -8.4751978797909E+00
4727 (PID.TID 0000.0001) %MON thSI_Tic1_ave_S = -5.0713911761591E+00
4728 (PID.TID 0000.0001) %MON thSI_Tic1_ave_N = -1.3643057918048E+01
4729 (PID.TID 0000.0001) %MON thSI_Tic1_min_S = -1.5925034538303E+01
4730 (PID.TID 0000.0001) %MON thSI_Tic1_min_N = -2.0968003795342E+01
4731 (PID.TID 0000.0001) %MON thSI_Tic1_max_S = -1.8495997832306E-01
4732 (PID.TID 0000.0001) %MON thSI_Tic1_max_N = -6.3219399267157E-01
4733 (PID.TID 0000.0001) %MON thSI_Tic2_ave_G = -3.8307460059557E+00
4734 (PID.TID 0000.0001) %MON thSI_Tic2_ave_S = -3.0999901207197E+00
4735 (PID.TID 0000.0001) %MON thSI_Tic2_ave_N = -4.9402226789415E+00
4736 (PID.TID 0000.0001) %MON thSI_Tic2_min_S = -8.7061562993255E+00
4737 (PID.TID 0000.0001) %MON thSI_Tic2_min_N = -7.5842895724309E+00
4738 (PID.TID 0000.0001) %MON thSI_Tic2_max_S = -1.2559989688147E+00
4739 (PID.TID 0000.0001) %MON thSI_Tic2_max_N = -1.2464474888775E+00
4740 (PID.TID 0000.0001) // =======================================================
4741 (PID.TID 0000.0001) // End MONITOR Therm.SeaIce statistics
4742 (PID.TID 0000.0001) // =======================================================
4743 cg2d: Sum(rhs),rhsMax = 3.90392464537088E+02 2.29795026190007E+02
4744 (PID.TID 0000.0001) cg2d_init_res = 2.71302075207214E+00
4745 (PID.TID 0000.0001) cg2d_iters = 69
4746 (PID.TID 0000.0001) cg2d_res = 5.65999927680541E-07
4747 (PID.TID 0000.0001) // =======================================================
4748 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4749 (PID.TID 0000.0001) // =======================================================
4750 (PID.TID 0000.0001) %MON time_tsnumber = 36006
4751 (PID.TID 0000.0001) %MON time_secondsf = 3.1109184000000E+09
4752 (PID.TID 0000.0001) %MON dynstat_eta_max = 7.2720368893839E-01
4753 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.1976366248061E+01
4754 (PID.TID 0000.0001) %MON dynstat_eta_mean = -5.8064751146589E-01
4755 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.6956556919520E+00
4756 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.6453679194682E-02
4757 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.7442722971689E-01
4758 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.6939182660646E-01
4759 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.2621622341089E-04
4760 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.2986431568705E-02
4761 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.7917445873467E-03
4762 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.9506264085612E-01
4763 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.1109235270064E-01
4764 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -4.2318302643275E-04
4765 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.3484924479614E-02
4766 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8256117817377E-03
4767 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.5273178023722E-05
4768 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.7819115029290E-04
4769 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.1008332407838E-09
4770 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.6256161451755E-06
4771 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.1352122684467E-06
4772 (PID.TID 0000.0001) %MON dynstat_theta_max = 3.0058438716535E+01
4773 (PID.TID 0000.0001) %MON dynstat_theta_min = -5.4710313126789E+00
4774 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.5030506436585E+00
4775 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.7494167759363E+00
4776 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 9.5443987907876E-02
4777 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0829246859667E+01
4778 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8033759810305E+01
4779 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4756098685742E+01
4780 (PID.TID 0000.0001) %MON dynstat_salt_sd = 5.1188494565855E-01
4781 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 2.0026781573654E-02
4782 (PID.TID 0000.0001) %MON advcfl_uvel_max = 7.6404632034702E-02
4783 (PID.TID 0000.0001) %MON advcfl_vvel_max = 8.5025057064916E-02
4784 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.8097039189835E-02
4785 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.2741523258455E-01
4786 (PID.TID 0000.0001) %MON pe_b_mean = -1.9070393203379E-03
4787 (PID.TID 0000.0001) %MON ke_max = 3.6257732647392E-02
4788 (PID.TID 0000.0001) %MON ke_mean = 1.6205260949947E-04
4789 (PID.TID 0000.0001) %MON ke_vol = 1.3395911759610E+18
4790 (PID.TID 0000.0001) %MON vort_r_min = -1.2335193297353E-06
4791 (PID.TID 0000.0001) %MON vort_r_max = 1.3830281109081E-06
4792 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4793 (PID.TID 0000.0001) %MON vort_a_sd = 7.5054013472741E-05
4794 (PID.TID 0000.0001) %MON vort_p_mean = -2.4719483285683E-05
4795 (PID.TID 0000.0001) %MON vort_p_sd = 1.2782270833490E-04
4796 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 8.4294265166573E-08