ViewVC logotype

Annotation of /MITgcm/verification/global_ocean.cs32x15/results/output.thsice.txt

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph

Revision 1.2 - (hide annotations) (download)
Tue Dec 5 20:51:12 2006 UTC (15 years, 8 months ago) by jmc
Branch: MAIN
CVS Tags: checkpoint58u_post, checkpoint58w_post, checkpoint58x_post, checkpoint58t_post, checkpoint59a, checkpoint59, checkpoint58y_post, checkpoint58v_post, checkpoint58s_post
Changes since 1.1: +1521 -480 lines
File MIME type: text/plain
changing cg2d.F (store solver main-diagonal term) affects the output
 of cg2d solver: => fails (@ level 11); generate a new output file.

1 jmc 1.1 (PID.TID 0000.0001)
2     (PID.TID 0000.0001) // ======================================================
3     (PID.TID 0000.0001) // MITgcm UV
4     (PID.TID 0000.0001) // =========
5     (PID.TID 0000.0001) // ======================================================
6     (PID.TID 0000.0001) // execution environment starting up...
7     (PID.TID 0000.0001)
8 jmc 1.2 (PID.TID 0000.0001) // MITgcmUV version: checkpoint58n_post
9 jmc 1.1 (PID.TID 0000.0001) // Build user: jmc
10     (PID.TID 0000.0001) // Build host: faulks
11 jmc 1.2 (PID.TID 0000.0001) // Build date: Wed Aug 23 11:14:36 EDT 2006
12 jmc 1.1 (PID.TID 0000.0001)
13     (PID.TID 0000.0001) // =======================================================
14     (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15     (PID.TID 0000.0001) // =======================================================
16     (PID.TID 0000.0001) ># Example "eedata" file
17     (PID.TID 0000.0001) ># Lines beginning "#" are comments
18     (PID.TID 0000.0001) ># nTx - No. threads per process in X
19     (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20     (PID.TID 0000.0001) > &EEPARMS
21     (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
22     (PID.TID 0000.0001) > nTx=1,
23     (PID.TID 0000.0001) > nTy=1,
24     (PID.TID 0000.0001) > &
25     (PID.TID 0000.0001) ># Note: Some systems use & as the
26     (PID.TID 0000.0001) ># namelist terminator. Other systems
27     (PID.TID 0000.0001) ># use a / character (as shown here).
28     (PID.TID 0000.0001)
29     (PID.TID 0000.0001) // =======================================================
30     (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
31     (PID.TID 0000.0001) // ( and "eedata" )
32     (PID.TID 0000.0001) // =======================================================
33     (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
34     (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
35     (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
36     (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
37     (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
38     (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
39     (PID.TID 0000.0001) OLx = 3 ; /* Tile overlap distance in X */
40     (PID.TID 0000.0001) OLy = 3 ; /* Tile overlap distance in Y */
41     (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
42     (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
43     (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
44     (PID.TID 0000.0001) nX = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
45     (PID.TID 0000.0001) nY = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
46     (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
47     (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
48     (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
49     (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
50     (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
51     (PID.TID 0000.0001) /* it must be launched appropriately e.g */
52     (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
53     (PID.TID 0000.0001) useCoupler= F ; /* Flag used to control communications with */
54     (PID.TID 0000.0001) /* other model components, through a coupler */
55     (PID.TID 0000.0001)
56     (PID.TID 0000.0001) // ======================================================
57     (PID.TID 0000.0001) // Mapping of tiles to threads
58     (PID.TID 0000.0001) // ======================================================
59     (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
60     (PID.TID 0000.0001)
61     (PID.TID 0000.0001) // ======================================================
62     (PID.TID 0000.0001) // Tile <-> Tile connectvity table
63     (PID.TID 0000.0001) // ======================================================
64     (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000001)
65     (PID.TID 0000.0001) // WEST: Tile = 000006, Process = 000001, Comm = put
66     (PID.TID 0000.0001) // bi = 000006, bj = 000001
67     (PID.TID 0000.0001) // EAST: Tile = 000002, Process = 000001, Comm = put
68     (PID.TID 0000.0001) // bi = 000002, bj = 000001
69     (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000001, Comm = put
70     (PID.TID 0000.0001) // bi = 000001, bj = 000001
71     (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000001, Comm = put
72     (PID.TID 0000.0001) // bi = 000001, bj = 000001
73     (PID.TID 0000.0001) // Tile number: 000002 (process no. = 000001)
74     (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000001, Comm = put
75     (PID.TID 0000.0001) // bi = 000001, bj = 000001
76     (PID.TID 0000.0001) // EAST: Tile = 000003, Process = 000001, Comm = put
77     (PID.TID 0000.0001) // bi = 000003, bj = 000001
78     (PID.TID 0000.0001) // SOUTH: Tile = 000002, Process = 000001, Comm = put
79     (PID.TID 0000.0001) // bi = 000002, bj = 000001
80     (PID.TID 0000.0001) // NORTH: Tile = 000002, Process = 000001, Comm = put
81     (PID.TID 0000.0001) // bi = 000002, bj = 000001
82     (PID.TID 0000.0001) // Tile number: 000003 (process no. = 000001)
83     (PID.TID 0000.0001) // WEST: Tile = 000002, Process = 000001, Comm = put
84     (PID.TID 0000.0001) // bi = 000002, bj = 000001
85     (PID.TID 0000.0001) // EAST: Tile = 000004, Process = 000001, Comm = put
86     (PID.TID 0000.0001) // bi = 000004, bj = 000001
87     (PID.TID 0000.0001) // SOUTH: Tile = 000003, Process = 000001, Comm = put
88     (PID.TID 0000.0001) // bi = 000003, bj = 000001
89     (PID.TID 0000.0001) // NORTH: Tile = 000003, Process = 000001, Comm = put
90     (PID.TID 0000.0001) // bi = 000003, bj = 000001
91     (PID.TID 0000.0001) // Tile number: 000004 (process no. = 000001)
92     (PID.TID 0000.0001) // WEST: Tile = 000003, Process = 000001, Comm = put
93     (PID.TID 0000.0001) // bi = 000003, bj = 000001
94     (PID.TID 0000.0001) // EAST: Tile = 000005, Process = 000001, Comm = put
95     (PID.TID 0000.0001) // bi = 000005, bj = 000001
96     (PID.TID 0000.0001) // SOUTH: Tile = 000004, Process = 000001, Comm = put
97     (PID.TID 0000.0001) // bi = 000004, bj = 000001
98     (PID.TID 0000.0001) // NORTH: Tile = 000004, Process = 000001, Comm = put
99     (PID.TID 0000.0001) // bi = 000004, bj = 000001
100     (PID.TID 0000.0001) // Tile number: 000005 (process no. = 000001)
101     (PID.TID 0000.0001) // WEST: Tile = 000004, Process = 000001, Comm = put
102     (PID.TID 0000.0001) // bi = 000004, bj = 000001
103     (PID.TID 0000.0001) // EAST: Tile = 000006, Process = 000001, Comm = put
104     (PID.TID 0000.0001) // bi = 000006, bj = 000001
105     (PID.TID 0000.0001) // SOUTH: Tile = 000005, Process = 000001, Comm = put
106     (PID.TID 0000.0001) // bi = 000005, bj = 000001
107     (PID.TID 0000.0001) // NORTH: Tile = 000005, Process = 000001, Comm = put
108     (PID.TID 0000.0001) // bi = 000005, bj = 000001
109     (PID.TID 0000.0001) // Tile number: 000006 (process no. = 000001)
110     (PID.TID 0000.0001) // WEST: Tile = 000005, Process = 000001, Comm = put
111     (PID.TID 0000.0001) // bi = 000005, bj = 000001
112     (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000001, Comm = put
113     (PID.TID 0000.0001) // bi = 000001, bj = 000001
114     (PID.TID 0000.0001) // SOUTH: Tile = 000006, Process = 000001, Comm = put
115     (PID.TID 0000.0001) // bi = 000006, bj = 000001
116     (PID.TID 0000.0001) // NORTH: Tile = 000006, Process = 000001, Comm = put
117     (PID.TID 0000.0001) // bi = 000006, bj = 000001
118     (PID.TID 0000.0001)
119     (PID.TID 0000.0001) ===== W2 TILE TOPLOGY =====
120     (PID.TID 0000.0001) TILE: 1
121     (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
122     (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
123     (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
124     (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
125     (PID.TID 0000.0001) TILE: 2
126     (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
127     (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
128     (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
129     (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
130     (PID.TID 0000.0001) TILE: 3
131     (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
132     (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
133     (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
134     (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
135     (PID.TID 0000.0001) TILE: 4
136     (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
137     (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
138     (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
139     (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
140     (PID.TID 0000.0001) TILE: 5
141     (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
142     (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
143     (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
144     (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
145     (PID.TID 0000.0001) TILE: 6
146     (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
147     (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
148     (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
149     (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
150     (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 35: -2, j= 30: 32
151     (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 3(proc = 1)
152     (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= -2: 35, j= 1: 3
153     (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 6(proc = 1)
154     (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 30: 32, j= -2: 35
155     (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 2(proc = 1)
156     (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 1: 3, j= 35: -2
157     (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 5(proc = 1)
158     (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= -2: 35, j= 30: 32
159     (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 3(proc = 1)
160     (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 35: -2, j= 1: 3
161     (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 6(proc = 1)
162     (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 30: 32, j= 35: -2
163     (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 4(proc = 1)
164     (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 1: 3, j= -2: 35
165     (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 1(proc = 1)
166     (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 35: -2, j= 30: 32
167     (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 5(proc = 1)
168     (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= -2: 35, j= 1: 3
169     (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 2(proc = 1)
170     (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 30: 32, j= -2: 35
171     (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 4(proc = 1)
172     (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 1: 3, j= 35: -2
173     (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 1(proc = 1)
174     (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= -2: 35, j= 30: 32
175     (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 5(proc = 1)
176     (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 35: -2, j= 1: 3
177     (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 2(proc = 1)
178     (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 30: 32, j= 35: -2
179     (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 6(proc = 1)
180     (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 1: 3, j= -2: 35
181     (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 3(proc = 1)
182     (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 35: -2, j= 30: 32
183     (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 1(proc = 1)
184     (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= -2: 35, j= 1: 3
185     (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 4(proc = 1)
186     (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 30: 32, j= -2: 35
187     (PID.TID 0000.0001) to points i= -2: 0, j= -2: 35 in tile 6(proc = 1)
188     (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 1: 3, j= 35: -2
189     (PID.TID 0000.0001) to points i= -2: 35, j= 33: 35 in tile 3(proc = 1)
190     (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= -2: 35, j= 30: 32
191     (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 1(proc = 1)
192     (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 35: -2, j= 1: 3
193     (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 4(proc = 1)
194     (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 30: 32, j= 35: -2
195     (PID.TID 0000.0001) to points i= -2: 35, j= -2: 0 in tile 2(proc = 1)
196     (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 1: 3, j= -2: 35
197     (PID.TID 0000.0001) to points i= 33: 35, j= -2: 35 in tile 5(proc = 1)
198     (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
199     (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
200     (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
201     (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
202     (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 3(proc = 1)
203     (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 6(proc = 1)
204     (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
205     (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
206     (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
207     (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
208     (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 4(proc = 1)
209     (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 1(proc = 1)
210     (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 5(proc = 1)
211     (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 2(proc = 1)
212     (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
213     (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
214     (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
215     (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
216     (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 6(proc = 1)
217     (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 3(proc = 1)
218     (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= 33: 35from tile 1(proc = 1)
219     (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 35, j= -2: 0from tile 4(proc = 1)
220     (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= 33: 35, j= -2: 35from tile 2(proc = 1)
221     (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -2: 0, j= -2: 35from tile 5(proc = 1)
222     (PID.TID 0000.0001) // =======================================================
223     (PID.TID 0000.0001) // Model parameter file "data"
224     (PID.TID 0000.0001) // =======================================================
225     (PID.TID 0000.0001) ># ====================
226     (PID.TID 0000.0001) ># | Model parameters |
227     (PID.TID 0000.0001) ># ====================
228     (PID.TID 0000.0001) >#
229     (PID.TID 0000.0001) ># Continuous equation parameters
230     (PID.TID 0000.0001) > &PARM01
231     (PID.TID 0000.0001) > tRef=15*20.,
232     (PID.TID 0000.0001) > sRef=15*35.,
233     (PID.TID 0000.0001) > viscAh =3.E5,
234     (PID.TID 0000.0001) > viscAr =1.E-3,
235     (PID.TID 0000.0001) > diffKhT=0.,
236     (PID.TID 0000.0001) > diffK4T=0.,
237     (PID.TID 0000.0001) > diffKrT=3.E-5,
238     (PID.TID 0000.0001) > diffKhS=0.,
239     (PID.TID 0000.0001) > diffK4S=0.,
240     (PID.TID 0000.0001) > diffKrS=3.E-5,
241     (PID.TID 0000.0001) > ivdc_kappa=10.,
242     (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
243     (PID.TID 0000.0001) > rotationPeriod=86400.,
244     (PID.TID 0000.0001) > gravity=9.81,
245     (PID.TID 0000.0001) > rhonil=1035.,
246     (PID.TID 0000.0001) > rhoConstFresh=1000.,
247     (PID.TID 0000.0001) > eosType='JMD95Z',
248     (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
249     (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
250     (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
251     (PID.TID 0000.0001) > exactConserv=.TRUE.,
252     (PID.TID 0000.0001) > select_rStar=2,
253     (PID.TID 0000.0001) > nonlinFreeSurf=4,
254     (PID.TID 0000.0001) > hFacInf=0.2,
255     (PID.TID 0000.0001) > hFacSup=2.0,
256     (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
257     (PID.TID 0000.0001) > hFacMin=.1,
258     (PID.TID 0000.0001) > hFacMinDr=20.,
259     (PID.TID 0000.0001) > readBinaryPrec=64,
260     (PID.TID 0000.0001) >#writeBinaryPrec=64,
261     (PID.TID 0000.0001) > &
262     (PID.TID 0000.0001) >
263     (PID.TID 0000.0001) ># Elliptic solver parameters
264     (PID.TID 0000.0001) > &PARM02
265     (PID.TID 0000.0001) > cg2dMaxIters=200,
266     (PID.TID 0000.0001) >#cg2dTargetResidual=1.E-9,
267     (PID.TID 0000.0001) > cg2dTargetResWunit=1.E-14,
268     (PID.TID 0000.0001) > &
269     (PID.TID 0000.0001) >
270     (PID.TID 0000.0001) ># Time stepping parameters
271     (PID.TID 0000.0001) > &PARM03
272     (PID.TID 0000.0001) > nIter0=36000,
273     (PID.TID 0000.0001) > nTimeSteps=20,
274     (PID.TID 0000.0001) > deltaTmom =1200.,
275     (PID.TID 0000.0001) > deltaTtracer=86400.,
276     (PID.TID 0000.0001) > deltaTfreesurf=86400.,
277     (PID.TID 0000.0001) > deltaTClock =86400.,
278     (PID.TID 0000.0001) > abEps = 0.1,
279     (PID.TID 0000.0001) >#forcing_In_AB=.FALSE.,
280     (PID.TID 0000.0001) > tracForcingOutAB=1,
281     (PID.TID 0000.0001) > pChkptFreq =31104000.,
282     (PID.TID 0000.0001) > taveFreq =31104000.,
283     (PID.TID 0000.0001) > dumpFreq =31104000.,
284     (PID.TID 0000.0001) > monitorFreq =2592000.,
285     (PID.TID 0000.0001) >#tave_lastIter=0.,
286     (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
287     (PID.TID 0000.0001) > externForcingPeriod=2592000.,
288     (PID.TID 0000.0001) > externForcingCycle=31104000.,
289     (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
290     (PID.TID 0000.0001) > tauThetaClimRelax = 5184000.,
291     (PID.TID 0000.0001) ># 6 months restoring timescale for salinity
292     (PID.TID 0000.0001) > tauSaltClimRelax = 15552000.,
293     (PID.TID 0000.0001) > latBandClimRelax=50.,
294     (PID.TID 0000.0001) > monitorFreq =1.,
295     (PID.TID 0000.0001) > &
296     (PID.TID 0000.0001) >
297     (PID.TID 0000.0001) ># Gridding parameters
298     (PID.TID 0000.0001) > &PARM04
299     (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
300 jmc 1.2 (PID.TID 0000.0001) > horizGridFile='grid_cs32',
301 jmc 1.1 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
302     (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
303     (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
304     (PID.TID 0000.0001) > &
305     (PID.TID 0000.0001) >
306     (PID.TID 0000.0001) ># Input datasets
307     (PID.TID 0000.0001) > &PARM05
308     (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
309     (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
310     (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
311     (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
312     (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
313     (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
314     (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
315     (PID.TID 0000.0001) > &
316     (PID.TID 0000.0001)
317     (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM01
318     (PID.TID 0000.0001) S/R INI_PARMS ; read PARM01 : OK
319     (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM02
320     (PID.TID 0000.0001) S/R INI_PARMS ; read PARM02 : OK
321     (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM03
322     (PID.TID 0000.0001) S/R INI_PARMS ; read PARM03 : OK
323     (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM04
324     (PID.TID 0000.0001) S/R INI_PARMS ; read PARM04 : OK
325     (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM05
326     (PID.TID 0000.0001) S/R INI_PARMS ; read PARM05 : OK
327     (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
328     (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
329     (PID.TID 0000.0001) // =======================================================
330     (PID.TID 0000.0001) // Parameter file "data.pkg"
331     (PID.TID 0000.0001) // =======================================================
332     (PID.TID 0000.0001) ># Packages
333     (PID.TID 0000.0001) > &PACKAGES
334     (PID.TID 0000.0001) > useGMRedi=.TRUE.,
335     (PID.TID 0000.0001) > useBulkforce=.TRUE.,
336     (PID.TID 0000.0001) > useThSIce=.TRUE.,
337 jmc 1.2 (PID.TID 0000.0001) > useDiagnostics=.TRUE.,
338 jmc 1.1 (PID.TID 0000.0001) > &
339     (PID.TID 0000.0001)
340     (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
341     (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
342     (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
343     (PID.TID 0000.0001) // =======================================================
344     (PID.TID 0000.0001) // Parameter file "data.gmredi"
345     (PID.TID 0000.0001) // =======================================================
346     (PID.TID 0000.0001) ># GM+Redi package parameters:
347     (PID.TID 0000.0001) >
348     (PID.TID 0000.0001) >#-from MOM :
349     (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
350     (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
351     (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
352     (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
353     (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
354     (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
355     (PID.TID 0000.0001) >
356     (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
357     (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
358     (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
359     (PID.TID 0000.0001) >
360     (PID.TID 0000.0001) > &GM_PARM01
361     (PID.TID 0000.0001) > GM_background_K = 800.,
362     (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
363     (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
364     (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
365     (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
366     (PID.TID 0000.0001) > GM_Sd = 1.e-3,
367     (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
368     (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
369     (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
370     (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
371     (PID.TID 0000.0001) > &
372     (PID.TID 0000.0001) >
373     (PID.TID 0000.0001) >
374     (PID.TID 0000.0001)
375     (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
376     (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.blk
377     (PID.TID 0000.0001) // =======================================================
378     (PID.TID 0000.0001) // Parameter file "data.blk"
379     (PID.TID 0000.0001) // =======================================================
380     (PID.TID 0000.0001) > &BULKF_CONST
381     (PID.TID 0000.0001) > Tf0kel = 273.15,
382     (PID.TID 0000.0001) >#p0 = 1013., <- no longer in Namelist, but hard coded
383     (PID.TID 0000.0001) > Rgas = 287.,
384     (PID.TID 0000.0001) > &
385     (PID.TID 0000.0001) >
386     (PID.TID 0000.0001) > &BULKF_PARM01
387     (PID.TID 0000.0001) ># set blk_nIter=0 to use the original FORMULA_LANL:
388     (PID.TID 0000.0001) > blk_nIter= 0,
389     (PID.TID 0000.0001) >#RainFile= 'ncep_precip_cs.bin',
390     (PID.TID 0000.0001) > RainFile= 'ncep_pr_scal_cs.bin',
391     (PID.TID 0000.0001) > SolarFile= 'ncep_downsolar_cs.bin',
392     (PID.TID 0000.0001) > AirTempFile= 'ncep_tair_cs.bin',
393     (PID.TID 0000.0001) > AirhumidityFile='ncep_qair_cs.bin',
394     (PID.TID 0000.0001) > LongwaveFile= 'ncep_downlw_cs.bin',
395     (PID.TID 0000.0001) > UWindFile= ' ',
396     (PID.TID 0000.0001) > VWindFile= ' ',
397     (PID.TID 0000.0001) > WspeedFile= 'ncep_windspeed_cs.bin',
398     (PID.TID 0000.0001) > RunoffFile= ' ',
399     (PID.TID 0000.0001) > QnetFile= ' ',
400     (PID.TID 0000.0001) > EmPFile= ' ',
401     (PID.TID 0000.0001) > CloudFile= ' ',
402     (PID.TID 0000.0001) >#blk_taveFreq=864000.,
403     (PID.TID 0000.0001) > &
404     (PID.TID 0000.0001) >
405     (PID.TID 0000.0001) > &BULKF_PARM02
406     (PID.TID 0000.0001) > qnet_off=0.0,
407     (PID.TID 0000.0001) > empmr_off=0.0,
408     (PID.TID 0000.0001) > conservcycle=311040000.,
409     (PID.TID 0000.0001) > &
410     (PID.TID 0000.0001) >
411     (PID.TID 0000.0001)
412     (PID.TID 0000.0001) BULKF_READPARMS: starts to read BULKF_CONST
413     (PID.TID 0000.0001) BULKF_READPARMS: read BULKF_CONST : OK
414     (PID.TID 0000.0001) BULKF_READPARMS: starts to read BULKF_PARM01
415     (PID.TID 0000.0001) BULKF_READPARMS: read BULKF_PARM01 : OK
416     BlkF: rhoA = 1.3
417     BlkF: rhoFW = 1000.
418     BlkF: cpAir = 1004.
419     BlkF: Lvap = 2500000.
420     BlkF: Lfresh = 334000.
421     BlkF: Tf0kel = 273.15
422     BlkF: Rgas = 287.
423     BlkF: xkar = 0.4
424     BlkF: stefan = 5.67E-08
425     BlkF: zref = 10.
426     BlkF: zwd = 10.
427     BlkF: zth = 10.
428     BlkF: cDrag_1 = 0.0027
429     BlkF: cDrag_2 = 0.000142
430     BlkF: cDrag_3 = 7.64E-05
431     BlkF: cStantonS= 0.018
432     BlkF: cStantonU= 0.0327
433     BlkF: cDalton = 0.0346
434     BlkF: umin = 1.
435     BlkF: humid_fac= 0.606
436     BlkF: saltQsFac= 0.98
437     BlkF: gamma_blk= 0.01
438     BlkF: atm_emissivity = 0.9
439     BlkF: ocean_emissivity= 0.985
440     BlkF: snow_emissivity = 0.98
441     BlkF: ice_emissivity = 0.98
442     BlkF: ocean_albedo = 0.1
443 jmc 1.2 BlkF: FWIND0 = 0.6
444     BlkF: CHS = 0.0008
445     BlkF: VGUST = 5.
446     BlkF: DTHETA = 3.
447     BlkF: dTstab = 1.
448     BlkF: FSTAB = 0.67
449 jmc 1.1 BlkF: useFluxFormula_AIM= F
450     BlkF: calcWindStress = F
451     BlkF: useQnetch = F
452     BlkF: useEmPch = F
453     BlkF: blk_nIter = 0
454     BlkF: blk_taveFreq= 31104000.
455     (PID.TID 0000.0001) THSICE_READPARMS: opening data.ice
456     (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.ice
457     (PID.TID 0000.0001) // =======================================================
458     (PID.TID 0000.0001) // Parameter file "data.ice"
459     (PID.TID 0000.0001) // =======================================================
460     (PID.TID 0000.0001) > &THSICE_CONST
461     (PID.TID 0000.0001) > Tf0kel = 273.15,
462     (PID.TID 0000.0001) >#- with LANL albedo:
463     (PID.TID 0000.0001) >#albWarmSnow=0.75,
464     (PID.TID 0000.0001) >#- for full ice-fraction :
465     (PID.TID 0000.0001) >#icemaskmin = 1.,
466     (PID.TID 0000.0001) >#himin0 = 0.01,
467     (PID.TID 0000.0001) >#frac_energy= 0.,
468     (PID.TID 0000.0001) >#hihig =100.,
469     (PID.TID 0000.0001) >#- with fractional ice:
470     (PID.TID 0000.0001) > icemaskmin = 0.05,
471     (PID.TID 0000.0001) > hiMax = 10.,
472     (PID.TID 0000.0001) > hsMax = 10.,
473     (PID.TID 0000.0001) >#albIceMax =0.7,
474     (PID.TID 0000.0001) >#albIceMin =0.7,
475     (PID.TID 0000.0001) > &
476     (PID.TID 0000.0001) >
477     (PID.TID 0000.0001) > &THSICE_PARM01
478     (PID.TID 0000.0001) >#StartIceModel=1,
479     (PID.TID 0000.0001) > stressReduction=0.,
480     (PID.TID 0000.0001) >#thSIce_taveFreq=2592000.,
481     (PID.TID 0000.0001) >#thSIce_diagFreq=2592000.,
482     (PID.TID 0000.0001) >#thSIce_monFreq=864000.,
483     (PID.TID 0000.0001) > &
484     (PID.TID 0000.0001) >
485     (PID.TID 0000.0001)
487     (PID.TID 0000.0001) THSICE_READPARMS: read THSICE_PARM01
488     ThSI: rhos = 330.
489     ThSI: rhoi = 900.
490     ThSI: rhosw = 1035.
491     ThSI: rhofw = 1000.
492     ThSI: rhoiw = 135.
493     ThSI: cpice = 2106.
494     ThSI: cpwater = 3994.
495     ThSI: kice = 2.03
496     ThSI: ksnow = 0.3
497     ThSI: transcoef= 0.006
498     ThSI: Lfresh = 334000.
499     ThSI: qsnow = 334000.
500     ThSI: albColdSnow= 0.85
501     ThSI: albWarmSnow= 0.7
502 jmc 1.2 ThSI: tempSnowAlb= -10.
503 jmc 1.1 ThSI: albOldSnow = 0.55
504 jmc 1.2 ThSI: hNewSnowAge= 0.002
505     ThSI: snowAgTime = 4320000.
506 jmc 1.1 ThSI: albIceMax = 0.65
507     ThSI: albIceMin = 0.2
508     ThSI: hAlbIce = 0.5
509     ThSI: hAlbSnow = 0.3
510     ThSI: i0 = 0.3
511     ThSI: ksolar = 1.5
512     ThSI: saltice = 4.
513     ThSI: S_winton= 1.
514     ThSI: mu_Tf = 0.054
515     ThSI: Tf0kel = 273.15
516     ThSI: Tmlt1 = -0.054
517     ThSI: himin = 0.01
518     ThSI: Terrmax = 0.5
519     ThSI: nitMaxTsf= 20
520     ThSI: hiMax = 10.
521     ThSI: hsMax = 10.
522     ThSI: iceMaskmax= 1.
523     ThSI: iceMaskmin= 0.05
524     ThSI: himin0 = 0.2
525     ThSI: frac_energy 0.4
526     ThSI: hihig = 2.5
527     ThSI: stressReduction = 0.
528     ThSI: thSIce_deltaT = 86400.
529     ThSI: ocean_deltaT = 86400.
530     ThSI: stepFwd_oceMxL= F
531     ThSI: tauRelax_MxL = 0.
532     ThSI: hMxL_default = 50.
533     ThSI: sMxL_default = 35.
534     ThSI: vMxL_default = 0.05
535     ThSI: thSIce_taveFreq= 31104000.
536     ThSI: thSIce_diagFreq= 31104000.
537     ThSI: thSIce_monFreq = 1.
538     ThSI: startIceModel = 0
539 jmc 1.2 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: opening data.diagnostics
540     (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.diagnostics
541     (PID.TID 0000.0001) // =======================================================
542     (PID.TID 0000.0001) // Parameter file "data.diagnostics"
543     (PID.TID 0000.0001) // =======================================================
544     (PID.TID 0000.0001) ># Diagnostic Package Choices
545     (PID.TID 0000.0001) >#-----------------
546     (PID.TID 0000.0001) ># for each output-stream:
547     (PID.TID 0000.0001) ># filename(n) : prefix of the output file name (only 8.c long) for outp.stream n
548     (PID.TID 0000.0001) ># frequency(n):< 0 : write snap-shot output every |frequency| seconds
549     (PID.TID 0000.0001) ># > 0 : write time-average output every frequency seconds
550     (PID.TID 0000.0001) ># timePhase(n) : write at time = timePhase + multiple of |frequency|
551     (PID.TID 0000.0001) ># averagingFreq(n) : frequency (in s) for periodic averaging interval
552     (PID.TID 0000.0001) ># averagingPhase(n): phase (in s) for periodic averaging interval
553     (PID.TID 0000.0001) ># repeatCycle(n) : number of averaging intervals in 1 cycle
554     (PID.TID 0000.0001) ># levels(:,n) : list of levels to write to file (Notes: declared as REAL)
555     (PID.TID 0000.0001) ># when this entry is missing, select all common levels of this list
556     (PID.TID 0000.0001) ># fields(:,n) : list of diagnostics fields (8.c) (see "available_diagnostics.log"
557     (PID.TID 0000.0001) ># file for the list of all available diag. in this particular config)
558     (PID.TID 0000.0001) >#-----------------
559     (PID.TID 0000.0001) > &DIAGNOSTICS_LIST
560     (PID.TID 0000.0001) ># diag_mnc = .FALSE.,
561     (PID.TID 0000.0001) ># dumpAtLast = .TRUE.,
562     (PID.TID 0000.0001) > fields(1,1) = 'ETAN ','ETANSQ ','DETADT2 ','PHIBOT ','PHIBOTSQ',
563     (PID.TID 0000.0001) > 'oceTAUX ','oceTAUY ','TFLUX ','SFLUX ','oceFreez',
564     (PID.TID 0000.0001) > 'TRELAX ','SRELAX ',
565     (PID.TID 0000.0001) > levels(1,1) = 1.,
566     (PID.TID 0000.0001) > filename(1) = 'surfDiag',
567     (PID.TID 0000.0001) > frequency(1) = 1555200000.,
568     (PID.TID 0000.0001) > fields(1,2) = 'UVEL ','VVEL ','WVEL ','PHIHYD ',
569     (PID.TID 0000.0001) > 'VVELMASS','UVELMASS','WVELSQ ',
570     (PID.TID 0000.0001) > 'THETA ','UTHMASS ','VTHMASS ','WTHMASS ',
571     (PID.TID 0000.0001) > 'SALT ','USLTMASS','VSLTMASS','WSLTMASS',
572     (PID.TID 0000.0001) ># do not specify levels => all levels are selected
573     (PID.TID 0000.0001) > filename(2) = 'dynDiag',
574     (PID.TID 0000.0001) > frequency(2) = 1555200000.,
575     (PID.TID 0000.0001) > fields(1,3) = 'DRHODR ','RHOAnoma','CONVADJ ',
576     (PID.TID 0000.0001) > 'GM_PsiX ','GM_PsiY ',
577     (PID.TID 0000.0001) > 'GM_Kwx ','GM_Kwy ','GM_Kwz ',
578     (PID.TID 0000.0001) > 'GM_Kux ','GM_Kvy ',
579     (PID.TID 0000.0001) > 'GM_Kuz ','GM_Kvz ',
580     (PID.TID 0000.0001) >#- disable this output list by commenting out the file name
581     (PID.TID 0000.0001) ># filename(3) = 'oceDiag',
582     (PID.TID 0000.0001) > frequency(3) = 1555200000.,
583     (PID.TID 0000.0001) > fields(1,4) = 'ADVx_TH ','ADVy_TH ','ADVr_TH ',
584     (PID.TID 0000.0001) > 'DFxE_TH ','DFyE_TH ','DFrE_TH ',
585     (PID.TID 0000.0001) > 'DFrI_TH ',
586     (PID.TID 0000.0001) ># 'ADVx_SLT',
587     (PID.TID 0000.0001) ># filename(4) = 'flxDiag',
588     (PID.TID 0000.0001) > frequency(4) = 1728000.,
589     (PID.TID 0000.0001) > fields(1,5) = 'SI_Fract','SI_Thick','SI_SnowH',
590     (PID.TID 0000.0001) > 'SI_Tsrf ','SI_Tice1','SI_Tice2',
591     (PID.TID 0000.0001) > 'SI_Qice1','SI_Qice2','SIsnwAge',
592     (PID.TID 0000.0001) > 'SIsnwPrc','SIalbedo',
593     (PID.TID 0000.0001) > 'SIflx2oc','SIfrw2oc','SIsaltFx',
594     (PID.TID 0000.0001) > 'SIflxAtm','SIfrwAtm',
595     (PID.TID 0000.0001) ># 'SItOcMxL','SIsOcMxL',
596     (PID.TID 0000.0001) > filename(5) = 'thSIceDiag',
597     (PID.TID 0000.0001) > frequency(5) = 1555200000.,
598     (PID.TID 0000.0001) > averagingFreq(5) = 2592000.,
599     (PID.TID 0000.0001) > repeatCycle(5) = 12,
600     (PID.TID 0000.0001) > &
601     (PID.TID 0000.0001) >
602     (PID.TID 0000.0001) ># Parameter for Diagnostics of per level statistics:
603     (PID.TID 0000.0001) >#-----------------
604     (PID.TID 0000.0001) ># for each output-stream:
605     (PID.TID 0000.0001) ># stat_fname(n) : prefix of the output file name (only 8.c long) for outp.stream n
606     (PID.TID 0000.0001) ># stat_freq(n):< 0 : write snap-shot output every |stat_freq| seconds
607     (PID.TID 0000.0001) ># > 0 : write time-average output every stat_freq seconds
608     (PID.TID 0000.0001) ># stat_phase(n) : write at time = stat_phase + multiple of |stat_freq|
609     (PID.TID 0000.0001) ># stat_region(:,n) : list of "regions" (default: 1 region only=global)
610     (PID.TID 0000.0001) ># stat_fields(:,n) : list of diagnostics fields (8.c) (see "available_diagnostics.log"
611     (PID.TID 0000.0001) ># file for the list of all available diag. in this particular config)
612     (PID.TID 0000.0001) >#-----------------
613     (PID.TID 0000.0001) > &DIAG_STATIS_PARMS
614     (PID.TID 0000.0001) >#- regional mask: 3 lat. band: 1 : y <= -24 ; 2 : -24<y<24 ; 3 : 24 <= y
615     (PID.TID 0000.0001) > diagSt_regMaskFile='regMask_lat24.bin',
616     (PID.TID 0000.0001) > nSetRegMskFile=1,
617     (PID.TID 0000.0001) > set_regMask(1)= 1, 1, 1,
618     (PID.TID 0000.0001) > val_regMask(1)= 1., 2., 3.,
619     (PID.TID 0000.0001) >#---
620     (PID.TID 0000.0001) > stat_fields(1,1)= 'ETAN ','UVEL ','VVEL ','WVEL ',
621     (PID.TID 0000.0001) > 'THETA ','SALT ','CONVADJ ','DETADT2 ',
622     (PID.TID 0000.0001) > stat_fname(1)= 'dynStDiag',
623     (PID.TID 0000.0001) > stat_freq(1)= 864000.,
624     (PID.TID 0000.0001) > stat_fields(1,5)= 'SI_Fract','SI_Thick','SI_SnowH',
625     (PID.TID 0000.0001) > 'SI_Tsrf ','SI_Tice1','SI_Tice2',
626     (PID.TID 0000.0001) > 'SI_Qice1','SI_Qice2',
627     (PID.TID 0000.0001) > 'SIsnwPrc','SIalbedo','SIsnwAge',
628     (PID.TID 0000.0001) > 'SIflx2oc','SIfrw2oc','SIsaltFx',
629     (PID.TID 0000.0001) > 'SIflxAtm','SIfrwAtm',
630     (PID.TID 0000.0001) ># 'SItOcMxL','SIsOcMxL',
631     (PID.TID 0000.0001) > stat_region(1,5)= 1, 3, 0,
632     (PID.TID 0000.0001) > stat_fname(5)= 'thSIceStDiag',
633     (PID.TID 0000.0001) > stat_freq(5)= 864000.,
634     (PID.TID 0000.0001) > &
635     (PID.TID 0000.0001) >
636     (PID.TID 0000.0001)
637     (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "diagnostics_list": start
638     (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "diagnostics_list": OK
639     (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "DIAG_STATIS_PARMS": start
640     (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "DIAG_STATIS_PARMS": OK
641     (PID.TID 0000.0001) -----------------------------------------------------
642     (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: active diagnostics summary:
643     (PID.TID 0000.0001) -----------------------------------------------------
644     (PID.TID 0000.0001) Creating Output Stream: surfDiag
645     (PID.TID 0000.0001) Output Frequency:1555200000.000000 ; Phase: 0.000000
646     (PID.TID 0000.0001) Averaging Freq.:1555200000.000000 , Phase: 0.000000 , Cycle: 1
647     (PID.TID 0000.0001) Levels: 1.
649     (PID.TID 0000.0001) Fields: TRELAX SRELAX
650     (PID.TID 0000.0001) Creating Output Stream: dynDiag
651     (PID.TID 0000.0001) Output Frequency:1555200000.000000 ; Phase: 0.000000
652     (PID.TID 0000.0001) Averaging Freq.:1555200000.000000 , Phase: 0.000000 , Cycle: 1
653     (PID.TID 0000.0001) Levels: will be set later
656     (PID.TID 0000.0001) Creating Output Stream: thSIceDiag
657     (PID.TID 0000.0001) Output Frequency:1555200000.000000 ; Phase: 0.000000
658     (PID.TID 0000.0001) Averaging Freq.: 2592000.000000 , Phase: 0.000000 , Cycle: 12
659     (PID.TID 0000.0001) Levels: will be set later
660     (PID.TID 0000.0001) Fields: SI_Fract SI_Thick SI_SnowH SI_Tsrf SI_Tice1 SI_Tice2 SI_Qice1 SI_Qice2 SIsnwAge SIsnwPrc
661     (PID.TID 0000.0001) Fields: SIalbedo SIflx2oc SIfrw2oc SIsaltFx SIflxAtm SIfrwAtm
662     (PID.TID 0000.0001) -----------------------------------------------------
663     (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: statistics diags. summary:
664     (PID.TID 0000.0001) Creating Stats. Output Stream: dynStDiag
665     (PID.TID 0000.0001) Output Frequency: 864000.000000 ; Phase: 0.000000
666     (PID.TID 0000.0001) Regions : 0
668     (PID.TID 0000.0001) Creating Stats. Output Stream: thSIceStDiag
669     (PID.TID 0000.0001) Output Frequency: 864000.000000 ; Phase: 0.000000
670     (PID.TID 0000.0001) Regions : 0 1 3
671     (PID.TID 0000.0001) Fields: SI_Fract SI_Thick SI_SnowH SI_Tsrf SI_Tice1 SI_Tice2 SI_Qice1 SI_Qice2 SIsnwPrc SIalbedo SIsnwAge SIflx2oc SIfrw2oc SIsaltFx SIflxAtm SIfrwAtm
672     (PID.TID 0000.0001) -----------------------------------------------------
673     (PID.TID 0000.0001)
674 jmc 1.1 (PID.TID 0000.0001) SET_PARMS: done
675 jmc 1.2 (PID.TID 0000.0001) Enter INI_VERTICAL_GRID: setInterFDr= T ; setCenterDr= F
676     (PID.TID 0000.0001) tile: 1 ; Read from file grid_cs32.face001.bin
677     (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
678     (PID.TID 0000.0001) tile: 2 ; Read from file grid_cs32.face002.bin
679     (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
680     (PID.TID 0000.0001) tile: 3 ; Read from file grid_cs32.face003.bin
681     (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
682     (PID.TID 0000.0001) tile: 4 ; Read from file grid_cs32.face004.bin
683     (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
684     (PID.TID 0000.0001) tile: 5 ; Read from file grid_cs32.face005.bin
685     (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
686     (PID.TID 0000.0001) tile: 6 ; Read from file grid_cs32.face006.bin
687     (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
688 jmc 1.1 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
689     (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
690     (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
691     (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
692     (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
693     (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
694     (PID.TID 0000.0001) %MON XG_mean = 1.8796250616675E+00
695     (PID.TID 0000.0001) %MON XG_sd = 1.0410625309932E+02
696     (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
697     (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
698     (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
699     (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
700     (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
701     (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
702     (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
703     (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
704     (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
705     (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
706     (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
707     (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
708     (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
709     (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
710     (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
711     (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
712     (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
713     (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
714     (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
715     (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
716     (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
717     (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
718     (PID.TID 0000.0001) %MON YG_mean = -1.2094344438470E-15
719     (PID.TID 0000.0001) %MON YG_sd = 3.9086186579984E+01
720     (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
721     (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
722     (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
723     (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
724     (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
725     (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
726     (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
727     (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
728     (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
729     (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
730     (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
731     (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
732     (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
733     (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
734     (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
735     (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
736     (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
737     (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
738     (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
739     (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
740     (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
741     (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
742     (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
743     (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
744     (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
745     (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
746     (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
747     (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
748     (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
749     (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
750     (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
751     (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
752 jmc 1.2 (PID.TID 0000.0001) %MON AngleCS_max = 9.9999994756719E-01
753     (PID.TID 0000.0001) %MON AngleCS_min = -9.9968286884824E-01
754     (PID.TID 0000.0001) %MON AngleCS_mean = 3.3078850405987E-01
755     (PID.TID 0000.0001) %MON AngleCS_sd = 6.2496317138039E-01
756     (PID.TID 0000.0001) %MON AngleSN_max = 9.9968286884824E-01
757     (PID.TID 0000.0001) %MON AngleSN_min = -9.9999994756719E-01
758     (PID.TID 0000.0001) %MON AngleSN_mean = -3.3078850405987E-01
759     (PID.TID 0000.0001) %MON AngleSN_sd = 6.2496317138039E-01
760 jmc 1.1 (PID.TID 0000.0001) MDSREADFIELD: opening global file: bathy_Hmin50.bin
761     (PID.TID 0000.0001) // =======================================================
762     (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc) at iteration 1
763     (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
764     (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
765     (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
766     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
767     (PID.TID 0000.0001) // 0.0: .
768     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
769     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
770     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
771     (PID.TID 0000.0001) // =======================================================
772     (PID.TID 0000.0001) K = 1
773     (PID.TID 0000.0001) // I=7 I=17 I=27 I=31 I=41 I=51 I=61 I=65 I=75 I=85 I=95 I=99 I=109 I=119 I=129 I=133 I=143 I=153 I=163 I=167 I=177 I=187
774 jmc 1.2 (PID.TID 0000.0001) // |--J--|210123456|890123456|890123456|890123450|234567890|234567890|234567890|234567234|678901234|678901234|678901234|678945678|012345678|012345678|012345678|016789012|456789012|456789012|456789012|890123456|890123456|890123456|89012345
775 jmc 1.1 (PID.TID 0000.0001) // 35 cac--cbbeefjkfefw+..........zpu......................................kqnzrqq-b-da----bbbbfu..............fdddccaaddccaadcdddcbbbbcdddcccdffffghgffffddefligfiljfba---aafddehy...pwvlhfffcbagfccbagfcceeffffjlkjgaa---bfvheeln-aesaaa
776     (PID.TID 0000.0001) // 34 --ba-abcehjnldcclz+........spps.....................................vkqn+xnnabbcbba--aabfu+..............hcbaaaaacaaaaaccdccbaaabbddddccdffffghfeeeeedefiffefilhfcaaaacgceei.......zomggfcaecbfcaecbbccddefilihecbaacbaajfega-aesfee
777     (PID.TID 0000.0001) // 33 -abbbccceiomkfdbbc+.......+s........................................xsrxzz+zdcddb-----adu+...............hcbaa--acaa--accddba--bbbddddccdfffhhgfeeddccedfeddfgikhfffdfgccffw........zohhgebbaagebbaaaaaccdfhlhfefdcccaabjefbaaafooss
778     (PID.TID 0000.0001) // 32 -bddefhhkqqlgfaakqz..v.+..+.......................................++..u+....gfdba----adu+................kdcaaa-acaaa-accdcb---bbbcdddddefffggfeeedccccccbbdcdfgghhiihcbeiw.........+ynjgebaaagebaaaa-aacccfikkhecccbbbaaabaadfklnqp
779     (PID.TID 0000.0001) // 31 bbcffijnpnqneaaat..umrr+s.z.......................................+++++.ztsvifeb--dfdfu+................+lkdca--abca--abcccb---bbbbddddeffflhfeeeecbbbbaa-abbacbcdceffbbfw+..........++ujfbaaajfbaaa----aacffiljgfffcca--adfikkiihhh
780     (PID.TID 0000.0001) // 30 -adgillkkkifcadcx.ymmqzqikvnnps...................................+++++wmegtlifcacdlqx+++...............mligea---aea---abbbb---abaaddddeedkmeddefdbbbaaac---b--aaaaabaabm..............+viba--viba-------acdefinmlgiieb-chnnnmlmlgff
781     (PID.TID 0000.0001) // 29 -cfiljigfjd--efdozy...+ximpnnuz....................................+++yqddhpljhcbbchz+......++.........+mmhffc----fc----aaba------acdddcbcineddgdbaaa---dd--a------aa-bfz...............+qe---+qe---aa---aedeegknmlgiigcdfhpokkimlfd
782     (PID.TID 0000.0001) // 28 abgkhfcccea-bdei........t..........................................++zwgfcfkknhccbbhwwy.....+++........+njfeed----ed-----aa-------abddcabcnfddegcaaa----lf------------dk+................+ja--.+ja------bffdddehfd--bedaacfhpnligiih
783     (PID.TID 0000.0001) // 27 acghfbaaaa-achmy............................+++....................++vnbbbclkpkeeecflmqxy....++........+lhfeecc---ecc------------aaadcbabcfhddccba------qd-----------irw.................++e--.++e-----mhmijddda--------ahhfiokhedeg
784     (PID.TID 0000.0001) // 26 adhfca-----bfiv.............................++sy...................+tq-fdbblknqiheddefhiksz++++........zkhfdccb---ccb------------aabdcaaaacfddbca-------xfa-abb-----vvv...................+wa-..+wa---mlmkijhc----------cjjffiheb-aa
785     (PID.TID 0000.0001) // 25 achfa------ch+..................w.....w.......njo+................+x-----bcgiqqojfefiiiijmy.++.........zkhfdbaa---baa-------daa---acccaaaacccca--------a+udaabbb----tei...................++qd..++qdeqnghiljcaaaaidaa----beedeeca--b
786     (PID.TID 0000.0001) // 24 aeifa--acbcei...................w.....w.......likn+.....++.....++znpa----bbdfnlmnjhinlksssw............qhfeca-----a--------addc--aeffaaaaaaccb-a----a--b++udbbaba---ven....................++x...++xywnfgllcbbabegkecba----ddddcaacd
787     (PID.TID 0000.0001) // 23 bfida-aabchjk...................zz....zz.....nhhijz....tqq.....+ujgzgd---abccegklkkknols..xuu..........zgfdba-----a--------bcd---affaaadffabbb-----aa-bc+.+ufb-----l.gx...........s.........++....++zzkfilfccccoz..ulkcd---bccnfdddd
788     (PID.TID 0000.0001) // 22 afhfaa---bfgi....................zz..r.zz..rnjffggm...nlmn+....+sffzya--aabcaaffdfhimrmp...yuu.++.......zudba-----a--------adc---dda-adffe-aa--------aaa...+ufc-baaqvhh..........dcfeeh......+.....++zggqvifefhz......zobbaccfwuffee
789     (PID.TID 0000.0001) // 21 abcgca----abe.....................ysst..ysstlgeeeeoz..ijklt+....lfjzzf---adfdaadcehllotq....yy+++zzs.....+zcba----ba-------cdd--aaa----df------------aaa....+upjdcy.vohq.......+idcdfeeefwz...fwz....+hhn.vklox.........gdccfjwrigff
790     (PID.TID 0000.0001) // 20 bbbcgfcaa-aae+.......................l.....lcgfdddhq.+hiilnz++.+oquxyz--adgkcaabcfmtooyxz......+yuiiy....++gb-----b--------ddcca-a-----acbaa------bbaaaa.......ywxy.lulo.lv...kcdgddffefffilyxffilyx+fffk.+xyyy.........mgeimvskjkll
791     (PID.TID 0000.0001) // 19 mfeccdghfeegcbt......................a.....aafifccgnrzgghjry.+++sr+lq.--edfkxtkblwnnsp.vv......skhggt...+++t---------------bdaf---------edd-------adlaaa..........vnhzy.tllqiedccdhggfggffiiggffiiggfcbdgy..yz..........xigqophijkki
792     (PID.TID 0000.0001) // 18 .wifedfkhfegbbcivlqfoz..............ja....jaacfihggokeeffgt..++++..hhlfdeddk..qcz+.zwxtsttz..ysrkhot++++++zig-----g--------b--f---------egqqqaa----frb--........+kkrhw.vqmlnieddcdehgggffgigedfgigedbaaceiy.............zilrddefikkh
793     (PID.TID 0000.0001) // 17 .+wfeefikhgcbbccaaacgn.............ica...icaaccfihfoedddeedy..++...nnqwgfeeky.z++..+zsjjllllljllpjos+++.+zhhi-----i-----e-----ea--------foqqoqqo--hlwgea........+nk+..xiioonhfefddegihhghigfdbhigfdbaaabdgx..............nheddefiklh
794     (PID.TID 0000.0001) // 16 ...wiheddeccdfhfbabdfl............jdba..jdbaddddgifkccccdccd+.++..++ynvz.tkkmu....++zyslllllkhggkmpy++...ihhi-----i-----ea---feb-----a-acnoohfghknvmwnuc.........qhu..hhhkojgffgeefghihhiieedbiieedbaaabcdy..............ygddeghiljg
795     (PID.TID 0000.0001) // 15 .....ylea--acfihebcbbes..........sfcbb.sfcbbngfffigcaaabdbcac+.+++++zgmpx...mm....++..zslwz.yhhhhnz+++...rhgc----ac----ab----ige----acaaalllkddfiy..yswx.........thk.xgghiligfghfefhhhhiiheedciheedcdbbabdmz.............zfdeghikkif
796     (PID.TID 0000.0001) // 14 .......c---acgkhdcc--di..........ofddc.ofddchohffikaaaaabaaa-aw+.+ysnggox++.qrv..........yzzzzrjil+++....qhgd-----d-----a-----i---cccdeabkklldinqssy..xx..........+y.uhghikihgfghefgihhhgeeeeegeeeeeddbaadhw.............nedeghjjhfe
797     (PID.TID 0000.0001) // 13 ......+b----cfkhec---afz.........nhfdf.nhfdffholghkaaaaaba-a---flkkuswyy++++zr...........zzzzz++ry++......yd--------------------aeecdeidfkkqnqlmqquukqqm.............iihiijjhfefgefhjihiffgggfffgggffecaabelx...........zjecehijhfec
798     (PID.TID 0000.0001) // 12 ......ec----chjhec---ag..........skiqd.skiqddeiiiifaaabae--a---dd--iu+++.+++q++..........+z+++++.+++....++.s------------------a-ceccdejhlllkqlkklssiccde............wjkkkjjjigeefffgjiiighiiihghiiihhhdaabdffghtxx......mfccehjiffdb
799     (PID.TID 0000.0001) // 11 .....pdca--achlheba--ai..........nkn.f.nkn.fdemijidaaaabi-------a--q+....++.is...........+++++..........+yyza----ba----b-----a--ccccddkhieekkossssfbbbbc...........njjijhhihijhgggggjjjjijkkkkijkkkkjjhcaacddeegpy.....xfdccdhjgfdda
800     (PID.TID 0000.0001) // 10 .....wfdb--achlhea---an.........uos..duos..dcemikkfdcaabi-------equ+........k...........................zyvuq----cq----cc----a---dcfhkopqjeissrnpfbbcccd.........zslihhigghgijjihhhhkllkkkkkkjkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddca
801     (PID.TID 0000.0001) // 9 .....vgec---bfikca--cjl+.......+nnv.+cnnv.+ccffhkkiddaadha-----as++.........vz++........................zxuuk-----k------a---a----djmqrrnlllsoiddcccccdj........+zjijhfgfggffhjkkkiillljihhghgihhghgihighdeeffgghimnnjgecbbcdgfeccba
802     (PID.TID 0000.0001) // 8 ....zleca---afjfca--hdfz.......vkky.jckky.jceddefijffdddhb--a-afv...........n..ss.........................+yku----ku--------------ejnpqqnninnritqdccchkm.......wihgghgeffffeefhijkjkljiigeeffegeeffefffhjhhikkklljklmhffeeeggfdcbaay
803     (PID.TID 0000.0001) // 7 ..+zohec--abcfkhecbchbdx.......qiht.faiht.faaaabdgijgfededcdcb-f+...........n...pz.........................+zu----zu--------------edefqgqddsz+......+yudm+....tiggfggfeeeefeeefiiiijkiihheddddheddddddddjjllliijhfkmmkkjjhijgdcba--q
804     (PID.TID 0000.0001) // 6 .+yomfddcaabefkifdchaadt......uqdeisc-deisc----dfefgifffkklldc--v...........p...pp.........................v.x----.x---------a----fbbpqgzenx+........zdbllkhhfffffffgfeeeeeeeefhhhhijihhffddcbffddcbbbbdhhiihedddb-cfhhhjjjieca----+
805     (PID.TID 0000.0001) // 5 .+nhgffkghccfhkhffgdaackz....uoibcimlabcimlaaacfbddfjjhijeehf-a-c...........s...su.........................qk.yi--k.yi-------gha-fjddqs+xkrz.........q-bikdccdeeeeeeedddedddddgghhhhjhhgffcbbaffcbbaaaaddfegecca----dfeefhfgdb-----+
806     (PID.TID 0000.0001) // 4 +ujhgfllfhdffhkfffca-aady...llnabdopfcbdopfcbdgdbcdehlihgfddc--ms..........................................okn.zd-kn.zd---eciiiicfkeeqy.ysz..........n-agdcbbdeddedcdcccdddcddffggghiggfffdbaaffdbaa---acdcccba--abvfedeffdcca----b+
807     (PID.TID 0000.0001) // 3 vjggfcceeffffjlkjgaa---bfvheeln-aesphfaesphfdhgabddeflihhgfecbaaayq+++++...................................kqnz.vtqnz.vtpkllgdccfkkkkk..++..........+g--ecaaadcdddcbbbbcdddcccdffffghgffffdcaaffdcaa----abcaaaa-acxxmecdjmdbba----r+
808     (PID.TID 0000.0001) // 2 ifeecbbccddefilihecbaacbaajfega-aesqhfaesqhffiea-cdeflkkljifeddcba---bry+.................................vkqn+.sgqn+.sghfcbcbbbdgfdek.++++.........+l--aaaaaccdccbaaabbddddccdffffghfeeeeecbaeeecba------baaaa-euwxqdbcdkud-----sy+
809     (PID.TID 0000.0001) // 1 bbbbaaaaaccdfhlhfefdcccaabjefbaaafonhgafonhglid--adfgkkkklkhffddca-----s++++..............................xsrxz.terxz.tedcbbbbaaadddet.++++.........+l----a-accddba--bbbddddccdfffhhgfeeddccbaddccba-------aaaabgns.qcbcchyzqngll++.
810     (PID.TID 0000.0001) // 0 aaaaaaa-aacccfikkhecccbbbaaabaadfkllilfkllilmgebaadfijjiiikjhffdcba-----lllg............................++..u+..zmu+..zmdfbd---a-aeef.xx+..........+++s-----accdcb---bbbcdddddefffggfeeedcccbbdcccbba----aa--alrwwy.kcbccc+...++++..
811     (PID.TID 0000.0001) // -1 -aaaaa----aacffiljgfffcca--adfikkiikimkiikimiiheccfurkiffhijjigfecb-----l---............................+++++.z+.w+.z+.wqgbf-------dgzpoy+........+ys+yr-aa-abcccb---bbbbddddeffflhfeeeecbbcbbcbbcbbaa----a--bdflm.yuibbcc.......+..
812     (PID.TID 0000.0001) // -2 -aaa-------acdefinmlgiieb-chnnnmlmlfkllmlfklklkhednwwsheeghhijjgfdca----g---............................+++++wmu+++wmu++ywn--------fwvmgy+........+r-.++abc--abbbb---abaaddddeedkmeddefdbbbdcbbbbdcbaa-------ba-hv.susfbcc.......+..
813     (PID.TID 0000.0001) // =======================================================
814     (PID.TID 0000.0001) // END OF FIELD =
815     (PID.TID 0000.0001) // =======================================================
816     (PID.TID 0000.0001)
817     (PID.TID 0000.0001) // =======================================================
818     (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc) at iteration 1
819     (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
820     (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
821     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
822     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
823     (PID.TID 0000.0001) // 0.0: .
824     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
825     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
826     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
827     (PID.TID 0000.0001) // =======================================================
828     (PID.TID 0000.0001) // =======================================================
829     (PID.TID 0000.0001) // END OF FIELD =
830     (PID.TID 0000.0001) // =======================================================
831     (PID.TID 0000.0001)
832     (PID.TID 0000.0001) // =======================================================
833     (PID.TID 0000.0001) // Field hFacC at iteration 1
834     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
835     (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
836     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
837     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
838     (PID.TID 0000.0001) // 0.0: .
839     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
840     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
841     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
842     (PID.TID 0000.0001) // =======================================================
843     (PID.TID 0000.0001) // =======================================================
844     (PID.TID 0000.0001) // END OF FIELD =
845     (PID.TID 0000.0001) // =======================================================
846     (PID.TID 0000.0001)
847     (PID.TID 0000.0001) // =======================================================
848     (PID.TID 0000.0001) // Field hFacW at iteration 1
849     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
850     (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
851     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
852     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
853     (PID.TID 0000.0001) // 0.0: .
854     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
855     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
856     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
857     (PID.TID 0000.0001) // =======================================================
858     (PID.TID 0000.0001) // =======================================================
859     (PID.TID 0000.0001) // END OF FIELD =
860     (PID.TID 0000.0001) // =======================================================
861     (PID.TID 0000.0001)
862     (PID.TID 0000.0001) // =======================================================
863     (PID.TID 0000.0001) // Field hFacS at iteration 1
864     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
865     (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
866     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
867     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
868     (PID.TID 0000.0001) // 0.0: .
869     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 195: 1)
870     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 35: -2: -1)
871     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
872     (PID.TID 0000.0001) // =======================================================
873     (PID.TID 0000.0001) // =======================================================
874     (PID.TID 0000.0001) // END OF FIELD =
875     (PID.TID 0000.0001) // =======================================================
876     (PID.TID 0000.0001)
877     (PID.TID 0000.0001)
878     (PID.TID 0000.0001) // ===================================
879     (PID.TID 0000.0001) // GAD parameters :
880     (PID.TID 0000.0001) // ===================================
881     (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
882     (PID.TID 0000.0001) 2
883     (PID.TID 0000.0001) ;
884     (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
885     (PID.TID 0000.0001) 2
886     (PID.TID 0000.0001) ;
887     (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
888     (PID.TID 0000.0001) F
889     (PID.TID 0000.0001) ;
890     (PID.TID 0000.0001) AdamsBashforthGt = /* apply Adams-Bashforth extrapolation on Gt */
891     (PID.TID 0000.0001) T
892     (PID.TID 0000.0001) ;
893     (PID.TID 0000.0001) AdamsBashforth_T = /* apply Adams-Bashforth extrapolation on Temp */
894     (PID.TID 0000.0001) F
895     (PID.TID 0000.0001) ;
896     (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
897     (PID.TID 0000.0001) 2
898     (PID.TID 0000.0001) ;
899     (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
900     (PID.TID 0000.0001) 2
901     (PID.TID 0000.0001) ;
902     (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
903     (PID.TID 0000.0001) F
904     (PID.TID 0000.0001) ;
905     (PID.TID 0000.0001) AdamsBashforthGs = /* apply Adams-Bashforth extrapolation on Gs */
906     (PID.TID 0000.0001) T
907     (PID.TID 0000.0001) ;
908     (PID.TID 0000.0001) AdamsBashforth_S = /* apply Adams-Bashforth extrapolation on Salt */
909     (PID.TID 0000.0001) F
910     (PID.TID 0000.0001) ;
911     (PID.TID 0000.0001) // ===================================
912 jmc 1.2 (PID.TID 0000.0001) ------------------------------------------------------------
913     (PID.TID 0000.0001) DIAGNOSTICS_SET_LEVELS: done
914     (PID.TID 0000.0001) Total Nb of available Diagnostics: ndiagt= 198
915     (PID.TID 0000.0001) write list of available Diagnostics to file: available_diagnostics.log
916     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 23 ETAN
917     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 24 ETANSQ
918     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 25 DETADT2
919     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 67 PHIBOT
920     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 68 PHIBOTSQ
921     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 71 oceTAUX
922     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 72 oceTAUY
923     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 84 TFLUX
924     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 85 SFLUX
925     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 79 oceFreez
926     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 80 TRELAX
927     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 81 SRELAX
928     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 30 UVEL
929     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 31 VVEL
930     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 32 WVEL
931     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 65 PHIHYD
932     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 44 VVELMASS
933     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 43 UVELMASS
934     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 38 WVELSQ
935     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 26 THETA
936     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 46 UTHMASS
937     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 47 VTHMASS
938     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 48 WTHMASS
939     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 27 SALT
940     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 49 USLTMASS
941     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 50 VSLTMASS
942     (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 51 WSLTMASS
943     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 181 SI_Fract
944     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 182 SI_Thick
945     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
946     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 183 SI_SnowH
947     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
948     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 184 SI_Tsrf
949     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
950     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 185 SI_Tice1
951     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
952     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 186 SI_Tice2
953     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
954     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 187 SI_Qice1
955     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
956     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 188 SI_Qice2
957     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
958     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 190 SIsnwAge
959     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 191 SIsnwPrc
960     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
961     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 189 SIalbedo
962     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
963     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 194 SIflx2oc
964     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 195 SIfrw2oc
965     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 196 SIsaltFx
966     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 192 SIflxAtm
967     (PID.TID 0000.0001) SETDIAG: Allocate 1 x 12 Levels for Diagnostic # 193 SIfrwAtm
968     (PID.TID 0000.0001) space allocated for all diagnostics: 429 levels
969     (PID.TID 0000.0001) set mate pointer for diag # 30 UVEL , Parms: UU 031MR
970     (PID.TID 0000.0001) set mate pointer for diag # 31 VVEL , Parms: VV 030MR
971     (PID.TID 0000.0001) set mate pointer for diag # 44 VVELMASS , Parms: VV 043MR
972     (PID.TID 0000.0001) set mate pointer for diag # 43 UVELMASS , Parms: UU 044MR
973     (PID.TID 0000.0001) set mate pointer for diag # 46 UTHMASS , Parms: UU 047MR
974     (PID.TID 0000.0001) set mate pointer for diag # 47 VTHMASS , Parms: VV 046MR
975     (PID.TID 0000.0001) set mate pointer for diag # 49 USLTMASS , Parms: UU 050MR
976     (PID.TID 0000.0001) set mate pointer for diag # 50 VSLTMASS , Parms: VV 049MR
977     (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: Set levels for Outp.Stream: dynDiag
978     (PID.TID 0000.0001) Levels: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15.
979     (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: Set levels for Outp.Stream: thSIceDiag
980     (PID.TID 0000.0001) Levels: 1.
981     (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: done
982     (PID.TID 0000.0001) ------------------------------------------------------------
983     DIAGSTATS_SET_REGIONS: start reading region-mask file: regMask_lat24.bin
984     DIAGSTATS_SET_REGIONS: reading set k= 1
985     (PID.TID 0000.0001) MDSREADFIELD: opening global file: regMask_lat24.bin
986     DIAGSTATS_SET_REGIONS: set k= 1 <= done
987     (PID.TID 0000.0001) DIAGSTATS_SET_REGIONS: define 3 regions: 1 2 3
988     (PID.TID 0000.0001) ------------------------------------------------------------
989     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 23 ETAN
990     (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 30 UVEL
991     (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 31 VVEL
992     (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 32 WVEL
993     (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 26 THETA
994     (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 27 SALT
995     (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 70 CONVADJ
996     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 25 DETADT2
997     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 181 SI_Fract
998     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 182 SI_Thick
999     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1000     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 183 SI_SnowH
1001     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1002     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 184 SI_Tsrf
1003     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1004     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 185 SI_Tice1
1005     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1006     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 186 SI_Tice2
1007     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1008     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 187 SI_Qice1
1009     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
1010     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 188 SI_Qice2
1011     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 182 SI_Thick has already been set
1012     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 191 SIsnwPrc
1013     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1014     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 189 SIalbedo
1015     (PID.TID 0000.0001) - NOTE - SETDIAG: Counter Diagnostic # 181 SI_Fract has already been set
1016     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 190 SIsnwAge
1017     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 194 SIflx2oc
1018     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 195 SIfrw2oc
1019     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 196 SIsaltFx
1020     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 192 SIflxAtm
1021     (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 193 SIfrwAtm
1022     (PID.TID 0000.0001) space allocated for all stats-diags: 108 levels
1023     (PID.TID 0000.0001) DIAGSTATS_SET_POINTERS: done
1024     (PID.TID 0000.0001) ------------------------------------------------------------
1025     (PID.TID 0000.0001) DIAGSTATS_INI_IO: open file: dynStDiag.0000036000.txt , unit= 9
1026     (PID.TID 0000.0001) DIAGSTATS_INI_IO: open file: thSIceStDiag.0000036000.txt , unit= 10
1027 jmc 1.1 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
1028     (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
1029     (PID.TID 0000.0001) F
1030     (PID.TID 0000.0001) ;
1031     (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
1032     (PID.TID 0000.0001) F
1033     (PID.TID 0000.0001) ;
1034     (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
1035     (PID.TID 0000.0001) F
1036     (PID.TID 0000.0001) ;
1037     (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity ( m^2/s ) */
1038     (PID.TID 0000.0001) 8.000000000000000E+02
1039     (PID.TID 0000.0001) ;
1040     (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity ( m^2/s ) */
1041     (PID.TID 0000.0001) 8.000000000000000E+02
1042     (PID.TID 0000.0001) ;
1043     (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity ( m^2/s ) */
1044     (PID.TID 0000.0001) 0.000000000000000E+00
1045     (PID.TID 0000.0001) ;
1046     (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. ( ) */
1047     (PID.TID 0000.0001) 0.000000000000000E+00
1048     (PID.TID 0000.0001) ;
1049     (PID.TID 0000.0001) Tapering/Cliping : gkw91
1050     (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
1051     (PID.TID 0000.0001) 1.000000000000000E-12
1052     (PID.TID 0000.0001) ;
1053     (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
1054     (PID.TID 0000.0001) 1.000000000000000E+48
1055     (PID.TID 0000.0001) ;
1056     (PID.TID 0000.0001) %MON fCori_max = 1.4535016908525E-04
1057     (PID.TID 0000.0001) %MON fCori_min = -1.4535016908525E-04
1058     (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
1059     (PID.TID 0000.0001) %MON fCori_sd = 8.3972192788621E-05
1060     (PID.TID 0000.0001) %MON fCoriG_max = 1.4544410433286E-04
1061     (PID.TID 0000.0001) %MON fCoriG_min = -1.4544410433286E-04
1062     (PID.TID 0000.0001) %MON fCoriG_mean = 0.0000000000000E+00
1063     (PID.TID 0000.0001) %MON fCoriG_sd = 8.4860812167727E-05
1064     (PID.TID 0000.0001) %MON fCoriCos_max = 1.4540341538469E-04
1065     (PID.TID 0000.0001) %MON fCoriCos_min = 5.2264550201501E-06
1066     (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1482595466044E-04
1067     (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0292878037194E-05
1068     (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
1069     (PID.TID 0000.0001) INI_CG2D: cg2dTolerance = 5.809016360175293E-07 (Area=3.6388673751E+14)
1070     (PID.TID 0000.0001)
1071     (PID.TID 0000.0001) CONFIG_CHECK: OK
1072     (PID.TID 0000.0001) // =======================================================
1073     (PID.TID 0000.0001) // Model configuration
1074     (PID.TID 0000.0001) // =======================================================
1075     (PID.TID 0000.0001) //
1076     (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
1077     (PID.TID 0000.0001) //
1078     (PID.TID 0000.0001) buoyancyRelation = OCEANIC
1079     (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
1080     (PID.TID 0000.0001) F
1081     (PID.TID 0000.0001) ;
1082 jmc 1.2 (PID.TID 0000.0001) fluidIsWater= /* fluid major constituent is Water */
1083 jmc 1.1 (PID.TID 0000.0001) T
1084     (PID.TID 0000.0001) ;
1085     (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
1086     (PID.TID 0000.0001) F
1087     (PID.TID 0000.0001) ;
1088     (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
1089     (PID.TID 0000.0001) T
1090     (PID.TID 0000.0001) ;
1091     (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or K ) */
1092     (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
1093     (PID.TID 0000.0001) ;
1094     (PID.TID 0000.0001) sRef = /* Reference salinity profile ( psu ) */
1095     (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
1096     (PID.TID 0000.0001) ;
1097     (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
1098     (PID.TID 0000.0001) 3.000000000000000E+05
1099     (PID.TID 0000.0001) ;
1100     (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
1101     (PID.TID 0000.0001) 1.000000000000000E+21
1102     (PID.TID 0000.0001) ;
1103     (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
1104     (PID.TID 0000.0001) 0.000000000000000E+00
1105     (PID.TID 0000.0001) ;
1106     (PID.TID 0000.0001) useFullLeith = /* Use Full Form of Leith Viscosity on/off flag*/
1107     (PID.TID 0000.0001) F
1108     (PID.TID 0000.0001) ;
1109     (PID.TID 0000.0001) useStrainTensionVisc = /* Use StrainTension Form of Viscous Operator on/off flag*/
1110     (PID.TID 0000.0001) F
1111     (PID.TID 0000.0001) ;
1112     (PID.TID 0000.0001) useAreaViscLength = /* Use area for visc length instead of geom. mean*/
1113     (PID.TID 0000.0001) F
1114     (PID.TID 0000.0001) ;
1115     (PID.TID 0000.0001) viscC2leith = /* Leith harmonic visc. factor (on grad(vort),non-dim.) */
1116     (PID.TID 0000.0001) 0.000000000000000E+00
1117     (PID.TID 0000.0001) ;
1118     (PID.TID 0000.0001) viscC2leithD = /* Leith harmonic viscosity factor (on grad(div),non-dim.) */
1119     (PID.TID 0000.0001) 0.000000000000000E+00
1120     (PID.TID 0000.0001) ;
1121     (PID.TID 0000.0001) viscC2smag = /* Smagorinsky harmonic viscosity factor (non-dim.) */
1122     (PID.TID 0000.0001) 0.000000000000000E+00
1123     (PID.TID 0000.0001) ;
1124     (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
1125     (PID.TID 0000.0001) 0.000000000000000E+00
1126     (PID.TID 0000.0001) ;
1127     (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
1128     (PID.TID 0000.0001) 1.000000000000000E+21
1129     (PID.TID 0000.0001) ;
1130     (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
1131     (PID.TID 0000.0001) 0.000000000000000E+00
1132     (PID.TID 0000.0001) ;
1133     (PID.TID 0000.0001) viscC4leith = /* Leith biharm viscosity factor (on grad(vort), non-dim.) */
1134     (PID.TID 0000.0001) 0.000000000000000E+00
1135     (PID.TID 0000.0001) ;
1136     (PID.TID 0000.0001) viscC4leithD = /* Leith biharm viscosity factor (on grad(div), non-dim.) */
1137     (PID.TID 0000.0001) 0.000000000000000E+00
1138     (PID.TID 0000.0001) ;
1139     (PID.TID 0000.0001) viscC4Smag = /* Smagorinsky biharm viscosity factor (non-dim) */
1140     (PID.TID 0000.0001) 0.000000000000000E+00
1141     (PID.TID 0000.0001) ;
1142     (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
1143     (PID.TID 0000.0001) T
1144     (PID.TID 0000.0001) ;
1145     (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
1146     (PID.TID 0000.0001) 2.000000000000000E+00
1147     (PID.TID 0000.0001) ;
1148     (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
1149     (PID.TID 0000.0001) 1.000000000000000E-03
1150     (PID.TID 0000.0001) ;
1151     (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
1152     (PID.TID 0000.0001) T
1153     (PID.TID 0000.0001) ;
1154     (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( 1/s ) */
1155     (PID.TID 0000.0001) 0.000000000000000E+00
1156     (PID.TID 0000.0001) ;
1157     (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coeff. ( 1/m ) */
1158     (PID.TID 0000.0001) 0.000000000000000E+00
1159     (PID.TID 0000.0001) ;
1160     (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
1161     (PID.TID 0000.0001) 0.000000000000000E+00
1162     (PID.TID 0000.0001) ;
1163     (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
1164     (PID.TID 0000.0001) 0.000000000000000E+00
1165     (PID.TID 0000.0001) ;
1166     (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
1167     (PID.TID 0000.0001) 0.000000000000000E+00
1168     (PID.TID 0000.0001) ;
1169     (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
1170     (PID.TID 0000.0001) 0.000000000000000E+00
1171     (PID.TID 0000.0001) ;
1172     (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
1173     (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
1174     (PID.TID 0000.0001) ;
1175     (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
1176     (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
1177     (PID.TID 0000.0001) ;
1178     (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 1979 ( m^2/s ) */
1179     (PID.TID 0000.0001) 0.000000000000000E+00
1180     (PID.TID 0000.0001) ;
1181     (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
1182     (PID.TID 0000.0001) 0.000000000000000E+00
1183     (PID.TID 0000.0001) ;
1184     (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
1185     (PID.TID 0000.0001) 2.000000000000000E+02
1186     (PID.TID 0000.0001) ;
1187     (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
1188     (PID.TID 0000.0001) -2.000000000000000E+03
1189     (PID.TID 0000.0001) ;
1190     (PID.TID 0000.0001) Equation of State : eosType = JMD95Z ;
1191     (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/oC ) */
1192     (PID.TID 0000.0001) 1.234567000000000E+05
1193     (PID.TID 0000.0001) ;
1194     (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/psu ) */
1195     (PID.TID 0000.0001) 1.234567000000000E+05
1196     (PID.TID 0000.0001) ;
1197     (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
1198     (PID.TID 0000.0001) 1.035000000000000E+03
1199     (PID.TID 0000.0001) ;
1200     (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
1201     (PID.TID 0000.0001) 1.035000000000000E+03
1202     (PID.TID 0000.0001) ;
1203 jmc 1.2 (PID.TID 0000.0001) rhoFacC = /* normalized Reference density @ cell-Center (-) */
1204     (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1205     (PID.TID 0000.0001) ;
1206     (PID.TID 0000.0001) rhoFacF = /* normalized Reference density @ W-Interface (-) */
1207     (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1208     (PID.TID 0000.0001) ;
1209 jmc 1.1 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
1210     (PID.TID 0000.0001) 1.000000000000000E+03
1211     (PID.TID 0000.0001) ;
1212     (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
1213     (PID.TID 0000.0001) 9.810000000000000E+00
1214     (PID.TID 0000.0001) ;
1215     (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
1216     (PID.TID 0000.0001) 9.810000000000000E+00
1217     (PID.TID 0000.0001) ;
1218     (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
1219     (PID.TID 0000.0001) 8.640000000000000E+04
1220     (PID.TID 0000.0001) ;
1221     (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
1222     (PID.TID 0000.0001) 7.272205216643040E-05
1223     (PID.TID 0000.0001) ;
1224     (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
1225     (PID.TID 0000.0001) 1.000000000000000E-04
1226     (PID.TID 0000.0001) ;
1227     (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
1228     (PID.TID 0000.0001) 9.999999999999999E-12
1229     (PID.TID 0000.0001) ;
1230     (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
1231     (PID.TID 0000.0001) 1.000000000000000E+00
1232     (PID.TID 0000.0001) ;
1233     (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
1234     (PID.TID 0000.0001) T
1235     (PID.TID 0000.0001) ;
1236     (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
1237     (PID.TID 0000.0001) F
1238     (PID.TID 0000.0001) ;
1239     (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
1240     (PID.TID 0000.0001) 1.000000000000000E+00
1241     (PID.TID 0000.0001) ;
1242     (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
1243     (PID.TID 0000.0001) 1.000000000000000E+00
1244     (PID.TID 0000.0001) ;
1245     (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
1246     (PID.TID 0000.0001) T
1247     (PID.TID 0000.0001) ;
1248     (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
1249     (PID.TID 0000.0001) T
1250     (PID.TID 0000.0001) ;
1251     (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
1252     (PID.TID 0000.0001) 4
1253     (PID.TID 0000.0001) ;
1254     (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
1255     (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
1256     (PID.TID 0000.0001) 2.000000000000000E-01
1257     (PID.TID 0000.0001) ;
1258     (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
1259     (PID.TID 0000.0001) 2.000000000000000E+00
1260     (PID.TID 0000.0001) ;
1261     (PID.TID 0000.0001) select_rStar = /* r* Coordinate options (not yet implemented)*/
1262     (PID.TID 0000.0001) 2
1263     (PID.TID 0000.0001) ;
1264     (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
1265     (PID.TID 0000.0001) T
1266     (PID.TID 0000.0001) ;
1267     (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
1268     (PID.TID 0000.0001) 1.234567000000000E+05
1269     (PID.TID 0000.0001) ;
1270     (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(ppt)*/
1271     (PID.TID 0000.0001) 0.000000000000000E+00
1272     (PID.TID 0000.0001) ;
1273     (PID.TID 0000.0001) use3Dsolver = /* use 3-D pressure solver on/off flag */
1274     (PID.TID 0000.0001) F
1275     (PID.TID 0000.0001) ;
1276     (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
1277     (PID.TID 0000.0001) F
1278     (PID.TID 0000.0001) ;
1279     (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
1280     (PID.TID 0000.0001) 1.000000000000000E+00
1281     (PID.TID 0000.0001) ;
1282     (PID.TID 0000.0001) quasiHydrostatic = /* Quasi-Hydrostatic on/off flag */
1283     (PID.TID 0000.0001) F
1284     (PID.TID 0000.0001) ;
1285     (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
1286     (PID.TID 0000.0001) T
1287     (PID.TID 0000.0001) ;
1288     (PID.TID 0000.0001) vectorInvariantMomentum= /* Vector-Invariant Momentum on/off */
1289     (PID.TID 0000.0001) T
1290     (PID.TID 0000.0001) ;
1291     (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
1292     (PID.TID 0000.0001) T
1293     (PID.TID 0000.0001) ;
1294     (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
1295     (PID.TID 0000.0001) T
1296     (PID.TID 0000.0001) ;
1297     (PID.TID 0000.0001) momImplVertAdv =/* Momentum implicit vert. advection on/off*/
1298     (PID.TID 0000.0001) F
1299     (PID.TID 0000.0001) ;
1300     (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
1301     (PID.TID 0000.0001) F
1302     (PID.TID 0000.0001) ;
1303     (PID.TID 0000.0001) metricTerms = /* metric-Terms on/off flag */
1304     (PID.TID 0000.0001) F
1305     (PID.TID 0000.0001) ;
1306     (PID.TID 0000.0001) useNHMTerms = /* Non-Hydrostatic Metric-Terms on/off */
1307     (PID.TID 0000.0001) F
1308     (PID.TID 0000.0001) ;
1309 jmc 1.2 (PID.TID 0000.0001) useConstantF = /* use Constant f0 Coriolis flag */
1310     (PID.TID 0000.0001) F
1311     (PID.TID 0000.0001) ;
1312     (PID.TID 0000.0001) useBetaPlaneF = /* use Beta-Plane Coriolis flag */
1313     (PID.TID 0000.0001) F
1314     (PID.TID 0000.0001) ;
1315     (PID.TID 0000.0001) useSphereF = /* use Spherical Coriolis flag */
1316     (PID.TID 0000.0001) T
1317     (PID.TID 0000.0001) ;
1318     (PID.TID 0000.0001) use3dCoriolis = /* 3-D Coriolis on/off flag */
1319     (PID.TID 0000.0001) F
1320     (PID.TID 0000.0001) ;
1321 jmc 1.1 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
1322     (PID.TID 0000.0001) T
1323     (PID.TID 0000.0001) ;
1324     (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
1325     (PID.TID 0000.0001) F
1326     (PID.TID 0000.0001) ;
1327     (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
1328     (PID.TID 0000.0001) F
1329     (PID.TID 0000.0001) ;
1330     (PID.TID 0000.0001) useJamartMomAdv= /* V.I. Non-linear terms Jamart flag */
1331     (PID.TID 0000.0001) F
1332     (PID.TID 0000.0001) ;
1333     (PID.TID 0000.0001) SadournyCoriolis= /* Sadourny Coriolis discr. flag */
1334     (PID.TID 0000.0001) F
1335     (PID.TID 0000.0001) ;
1336     (PID.TID 0000.0001) upwindVorticity= /* Upwind bias vorticity flag */
1337     (PID.TID 0000.0001) F
1338     (PID.TID 0000.0001) ;
1339     (PID.TID 0000.0001) useAbsVorticity= /* Work with f+zeta in Coriolis */
1340     (PID.TID 0000.0001) F
1341     (PID.TID 0000.0001) ;
1342     (PID.TID 0000.0001) highOrderVorticity= /* High order interp. of vort. flag */
1343     (PID.TID 0000.0001) F
1344     (PID.TID 0000.0001) ;
1345     (PID.TID 0000.0001) upwindShear= /* Upwind vertical Shear advection flag */
1346     (PID.TID 0000.0001) F
1347     (PID.TID 0000.0001) ;
1348     (PID.TID 0000.0001) selectKEscheme= /* Kinetic Energy scheme selector */
1349     (PID.TID 0000.0001) 0
1350     (PID.TID 0000.0001) ;
1351     (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
1352     (PID.TID 0000.0001) T
1353     (PID.TID 0000.0001) ;
1354     (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
1355     (PID.TID 0000.0001) T
1356     (PID.TID 0000.0001) ;
1357     (PID.TID 0000.0001) implicitIntGravWave= /* Implicit Internal Gravity Wave flag */
1358     (PID.TID 0000.0001) F
1359     (PID.TID 0000.0001) ;
1360     (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
1361     (PID.TID 0000.0001) T
1362     (PID.TID 0000.0001) ;
1363     (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
1364     (PID.TID 0000.0001) T
1365     (PID.TID 0000.0001) ;
1366     (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
1367     (PID.TID 0000.0001) F
1368     (PID.TID 0000.0001) ;
1369     (PID.TID 0000.0001) implicitDiffusion =/* Implicit Diffusion on/off flag */
1370     (PID.TID 0000.0001) T
1371     (PID.TID 0000.0001) ;
1372     (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
1373     (PID.TID 0000.0001) T
1374     (PID.TID 0000.0001) ;
1375     (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
1376     (PID.TID 0000.0001) T
1377     (PID.TID 0000.0001) ;
1378     (PID.TID 0000.0001) tempImplVertAdv =/* Temp. implicit vert. advection on/off */
1379     (PID.TID 0000.0001) F
1380     (PID.TID 0000.0001) ;
1381     (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
1382     (PID.TID 0000.0001) T
1383     (PID.TID 0000.0001) ;
1384     (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
1385     (PID.TID 0000.0001) T
1386     (PID.TID 0000.0001) ;
1387     (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
1388     (PID.TID 0000.0001) T
1389     (PID.TID 0000.0001) ;
1390     (PID.TID 0000.0001) saltImplVertAdv =/* Sali. implicit vert. advection on/off */
1391     (PID.TID 0000.0001) F
1392     (PID.TID 0000.0001) ;
1393     (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
1394     (PID.TID 0000.0001) T
1395     (PID.TID 0000.0001) ;
1396     (PID.TID 0000.0001) readBinaryPrec = /* Precision used for reading binary files */
1397     (PID.TID 0000.0001) 64
1398     (PID.TID 0000.0001) ;
1399     (PID.TID 0000.0001) writeBinaryPrec = /* Precision used for writing binary files */
1400     (PID.TID 0000.0001) 32
1401     (PID.TID 0000.0001) ;
1402     (PID.TID 0000.0001) globalFiles = /* write "global" (=not per tile) files */
1403     (PID.TID 0000.0001) F
1404     (PID.TID 0000.0001) ;
1405     (PID.TID 0000.0001) useSingleCpuIO = /* only master MPI process does I/O */
1406     (PID.TID 0000.0001) F
1407     (PID.TID 0000.0001) ;
1408     (PID.TID 0000.0001) debugMode = /* Debug Mode on/off flag */
1409     (PID.TID 0000.0001) F
1410     (PID.TID 0000.0001) ;
1411     (PID.TID 0000.0001) debLevA = /* 1rst level of debugging */
1412     (PID.TID 0000.0001) 1
1413     (PID.TID 0000.0001) ;
1414     (PID.TID 0000.0001) debLevB = /* 2nd level of debugging */
1415     (PID.TID 0000.0001) 2
1416     (PID.TID 0000.0001) ;
1417     (PID.TID 0000.0001) debugLevel = /* select debugging level */
1418     (PID.TID 0000.0001) 1
1419     (PID.TID 0000.0001) ;
1420     (PID.TID 0000.0001) //
1421     (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
1422     (PID.TID 0000.0001) //
1423     (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
1424     (PID.TID 0000.0001) 200
1425     (PID.TID 0000.0001) ;
1426     (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
1427     (PID.TID 0000.0001) 1
1428     (PID.TID 0000.0001) ;
1429     (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
1430     (PID.TID 0000.0001) 1.000000000000000E-07
1431     (PID.TID 0000.0001) ;
1432     (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
1433     (PID.TID 0000.0001) 1.000000000000000E-14
1434     (PID.TID 0000.0001) ;
1435     (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
1436     (PID.TID 0000.0001) 1
1437     (PID.TID 0000.0001) ;
1438     (PID.TID 0000.0001) //
1439     (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
1440     (PID.TID 0000.0001) //
1441     (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
1442     (PID.TID 0000.0001) 36000
1443     (PID.TID 0000.0001) ;
1444     (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
1445     (PID.TID 0000.0001) 20
1446     (PID.TID 0000.0001) ;
1447 jmc 1.2 (PID.TID 0000.0001) deltaTmom = /* Momentum equation timestep ( s ) */
1448 jmc 1.1 (PID.TID 0000.0001) 1.200000000000000E+03
1449     (PID.TID 0000.0001) ;
1450     (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
1451     (PID.TID 0000.0001) 8.640000000000000E+04
1452     (PID.TID 0000.0001) ;
1453     (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
1454     (PID.TID 0000.0001) 15 @ 8.640000000000000E+04 /* K = 1: 15 */
1455     (PID.TID 0000.0001) ;
1456 jmc 1.2 (PID.TID 0000.0001) deltaTClock = /* Model clock timestep ( s ) */
1457 jmc 1.1 (PID.TID 0000.0001) 8.640000000000000E+04
1458     (PID.TID 0000.0001) ;
1459     (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1460     (PID.TID 0000.0001) 0.000000000000000E+00
1461     (PID.TID 0000.0001) ;
1462     (PID.TID 0000.0001) momForcingOutAB = /* =1: take Momentum Forcing out of Adams-Bash. stepping */
1463     (PID.TID 0000.0001) 0
1464     (PID.TID 0000.0001) ;
1465     (PID.TID 0000.0001) tracForcingOutAB = /* =1: take T,S,pTr Forcing out of Adams-Bash. stepping */
1466     (PID.TID 0000.0001) 1
1467     (PID.TID 0000.0001) ;
1468     (PID.TID 0000.0001) momDissip_In_AB = /* put Dissipation Tendency in Adams-Bash. stepping */
1469     (PID.TID 0000.0001) T
1470     (PID.TID 0000.0001) ;
1471     (PID.TID 0000.0001) doAB_onGtGs = /* apply AB on Tendencies (rather than on T,S)*/
1472     (PID.TID 0000.0001) T
1473     (PID.TID 0000.0001) ;
1474     (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
1475     (PID.TID 0000.0001) 1.000000000000000E-01
1476     (PID.TID 0000.0001) ;
1477     (PID.TID 0000.0001) baseTime = /* Model base time ( s ). */
1478     (PID.TID 0000.0001) 0.000000000000000E+00
1479     (PID.TID 0000.0001) ;
1480     (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
1481     (PID.TID 0000.0001) 3.110400000000000E+09
1482     (PID.TID 0000.0001) ;
1483     (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
1484     (PID.TID 0000.0001) 3.112128000000000E+09
1485     (PID.TID 0000.0001) ;
1486     (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
1487     (PID.TID 0000.0001) 3.110400000000000E+07
1488     (PID.TID 0000.0001) ;
1489     (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
1490     (PID.TID 0000.0001) 0.000000000000000E+00
1491     (PID.TID 0000.0001) ;
1492     (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1493     (PID.TID 0000.0001) T
1494     (PID.TID 0000.0001) ;
1495     (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1496     (PID.TID 0000.0001) T
1497     (PID.TID 0000.0001) ;
1498     (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1499     (PID.TID 0000.0001) F
1500     (PID.TID 0000.0001) ;
1501     (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1502     (PID.TID 0000.0001) 3.110400000000000E+07
1503     (PID.TID 0000.0001) ;
1504     (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1505     (PID.TID 0000.0001) T
1506     (PID.TID 0000.0001) ;
1507     (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1508     (PID.TID 0000.0001) T
1509     (PID.TID 0000.0001) ;
1510     (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1511     (PID.TID 0000.0001) 1.000000000000000E+00
1512     (PID.TID 0000.0001) ;
1513     (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1514     (PID.TID 0000.0001) T
1515     (PID.TID 0000.0001) ;
1516     (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1517     (PID.TID 0000.0001) 2.592000000000000E+06
1518     (PID.TID 0000.0001) ;
1519     (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1520     (PID.TID 0000.0001) 3.110400000000000E+07
1521     (PID.TID 0000.0001) ;
1522     (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1523     (PID.TID 0000.0001) 5.184000000000000E+06
1524     (PID.TID 0000.0001) ;
1525     (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1526     (PID.TID 0000.0001) 1.555200000000000E+07
1527     (PID.TID 0000.0001) ;
1528     (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1529     (PID.TID 0000.0001) 5.000000000000000E+01
1530     (PID.TID 0000.0001) ;
1531     (PID.TID 0000.0001) //
1532     (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1533     (PID.TID 0000.0001) //
1534 jmc 1.2 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True/False ) */
1535 jmc 1.1 (PID.TID 0000.0001) F
1536     (PID.TID 0000.0001) ;
1537 jmc 1.2 (PID.TID 0000.0001) usingCylindricalGrid = /* Cylindrical coordinates flag ( True/False ) */
1538 jmc 1.1 (PID.TID 0000.0001) F
1539     (PID.TID 0000.0001) ;
1540 jmc 1.2 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True/False ) */
1541 jmc 1.1 (PID.TID 0000.0001) F
1542     (PID.TID 0000.0001) ;
1543 jmc 1.2 (PID.TID 0000.0001) usingCurvilinearGrid = /* Curvilinear coordinates flag ( True/False ) */
1544     (PID.TID 0000.0001) T
1545     (PID.TID 0000.0001) ;
1546     (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r ) */
1547 jmc 1.1 (PID.TID 0000.0001) 0.000000000000000E+00
1548     (PID.TID 0000.0001) ;
1549     (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1550     (PID.TID 0000.0001) -1.000000000000000E+00
1551     (PID.TID 0000.0001) ;
1552 jmc 1.2 (PID.TID 0000.0001) gravitySign = /* gravity orientation relative to vertical coordinate */
1553     (PID.TID 0000.0001) -1.000000000000000E+00
1554     (PID.TID 0000.0001) ;
1555 jmc 1.1 (PID.TID 0000.0001) horiVertRatio = /* Ratio on units : Horiz - Vertical */
1556     (PID.TID 0000.0001) 1.000000000000000E+00
1557     (PID.TID 0000.0001) ;
1558     (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1559     (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1560     (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1561     (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1562     (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1563     (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1564     (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1565     (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1566     (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1567     (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1568     (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1569     (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1570     (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1571     (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1572     (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1573     (PID.TID 0000.0001) 6.650000000000000E+02 /* K = 15 */
1574     (PID.TID 0000.0001) ;
1575     (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1576     (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1577     (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1578     (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1579     (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1580     (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1581     (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1582     (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1583     (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1584     (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1585     (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1586     (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1587     (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1588     (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1589     (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1590     (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1591     (PID.TID 0000.0001) ;
1592     (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
1593     (PID.TID 0000.0001) 192 @ 1.234567000000000E+05 /* I = 1:192 */
1594     (PID.TID 0000.0001) ;
1595     (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
1596     (PID.TID 0000.0001) 32 @ 1.234567000000000E+05 /* J = 1: 32 */
1597     (PID.TID 0000.0001) ;
1598     (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
1599     (PID.TID 0000.0001) 0.000000000000000E+00
1600     (PID.TID 0000.0001) ;
1601     (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
1602     (PID.TID 0000.0001) 0.000000000000000E+00
1603     (PID.TID 0000.0001) ;
1604 jmc 1.2 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1605 jmc 1.1 (PID.TID 0000.0001) 6.370000000000000E+06
1606     (PID.TID 0000.0001) ;
1607 jmc 1.2 (PID.TID 0000.0001) deepAtmosphere = /* Deep/Shallow Atmosphere flag (True/False) */
1608     (PID.TID 0000.0001) F
1609     (PID.TID 0000.0001) ;
1610 jmc 1.1 (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
1611     (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1612     (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1613     (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1614     (PID.TID 0000.0001) -3.923446288487304E+01, /* I = 4 */
1615     (PID.TID 0000.0001) -3.702585158682200E+01, /* I = 5 */
1616     (PID.TID 0000.0001) -3.461179367094151E+01, /* I = 6 */
1617     (PID.TID 0000.0001) -3.200434569041793E+01, /* I = 7 */
1618     (PID.TID 0000.0001) -2.921355965632675E+01, /* I = 8 */
1619     (PID.TID 0000.0001) -2.624932223028290E+01, /* I = 9 */
1620     (PID.TID 0000.0001) -2.312261250426344E+01, /* I = 10 */
1621     (PID.TID 0000.0001) -1.984640717127058E+01, /* I = 11 */
1622     (PID.TID 0000.0001) -1.643630800555134E+01, /* I = 12 */
1623     (PID.TID 0000.0001) -1.291089806302069E+01, /* I = 13 */
1624     (PID.TID 0000.0001) -9.291807802719402E+00, /* I = 14 */
1625     (PID.TID 0000.0001) -5.603475335822332E+00, /* I = 15 */
1626     (PID.TID 0000.0001) -1.872608513033445E+00, /* I = 16 */
1627     (PID.TID 0000.0001) 1.872608513033445E+00, /* I = 17 */
1628     (PID.TID 0000.0001) 5.603475335822332E+00, /* I = 18 */
1629     (PID.TID 0000.0001) 9.291807802719402E+00, /* I = 19 */
1630     (PID.TID 0000.0001) 1.291089806302069E+01, /* I = 20 */
1631     (PID.TID 0000.0001) 1.643630800555134E+01, /* I = 21 */
1632     (PID.TID 0000.0001) 1.984640717127058E+01, /* I = 22 */
1633     (PID.TID 0000.0001) 2.312261250426344E+01, /* I = 23 */
1634     (PID.TID 0000.0001) 2.624932223028290E+01, /* I = 24 */
1635     (PID.TID 0000.0001) 2.921355965632675E+01, /* I = 25 */
1636     (PID.TID 0000.0001) 3.200434569041793E+01, /* I = 26 */
1637     (PID.TID 0000.0001) 3.461179367094151E+01, /* I = 27 */
1638     (PID.TID 0000.0001) 3.702585158682200E+01, /* I = 28 */
1639     (PID.TID 0000.0001) 3.923446288487304E+01, /* I = 29 */
1640     (PID.TID 0000.0001) 4.122055553388957E+01, /* I = 30 */
1641     (PID.TID 0000.0001) 4.295641272275883E+01, /* I = 31 */
1642     (PID.TID 0000.0001) 4.439521994760536E+01, /* I = 32 */
1643     (PID.TID 0000.0001) 4.560478005239464E+01, /* I = 33 */
1644     (PID.TID 0000.0001) 4.704358727724117E+01, /* I = 34 */
1645     (PID.TID 0000.0001) 4.877944446611043E+01, /* I = 35 */
1646     (PID.TID 0000.0001) 5.076553711512697E+01, /* I = 36 */
1647     (PID.TID 0000.0001) 5.297414841317801E+01, /* I = 37 */
1648     (PID.TID 0000.0001) 5.538820632905850E+01, /* I = 38 */
1649     (PID.TID 0000.0001) 5.799565430958209E+01, /* I = 39 */
1650     (PID.TID 0000.0001) 6.078644034367325E+01, /* I = 40 */
1651     (PID.TID 0000.0001) 6.375067776971711E+01, /* I = 41 */
1652     (PID.TID 0000.0001) 6.687738749573657E+01, /* I = 42 */
1653     (PID.TID 0000.0001) 7.015359282872943E+01, /* I = 43 */
1654     (PID.TID 0000.0001) 7.356369199444866E+01, /* I = 44 */
1655     (PID.TID 0000.0001) 7.708910193697932E+01, /* I = 45 */
1656     (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1657     (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1658     (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1659     (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1660     (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1661     (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1662     (PID.TID 0000.0001) 1.029108980630207E+02, /* I = 52 */
1663     (PID.TID 0000.0001) 1.064363080055513E+02, /* I = 53 */
1664     (PID.TID 0000.0001) 1.098464071712706E+02, /* I = 54 */
1665     (PID.TID 0000.0001) 1.131226125042634E+02, /* I = 55 */
1666     (PID.TID 0000.0001) 1.162493222302829E+02, /* I = 56 */
1667     (PID.TID 0000.0001) 1.192135596563268E+02, /* I = 57 */
1668     (PID.TID 0000.0001) 1.220043456904179E+02, /* I = 58 */
1669     (PID.TID 0000.0001) 1.246117936709415E+02, /* I = 59 */
1670     (PID.TID 0000.0001) 1.270258515868220E+02, /* I = 60 */
1671     (PID.TID 0000.0001) 1.292344628848730E+02, /* I = 61 */
1672     (PID.TID 0000.0001) 1.312205555338896E+02, /* I = 62 */
1673     (PID.TID 0000.0001) 1.329564127227588E+02, /* I = 63 */
1674     (PID.TID 0000.0001) 1.343952199476053E+02, /* I = 64 */
1675     (PID.TID 0000.0001) 4.500000000000000E+01, /* I = 65 */
1676     (PID.TID 0000.0001) 4.620805468796297E+01, /* I = 66 */
1677     (PID.TID 0000.0001) 4.781369642513039E+01, /* I = 67 */
1678     (PID.TID 0000.0001) 4.971767671143929E+01, /* I = 68 */
1679     (PID.TID 0000.0001) 5.187738319787235E+01, /* I = 69 */
1680     (PID.TID 0000.0001) 5.427004371478710E+01, /* I = 70 */
1681     (PID.TID 0000.0001) 5.688128325334060E+01, /* I = 71 */
1682     (PID.TID 0000.0001) 5.970018167786760E+01, /* I = 72 */
1683     (PID.TID 0000.0001) 6.271654991792347E+01, /* I = 73 */
1684     (PID.TID 0000.0001) 6.591914604853015E+01, /* I = 74 */
1685     (PID.TID 0000.0001) 6.929439270484148E+01, /* I = 75 */
1686     (PID.TID 0000.0001) 7.282545807616151E+01, /* I = 76 */
1687     (PID.TID 0000.0001) 7.649168830618933E+01, /* I = 77 */
1688     (PID.TID 0000.0001) 8.026842803787176E+01, /* I = 78 */
1689     (PID.TID 0000.0001) 8.412726743124185E+01, /* I = 79 */
1690     (PID.TID 0000.0001) 8.803672008547504E+01, /* I = 80 */
1691     (PID.TID 0000.0001) 9.196327991452496E+01, /* I = 81 */
1692     (PID.TID 0000.0001) 9.587273256875815E+01, /* I = 82 */
1693     (PID.TID 0000.0001) 9.973157196212824E+01, /* I = 83 */
1694     (PID.TID 0000.0001) 1.035083116938107E+02, /* I = 84 */
1695     (PID.TID 0000.0001) 1.071745419238385E+02, /* I = 85 */
1696     (PID.TID 0000.0001) 1.107056072951585E+02, /* I = 86 */
1697     (PID.TID 0000.0001) 1.140808539514698E+02, /* I = 87 */
1698     (PID.TID 0000.0001) 1.172834500820765E+02, /* I = 88 */
1699     (PID.TID 0000.0001) 1.202998183221324E+02, /* I = 89 */
1700     (PID.TID 0000.0001) 1.231187167466594E+02, /* I = 90 */
1701     (PID.TID 0000.0001) 1.257299562852129E+02, /* I = 91 */
1702     (PID.TID 0000.0001) 1.281226168021277E+02, /* I = 92 */
1703     (PID.TID 0000.0001) 1.302823232885607E+02, /* I = 93 */
1704     (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1705     (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1706     (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1707     (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1708     (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1709     (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1710     (PID.TID 0000.0001) 1.360654656901789E+02, /* I =100 */
1711     (PID.TID 0000.0001) 1.361344533147042E+02, /* I =101 */
1712     (PID.TID 0000.0001) 1.361871219420981E+02, /* I =102 */
1713     (PID.TID 0000.0001) 1.362280794509603E+02, /* I =103 */
1714     (PID.TID 0000.0001) 1.362602511071934E+02, /* I =104 */
1715     (PID.TID 0000.0001) 1.362856280326734E+02, /* I =105 */
1716     (PID.TID 0000.0001) 1.363056266270901E+02, /* I =106 */
1717     (PID.TID 0000.0001) 1.363212817739446E+02, /* I =107 */
1718     (PID.TID 0000.0001) 1.363333595910255E+02, /* I =108 */
1719     (PID.TID 0000.0001) 1.363424272425760E+02, /* I =109 */
1720     (PID.TID 0000.0001) 1.363488978790713E+02, /* I =110 */
1721     (PID.TID 0000.0001) 1.363530600590580E+02, /* I =111 */
1722     (PID.TID 0000.0001) 2 @ 1.363550967500717E+02, /* I =112:113 */
1723     (PID.TID 0000.0001) 1.363530600590580E+02, /* I =114 */
1724     (PID.TID 0000.0001) 1.363488978790713E+02, /* I =115 */
1725     (PID.TID 0000.0001) 1.363424272425760E+02, /* I =116 */
1726     (PID.TID 0000.0001) 1.363333595910255E+02, /* I =117 */
1727     (PID.TID 0000.0001) 1.363212817739446E+02, /* I =118 */
1728     (PID.TID 0000.0001) 1.363056266270901E+02, /* I =119 */
1729     (PID.TID 0000.0001) 1.362856280326734E+02, /* I =120 */
1730     (PID.TID 0000.0001) 1.362602511071934E+02, /* I =121 */
1731     (PID.TID 0000.0001) 1.362280794509603E+02, /* I =122 */
1732     (PID.TID 0000.0001) 1.361871219420981E+02, /* I =123 */
1733     (PID.TID 0000.0001) 1.361344533147042E+02, /* I =124 */
1734     (PID.TID 0000.0001) 1.360654656901789E+02, /* I =125 */
1735     (PID.TID 0000.0001) 1.359720382181193E+02, /* I =126 */
1736     (PID.TID 0000.0001) 1.358367907661329E+02, /* I =127 */
1737     (PID.TID 0000.0001) 1.356047800523947E+02, /* I =128 */
1738     (PID.TID 0000.0001) -1.343952199476053E+02, /* I =129 */
1739     (PID.TID 0000.0001) -1.341632092338671E+02, /* I =130 */
1740     (PID.TID 0000.0001) -1.340279617818807E+02, /* I =131 */
1741     (PID.TID 0000.0001) -1.339345343098211E+02, /* I =132 */
1742     (PID.TID 0000.0001) -1.338655466852958E+02, /* I =133 */
1743     (PID.TID 0000.0001) -1.338128780579019E+02, /* I =134 */
1744     (PID.TID 0000.0001) -1.337719205490397E+02, /* I =135 */
1745     (PID.TID 0000.0001) -1.337397488928066E+02, /* I =136 */
1746     (PID.TID 0000.0001) -1.337143719673266E+02, /* I =137 */
1747     (PID.TID 0000.0001) -1.336943733729099E+02, /* I =138 */
1748     (PID.TID 0000.0001) -1.336787182260554E+02, /* I =139 */
1749     (PID.TID 0000.0001) -1.336666404089745E+02, /* I =140 */
1750     (PID.TID 0000.0001) -1.336575727574240E+02, /* I =141 */
1751     (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1752     (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1753     (PID.TID 0000.0001) 2 @ -1.336449032499283E+02, /* I =144:145 */
1754     (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1755     (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1756     (PID.TID 0000.0001) -1.336575727574240E+02, /* I =148 */
1757     (PID.TID 0000.0001) -1.336666404089745E+02, /* I =149 */
1758     (PID.TID 0000.0001) -1.336787182260554E+02, /* I =150 */
1759     (PID.TID 0000.0001) -1.336943733729099E+02, /* I =151 */
1760     (PID.TID 0000.0001) -1.337143719673266E+02, /* I =152 */
1761     (PID.TID 0000.0001) -1.337397488928066E+02, /* I =153 */
1762     (PID.TID 0000.0001) -1.337719205490397E+02, /* I =154 */
1763     (PID.TID 0000.0001) -1.338128780579019E+02, /* I =155 */
1764     (PID.TID 0000.0001) -1.338655466852958E+02, /* I =156 */
1765     (PID.TID 0000.0001) -1.339345343098211E+02, /* I =157 */
1766     (PID.TID 0000.0001) -1.340279617818807E+02, /* I =158 */
1767     (PID.TID 0000.0001) -1.341632092338671E+02, /* I =159 */
1768     (PID.TID 0000.0001) -1.343952199476053E+02, /* I =160 */
1769     (PID.TID 0000.0001) -1.350000000000000E+02, /* I =161 */
1770     (PID.TID 0000.0001) -1.362080546879630E+02, /* I =162 */
1771     (PID.TID 0000.0001) -1.378136964251304E+02, /* I =163 */
1772     (PID.TID 0000.0001) -1.397176767114393E+02, /* I =164 */
1773     (PID.TID 0000.0001) -1.418773831978723E+02, /* I =165 */
1774     (PID.TID 0000.0001) -1.442700437147871E+02, /* I =166 */
1775     (PID.TID 0000.0001) -1.468812832533406E+02, /* I =167 */
1776     (PID.TID 0000.0001) -1.497001816778676E+02, /* I =168 */
1777     (PID.TID 0000.0001) -1.527165499179235E+02, /* I =169 */
1778     (PID.TID 0000.0001) -1.559191460485302E+02, /* I =170 */
1779     (PID.TID 0000.0001) -1.592943927048415E+02, /* I =171 */
1780     (PID.TID 0000.0001) -1.628254580761615E+02, /* I =172 */
1781     (PID.TID 0000.0001) -1.664916883061893E+02, /* I =173 */
1782     (PID.TID 0000.0001) -1.702684280378718E+02, /* I =174 */
1783     (PID.TID 0000.0001) -1.741272674312418E+02, /* I =175 */
1784     (PID.TID 0000.0001) -1.780367200854751E+02, /* I =176 */
1785     (PID.TID 0000.0001) 1.780367200854751E+02, /* I =177 */
1786     (PID.TID 0000.0001) 1.741272674312418E+02, /* I =178 */
1787     (PID.TID 0000.0001) 1.702684280378718E+02, /* I =179 */
1788     (PID.TID 0000.0001) 1.664916883061893E+02, /* I =180 */
1789     (PID.TID 0000.0001) 1.628254580761615E+02, /* I =181 */
1790     (PID.TID 0000.0001) 1.592943927048415E+02, /* I =182 */
1791     (PID.TID 0000.0001) 1.559191460485302E+02, /* I =183 */
1792     (PID.TID 0000.0001) 1.527165499179235E+02, /* I =184 */
1793     (PID.TID 0000.0001) 1.497001816778676E+02, /* I =185 */
1794     (PID.TID 0000.0001) 1.468812832533406E+02, /* I =186 */
1795     (PID.TID 0000.0001) 1.442700437147871E+02, /* I =187 */
1796     (PID.TID 0000.0001) 1.418773831978723E+02, /* I =188 */
1797     (PID.TID 0000.0001) 1.397176767114393E+02, /* I =189 */
1798     (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1799     (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1800     (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1801     (PID.TID 0000.0001) ;
1802     (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
1803     (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1804     (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1805     (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1806     (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1807     (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1808     (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1809     (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1810     (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1811     (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1812     (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1813     (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1814     (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1815     (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1816     (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1817     (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1818     (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1819     (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1820     (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1821     (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1822     (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1823     (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1824     (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1825     (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1826     (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1827     (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1828     (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1829     (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1830     (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1831     (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1832     (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1833     (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1834     (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1835     (PID.TID 0000.0001) ;
1836     (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1837     (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1838     (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1839     (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1840     (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1841     (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1842     (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1843     (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1844     (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1845     (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1846     (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1847     (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1848     (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1849     (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1850     (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1851     (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1852     (PID.TID 0000.0001) ;
1853     (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1854     (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1855     (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1856     (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1857     (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1858     (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1859     (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1860     (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1861     (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1862     (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1863     (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1864     (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1865     (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1866     (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1867     (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1868     (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1869     (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1870     (PID.TID 0000.0001) ;
1871 jmc 1.2 (PID.TID 0000.0001) deepFacC = /* deep-model grid factor @ cell-Center (-) */
1872     (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1873     (PID.TID 0000.0001) ;
1874     (PID.TID 0000.0001) deepFacF = /* deep-model grid factor @ W-Interface (-) */
1875     (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1876     (PID.TID 0000.0001) ;
1877 jmc 1.1 (PID.TID 0000.0001) dBdrRef = /* Vertical gradient of reference boyancy [(m/s/r)^2)] */
1878     (PID.TID 0000.0001) 15 @ 0.000000000000000E+00 /* K = 1: 15 */
1879     (PID.TID 0000.0001) ;
1880 jmc 1.2 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( units: m ) */
1881 jmc 1.1 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1882     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1883     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1884     (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 4 */
1885     (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 5 */
1886     (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 6 */
1887     (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 7 */
1888     (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 8 */
1889     (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 9 */
1890     (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 10 */
1891     (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 11 */
1892     (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 12 */
1893     (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 13 */
1894     (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 14 */
1895     (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 15 */
1896     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 16: 17 */
1897     (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 18 */
1898     (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 19 */
1899     (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 20 */
1900     (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 21 */
1901     (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 22 */
1902     (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 23 */
1903     (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 24 */
1904     (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 25 */
1905     (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 26 */
1906     (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 27 */
1907     (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 28 */
1908     (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 29 */
1909     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 30 */
1910     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 31 */
1911     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1912     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 34 */
1913     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 35 */
1914     (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 36 */
1915     (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 37 */
1916     (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 38 */
1917     (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 39 */
1918     (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 40 */
1919     (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 41 */
1920     (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 42 */
1921     (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 43 */
1922     (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 44 */
1923     (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 45 */
1924     (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1925     (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1926     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 48: 49 */
1927     (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1928     (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1929     (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 52 */
1930     (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 53 */
1931     (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 54 */
1932     (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 55 */
1933     (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 56 */
1934     (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 57 */
1935     (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 58 */
1936     (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 59 */
1937     (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 60 */
1938     (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 61 */
1939     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 62 */
1940     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 63 */
1941     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1942     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 66 */
1943     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 67 */
1944     (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 68 */
1945     (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 69 */
1946     (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 70 */
1947     (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 71 */
1948     (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 72 */
1949     (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 73 */
1950     (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 74 */
1951     (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 75 */
1952     (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 76 */
1953     (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 77 */
1954     (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 78 */
1955     (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 79 */
1956     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 80: 81 */
1957     (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 82 */
1958     (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 83 */
1959     (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 84 */
1960     (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 85 */
1961     (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 86 */
1962     (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 87 */
1963     (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 88 */
1964     (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 89 */
1965     (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 90 */
1966     (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 91 */
1967     (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 92 */
1968     (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 93 */
1969     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1970     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1971     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1972     (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1973     (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1974     (PID.TID 0000.0001) 2.045883481718707E+05, /* I =100 */
1975     (PID.TID 0000.0001) 2.218350349844185E+05, /* I =101 */
1976     (PID.TID 0000.0001) 2.364352994647058E+05, /* I =102 */
1977     (PID.TID 0000.0001) 2.490022710862746E+05, /* I =103 */
1978     (PID.TID 0000.0001) 2.598919724358304E+05, /* I =104 */
1979     (PID.TID 0000.0001) 2.693210245495156E+05, /* I =105 */
1980     (PID.TID 0000.0001) 2.774243179696503E+05, /* I =106 */
1981     (PID.TID 0000.0001) 2.842862532064524E+05, /* I =107 */
1982     (PID.TID 0000.0001) 2.899590699694043E+05, /* I =108 */
1983     (PID.TID 0000.0001) 2.944742915095688E+05, /* I =109 */
1984     (PID.TID 0000.0001) 2.978501920522794E+05, /* I =110 */
1985     (PID.TID 0000.0001) 3.000967749619962E+05, /* I =111 */
1986     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =112:113 */
1987     (PID.TID 0000.0001) 3.000967749619962E+05, /* I =114 */
1988     (PID.TID 0000.0001) 2.978501920522794E+05, /* I =115 */
1989     (PID.TID 0000.0001) 2.944742915095688E+05, /* I =116 */
1990     (PID.TID 0000.0001) 2.899590699694043E+05, /* I =117 */
1991     (PID.TID 0000.0001) 2.842862532064524E+05, /* I =118 */
1992     (PID.TID 0000.0001) 2.774243179696503E+05, /* I =119 */
1993     (PID.TID 0000.0001) 2.693210245495156E+05, /* I =120 */
1994     (PID.TID 0000.0001) 2.598919724358304E+05, /* I =121 */
1995     (PID.TID 0000.0001) 2.490022710862746E+05, /* I =122 */
1996     (PID.TID 0000.0001) 2.364352994647058E+05, /* I =123 */
1997     (PID.TID 0000.0001) 2.218350349844185E+05, /* I =124 */
1998     (PID.TID 0000.0001) 2.045883481718707E+05, /* I =125 */
1999     (PID.TID 0000.0001) 1.835530058121492E+05, /* I =126 */
2000     (PID.TID 0000.0001) 1.563594089971120E+05, /* I =127 */
2001     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
2002     (PID.TID 0000.0001) 1.563594089971120E+05, /* I =130 */
2003     (PID.TID 0000.0001) 1.835530058121492E+05, /* I =131 */
2004     (PID.TID 0000.0001) 2.045883481718707E+05, /* I =132 */
2005     (PID.TID 0000.0001) 2.218350349844185E+05, /* I =133 */
2006     (PID.TID 0000.0001) 2.364352994647058E+05, /* I =134 */
2007     (PID.TID 0000.0001) 2.490022710862746E+05, /* I =135 */
2008     (PID.TID 0000.0001) 2.598919724358304E+05, /* I =136 */
2009     (PID.TID 0000.0001) 2.693210245495156E+05, /* I =137 */
2010     (PID.TID 0000.0001) 2.774243179696503E+05, /* I =138 */
2011     (PID.TID 0000.0001) 2.842862532064524E+05, /* I =139 */
2012     (PID.TID 0000.0001) 2.899590699694043E+05, /* I =140 */
2013     (PID.TID 0000.0001) 2.944742915095688E+05, /* I =141 */
2014     (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
2015     (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
2016     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =144:145 */
2017     (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
2018     (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
2019     (PID.TID 0000.0001) 2.944742915095688E+05, /* I =148 */
2020     (PID.TID 0000.0001) 2.899590699694043E+05, /* I =149 */
2021     (PID.TID 0000.0001) 2.842862532064524E+05, /* I =150 */
2022     (PID.TID 0000.0001) 2.774243179696503E+05, /* I =151 */
2023     (PID.TID 0000.0001) 2.693210245495156E+05, /* I =152 */
2024     (PID.TID 0000.0001) 2.598919724358304E+05, /* I =153 */
2025     (PID.TID 0000.0001) 2.490022710862746E+05, /* I =154 */
2026     (PID.TID 0000.0001) 2.364352994647058E+05, /* I =155 */
2027     (PID.TID 0000.0001) 2.218350349844185E+05, /* I =156 */
2028     (PID.TID 0000.0001) 2.045883481718707E+05, /* I =157 */
2029     (PID.TID 0000.0001) 1.835530058121492E+05, /* I =158 */
2030     (PID.TID 0000.0001) 1.563594089971120E+05, /* I =159 */
2031     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
2032     (PID.TID 0000.0001) 1.563594089971120E+05, /* I =162 */
2033     (PID.TID 0000.0001) 1.835530058121492E+05, /* I =163 */
2034     (PID.TID 0000.0001) 2.045883481718707E+05, /* I =164 */
2035     (PID.TID 0000.0001) 2.218350349844185E+05, /* I =165 */
2036     (PID.TID 0000.0001) 2.364352994647058E+05, /* I =166 */
2037     (PID.TID 0000.0001) 2.490022710862746E+05, /* I =167 */
2038     (PID.TID 0000.0001) 2.598919724358304E+05, /* I =168 */
2039     (PID.TID 0000.0001) 2.693210245495156E+05, /* I =169 */
2040     (PID.TID 0000.0001) 2.774243179696503E+05, /* I =170 */
2041     (PID.TID 0000.0001) 2.842862532064524E+05, /* I =171 */
2042     (PID.TID 0000.0001) 2.899590699694043E+05, /* I =172 */
2043     (PID.TID 0000.0001) 2.944742915095688E+05, /* I =173 */
2044     (PID.TID 0000.0001) 2.978501920522794E+05, /* I =174 */
2045     (PID.TID 0000.0001) 3.000967749619962E+05, /* I =175 */
2046     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =176:177 */
2047     (PID.TID 0000.0001) 3.000967749619962E+05, /* I =178 */
2048     (PID.TID 0000.0001) 2.978501920522794E+05, /* I =179 */
2049     (PID.TID 0000.0001) 2.944742915095688E+05, /* I =180 */
2050     (PID.TID 0000.0001) 2.899590699694043E+05, /* I =181 */
2051     (PID.TID 0000.0001) 2.842862532064524E+05, /* I =182 */
2052     (PID.TID 0000.0001) 2.774243179696503E+05, /* I =183 */
2053     (PID.TID 0000.0001) 2.693210245495156E+05, /* I =184 */
2054     (PID.TID 0000.0001) 2.598919724358304E+05, /* I =185 */
2055     (PID.TID 0000.0001) 2.490022710862746E+05, /* I =186 */
2056     (PID.TID 0000.0001) 2.364352994647058E+05, /* I =187 */
2057     (PID.TID 0000.0001) 2.218350349844185E+05, /* I =188 */
2058     (PID.TID 0000.0001) 2.045883481718707E+05, /* I =189 */
2059     (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
2060     (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
2061     (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
2062     (PID.TID 0000.0001) ;
2063 jmc 1.2 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( units: m ) */
2064 jmc 1.1 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
2065     (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
2066     (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
2067     (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
2068     (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
2069     (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
2070     (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
2071     (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
2072     (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
2073     (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
2074     (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
2075     (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
2076     (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
2077     (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
2078     (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
2079     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
2080     (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
2081     (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
2082     (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
2083     (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
2084     (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
2085     (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
2086     (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
2087     (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
2088     (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
2089     (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
2090     (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
2091     (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
2092     (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
2093     (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
2094     (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
2095     (PID.TID 0000.0001) ;
2096 jmc 1.2 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( units: m ) */
2097 jmc 1.1 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
2098     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
2099     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
2100     (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 4 */
2101     (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 5 */
2102     (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 6 */
2103     (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 7 */
2104     (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 8 */
2105     (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 9 */
2106     (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 10 */
2107     (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 11 */
2108     (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 12 */
2109     (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 13 */
2110     (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 14 */
2111     (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 15 */
2112     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 16: 17 */
2113     (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 18 */
2114     (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 19 */
2115     (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 20 */
2116     (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 21 */
2117     (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 22 */
2118     (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 23 */
2119     (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 24 */
2120     (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 25 */
2121     (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 26 */
2122     (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 27 */
2123     (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 28 */
2124     (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 29 */
2125     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 30 */
2126     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 31 */
2127     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
2128     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 34 */
2129     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 35 */
2130     (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 36 */
2131     (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 37 */
2132     (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 38 */
2133     (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 39 */
2134     (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 40 */
2135     (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 41 */
2136     (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 42 */
2137     (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 43 */
2138     (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 44 */
2139     (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 45 */
2140     (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
2141     (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
2142     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 48: 49 */
2143     (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
2144     (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
2145     (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 52 */
2146     (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 53 */
2147     (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 54 */
2148     (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 55 */
2149     (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 56 */
2150     (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 57 */
2151     (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 58 */
2152     (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 59 */
2153     (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 60 */
2154     (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 61 */
2155     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 62 */
2156     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 63 */
2157     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
2158     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 66 */
2159     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 67 */
2160     (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 68 */
2161     (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 69 */
2162     (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 70 */
2163     (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 71 */
2164     (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 72 */
2165     (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 73 */
2166     (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 74 */
2167     (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 75 */
2168     (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 76 */
2169     (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 77 */
2170     (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 78 */
2171     (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 79 */
2172     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 80: 81 */
2173     (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 82 */
2174     (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 83 */
2175     (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 84 */
2176     (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 85 */
2177     (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 86 */
2178     (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 87 */
2179     (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 88 */
2180     (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 89 */
2181     (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 90 */
2182     (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 91 */
2183     (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 92 */
2184     (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 93 */
2185     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
2186     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
2187     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
2188     (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
2189     (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
2190     (PID.TID 0000.0001) 2.048868197919576E+05, /* I =100 */
2191     (PID.TID 0000.0001) 2.220405216043041E+05, /* I =101 */
2192     (PID.TID 0000.0001) 2.365892017348392E+05, /* I =102 */
2193     (PID.TID 0000.0001) 2.491250781852558E+05, /* I =103 */
2194     (PID.TID 0000.0001) 2.599949918261881E+05, /* I =104 */
2195     (PID.TID 0000.0001) 2.694110134598581E+05, /* I =105 */
2196     (PID.TID 0000.0001) 2.775055554645015E+05, /* I =106 */
2197     (PID.TID 0000.0001) 2.843615645344775E+05, /* I =107 */
2198     (PID.TID 0000.0001) 2.900303768613599E+05, /* I =108 */
2199     (PID.TID 0000.0001) 2.945429307892709E+05, /* I =109 */
2200     (PID.TID 0000.0001) 2.979171143158405E+05, /* I =110 */
2201     (PID.TID 0000.0001) 3.001626787528886E+05, /* I =111 */
2202     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =112:113 */
2203     (PID.TID 0000.0001) 3.001626787528886E+05, /* I =114 */
2204     (PID.TID 0000.0001) 2.979171143158405E+05, /* I =115 */
2205     (PID.TID 0000.0001) 2.945429307892709E+05, /* I =116 */
2206     (PID.TID 0000.0001) 2.900303768613599E+05, /* I =117 */
2207     (PID.TID 0000.0001) 2.843615645344775E+05, /* I =118 */
2208     (PID.TID 0000.0001) 2.775055554645015E+05, /* I =119 */
2209     (PID.TID 0000.0001) 2.694110134598581E+05, /* I =120 */
2210     (PID.TID 0000.0001) 2.599949918261881E+05, /* I =121 */
2211     (PID.TID 0000.0001) 2.491250781852558E+05, /* I =122 */
2212     (PID.TID 0000.0001) 2.365892017348392E+05, /* I =123 */
2213     (PID.TID 0000.0001) 2.220405216043041E+05, /* I =124 */
2214     (PID.TID 0000.0001) 2.048868197919576E+05, /* I =125 */
2215     (PID.TID 0000.0001) 1.840412227747703E+05, /* I =126 */
2216     (PID.TID 0000.0001) 1.572908084538706E+05, /* I =127 */
2217     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
2218     (PID.TID 0000.0001) 1.572908084538706E+05, /* I =130 */
2219     (PID.TID 0000.0001) 1.840412227747703E+05, /* I =131 */
2220     (PID.TID 0000.0001) 2.048868197919576E+05, /* I =132 */
2221     (PID.TID 0000.0001) 2.220405216043041E+05, /* I =133 */
2222     (PID.TID 0000.0001) 2.365892017348392E+05, /* I =134 */
2223     (PID.TID 0000.0001) 2.491250781852558E+05, /* I =135 */
2224     (PID.TID 0000.0001) 2.599949918261881E+05, /* I =136 */
2225     (PID.TID 0000.0001) 2.694110134598581E+05, /* I =137 */
2226     (PID.TID 0000.0001) 2.775055554645015E+05, /* I =138 */
2227     (PID.TID 0000.0001) 2.843615645344775E+05, /* I =139 */
2228     (PID.TID 0000.0001) 2.900303768613599E+05, /* I =140 */
2229     (PID.TID 0000.0001) 2.945429307892709E+05, /* I =141 */
2230     (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
2231     (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
2232     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =144:145 */
2233     (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
2234     (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
2235     (PID.TID 0000.0001) 2.945429307892709E+05, /* I =148 */
2236     (PID.TID 0000.0001) 2.900303768613599E+05, /* I =149 */
2237     (PID.TID 0000.0001) 2.843615645344775E+05, /* I =150 */
2238     (PID.TID 0000.0001) 2.775055554645015E+05, /* I =151 */
2239     (PID.TID 0000.0001) 2.694110134598581E+05, /* I =152 */
2240     (PID.TID 0000.0001) 2.599949918261881E+05, /* I =153 */
2241     (PID.TID 0000.0001) 2.491250781852558E+05, /* I =154 */
2242     (PID.TID 0000.0001) 2.365892017348392E+05, /* I =155 */
2243     (PID.TID 0000.0001) 2.220405216043041E+05, /* I =156 */
2244     (PID.TID 0000.0001) 2.048868197919576E+05, /* I =157 */
2245     (PID.TID 0000.0001) 1.840412227747703E+05, /* I =158 */
2246     (PID.TID 0000.0001) 1.572908084538706E+05, /* I =159 */
2247     (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
2248     (PID.TID 0000.0001) 1.572908084538706E+05, /* I =162 */
2249     (PID.TID 0000.0001) 1.840412227747703E+05, /* I =163 */
2250     (PID.TID 0000.0001) 2.048868197919576E+05, /* I =164 */
2251     (PID.TID 0000.0001) 2.220405216043041E+05, /* I =165 */
2252     (PID.TID 0000.0001) 2.365892017348392E+05, /* I =166 */
2253     (PID.TID 0000.0001) 2.491250781852558E+05, /* I =167 */
2254     (PID.TID 0000.0001) 2.599949918261881E+05, /* I =168 */
2255     (PID.TID 0000.0001) 2.694110134598581E+05, /* I =169 */
2256     (PID.TID 0000.0001) 2.775055554645015E+05, /* I =170 */
2257     (PID.TID 0000.0001) 2.843615645344775E+05, /* I =171 */
2258     (PID.TID 0000.0001) 2.900303768613599E+05, /* I =172 */
2259     (PID.TID 0000.0001) 2.945429307892709E+05, /* I =173 */
2260     (PID.TID 0000.0001) 2.979171143158405E+05, /* I =174 */
2261     (PID.TID 0000.0001) 3.001626787528886E+05, /* I =175 */
2262     (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =176:177 */
2263     (PID.TID 0000.0001) 3.001626787528886E+05, /* I =178 */
2264     (PID.TID 0000.0001) 2.979171143158405E+05, /* I =179 */
2265     (PID.TID 0000.0001) 2.945429307892709E+05, /* I =180 */
2266     (PID.TID 0000.0001) 2.900303768613599E+05, /* I =181 */
2267     (PID.TID 0000.0001) 2.843615645344775E+05, /* I =182 */
2268     (PID.TID 0000.0001) 2.775055554645015E+05, /* I =183 */
2269     (PID.TID 0000.0001) 2.694110134598581E+05, /* I =184 */
2270     (PID.TID 0000.0001) 2.599949918261881E+05, /* I =185 */
2271     (PID.TID 0000.0001) 2.491250781852558E+05, /* I =186 */
2272     (PID.TID 0000.0001) 2.365892017348392E+05, /* I =187 */
2273     (PID.TID 0000.0001) 2.220405216043041E+05, /* I =188 */
2274     (PID.TID 0000.0001) 2.048868197919576E+05, /* I =189 */
2275     (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
2276     (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
2277     (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
2278     (PID.TID 0000.0001) ;
2279 jmc 1.2 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( units: m ) */
2280 jmc 1.1 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
2281     (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
2282     (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
2283     (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
2284     (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
2285     (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
2286     (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
2287     (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
2288     (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
2289     (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
2290     (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
2291     (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
2292     (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
2293     (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
2294     (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
2295     (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
2296     (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
2297     (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
2298     (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
2299     (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
2300     (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
2301     (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
2302     (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
2303     (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
2304     (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
2305     (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
2306     (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
2307     (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
2308     (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
2309     (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
2310     (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
2311     (PID.TID 0000.0001) ;
2312 jmc 1.2 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( units: m ) */
2313 jmc 1.1 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2314     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
2315     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
2316     (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 4 */
2317     (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 5 */
2318     (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 6 */
2319     (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 7 */
2320     (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 8 */
2321     (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 9 */
2322     (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 10 */
2323     (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 11 */
2324     (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 12 */
2325     (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 13 */
2326     (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 14 */
2327     (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 15 */
2328     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 16: 17 */
2329     (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 18 */
2330     (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 19 */
2331     (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 20 */
2332     (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 21 */
2333     (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 22 */
2334     (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 23 */
2335     (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 24 */
2336     (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 25 */
2337     (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 26 */
2338     (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 27 */
2339     (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 28 */
2340     (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 29 */
2341     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 30 */
2342     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 31 */
2343     (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 32: 33 */
2344     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 34 */
2345     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 35 */
2346     (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 36 */
2347     (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 37 */
2348     (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 38 */
2349     (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 39 */
2350     (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 40 */
2351     (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 41 */
2352     (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 42 */
2353     (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 43 */
2354     (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 44 */
2355     (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 45 */
2356     (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
2357     (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
2358     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 48: 49 */
2359     (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
2360     (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
2361     (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 52 */
2362     (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 53 */
2363     (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 54 */
2364     (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 55 */
2365     (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 56 */
2366     (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 57 */
2367     (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 58 */
2368     (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 59 */
2369     (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 60 */
2370     (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 61 */
2371     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 62 */
2372     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 63 */
2373     (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 64: 65 */
2374     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 66 */
2375     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 67 */
2376     (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 68 */
2377     (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 69 */
2378     (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 70 */
2379     (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 71 */
2380     (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 72 */
2381     (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 73 */
2382     (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 74 */
2383     (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 75 */
2384     (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 76 */
2385     (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 77 */
2386     (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 78 */
2387     (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 79 */
2388     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 80: 81 */
2389     (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 82 */
2390     (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 83 */
2391     (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 84 */
2392     (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 85 */
2393     (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 86 */
2394     (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 87 */
2395     (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 88 */
2396     (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 89 */
2397     (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 90 */
2398     (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 91 */
2399     (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 92 */
2400     (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 93 */
2401     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
2402     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
2403     (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 96: 97 */
2404     (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
2405     (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
2406     (PID.TID 0000.0001) 2.038999045536999E+05, /* I =100 */
2407     (PID.TID 0000.0001) 2.213884732245467E+05, /* I =101 */
2408     (PID.TID 0000.0001) 2.361211699596122E+05, /* I =102 */
2409     (PID.TID 0000.0001) 2.487693460283865E+05, /* I =103 */
2410     (PID.TID 0000.0001) 2.597126963772147E+05, /* I =104 */
2411     (PID.TID 0000.0001) 2.691790288994575E+05, /* I =105 */
2412     (PID.TID 0000.0001) 2.773091043277394E+05, /* I =106 */
2413     (PID.TID 0000.0001) 2.841906470085516E+05, /* I =107 */
2414     (PID.TID 0000.0001) 2.898778860929753E+05, /* I =108 */
2415     (PID.TID 0000.0001) 2.944035815526416E+05, /* I =109 */
2416     (PID.TID 0000.0001) 2.977867909042096E+05, /* I =110 */
2417     (PID.TID 0000.0001) 3.000380090330854E+05, /* I =111 */
2418     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =112:113 */
2419     (PID.TID 0000.0001) 3.000380090330854E+05, /* I =114 */
2420     (PID.TID 0000.0001) 2.977867909042096E+05, /* I =115 */
2421     (PID.TID 0000.0001) 2.944035815526416E+05, /* I =116 */
2422     (PID.TID 0000.0001) 2.898778860929753E+05, /* I =117 */
2423     (PID.TID 0000.0001) 2.841906470085516E+05, /* I =118 */
2424     (PID.TID 0000.0001) 2.773091043277394E+05, /* I =119 */
2425     (PID.TID 0000.0001) 2.691790288994575E+05, /* I =120 */
2426     (PID.TID 0000.0001) 2.597126963772147E+05, /* I =121 */
2427     (PID.TID 0000.0001) 2.487693460283865E+05, /* I =122 */
2428     (PID.TID 0000.0001) 2.361211699596122E+05, /* I =123 */
2429     (PID.TID 0000.0001) 2.213884732245467E+05, /* I =124 */
2430     (PID.TID 0000.0001) 2.038999045536999E+05, /* I =125 */
2431     (PID.TID 0000.0001) 1.823321598773926E+05, /* I =126 */
2432     (PID.TID 0000.0001) 1.534505834330338E+05, /* I =127 */
2433     (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =128:129 */
2434     (PID.TID 0000.0001) 1.534505834330338E+05, /* I =130 */
2435     (PID.TID 0000.0001) 1.823321598773926E+05, /* I =131 */
2436     (PID.TID 0000.0001) 2.038999045536999E+05, /* I =132 */
2437     (PID.TID 0000.0001) 2.213884732245467E+05, /* I =133 */
2438     (PID.TID 0000.0001) 2.361211699596122E+05, /* I =134 */
2439     (PID.TID 0000.0001) 2.487693460283865E+05, /* I =135 */
2440     (PID.TID 0000.0001) 2.597126963772147E+05, /* I =136 */
2441     (PID.TID 0000.0001) 2.691790288994575E+05, /* I =137 */
2442     (PID.TID 0000.0001) 2.773091043277394E+05, /* I =138 */
2443     (PID.TID 0000.0001) 2.841906470085516E+05, /* I =139 */
2444     (PID.TID 0000.0001) 2.898778860929753E+05, /* I =140 */
2445     (PID.TID 0000.0001) 2.944035815526416E+05, /* I =141 */
2446     (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
2447     (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
2448     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =144:145 */
2449     (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
2450     (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
2451     (PID.TID 0000.0001) 2.944035815526416E+05, /* I =148 */
2452     (PID.TID 0000.0001) 2.898778860929753E+05, /* I =149 */
2453     (PID.TID 0000.0001) 2.841906470085516E+05, /* I =150 */
2454     (PID.TID 0000.0001) 2.773091043277394E+05, /* I =151 */
2455     (PID.TID 0000.0001) 2.691790288994575E+05, /* I =152 */
2456     (PID.TID 0000.0001) 2.597126963772147E+05, /* I =153 */
2457     (PID.TID 0000.0001) 2.487693460283865E+05, /* I =154 */
2458     (PID.TID 0000.0001) 2.361211699596122E+05, /* I =155 */
2459     (PID.TID 0000.0001) 2.213884732245467E+05, /* I =156 */
2460     (PID.TID 0000.0001) 2.038999045536999E+05, /* I =157 */
2461     (PID.TID 0000.0001) 1.823321598773926E+05, /* I =158 */
2462     (PID.TID 0000.0001) 1.534505834330338E+05, /* I =159 */
2463     (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =160:161 */
2464     (PID.TID 0000.0001) 1.534505834330338E+05, /* I =162 */
2465     (PID.TID 0000.0001) 1.823321598773926E+05, /* I =163 */
2466     (PID.TID 0000.0001) 2.038999045536999E+05, /* I =164 */
2467     (PID.TID 0000.0001) 2.213884732245467E+05, /* I =165 */
2468     (PID.TID 0000.0001) 2.361211699596122E+05, /* I =166 */
2469     (PID.TID 0000.0001) 2.487693460283865E+05, /* I =167 */
2470     (PID.TID 0000.0001) 2.597126963772147E+05, /* I =168 */
2471     (PID.TID 0000.0001) 2.691790288994575E+05, /* I =169 */
2472     (PID.TID 0000.0001) 2.773091043277394E+05, /* I =170 */
2473     (PID.TID 0000.0001) 2.841906470085516E+05, /* I =171 */
2474     (PID.TID 0000.0001) 2.898778860929753E+05, /* I =172 */
2475     (PID.TID 0000.0001) 2.944035815526416E+05, /* I =173 */
2476     (PID.TID 0000.0001) 2.977867909042096E+05, /* I =174 */
2477     (PID.TID 0000.0001) 3.000380090330854E+05, /* I =175 */
2478     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =176:177 */
2479     (PID.TID 0000.0001) 3.000380090330854E+05, /* I =178 */
2480     (PID.TID 0000.0001) 2.977867909042096E+05, /* I =179 */
2481     (PID.TID 0000.0001) 2.944035815526416E+05, /* I =180 */
2482     (PID.TID 0000.0001) 2.898778860929753E+05, /* I =181 */
2483     (PID.TID 0000.0001) 2.841906470085516E+05, /* I =182 */
2484     (PID.TID 0000.0001) 2.773091043277394E+05, /* I =183 */
2485     (PID.TID 0000.0001) 2.691790288994575E+05, /* I =184 */
2486     (PID.TID 0000.0001) 2.597126963772147E+05, /* I =185 */
2487     (PID.TID 0000.0001) 2.487693460283865E+05, /* I =186 */
2488     (PID.TID 0000.0001) 2.361211699596122E+05, /* I =187 */
2489     (PID.TID 0000.0001) 2.213884732245467E+05, /* I =188 */
2490     (PID.TID 0000.0001) 2.038999045536999E+05, /* I =189 */
2491     (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
2492     (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
2493     (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
2494     (PID.TID 0000.0001) ;
2495 jmc 1.2 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( units: m ) */
2496 jmc 1.1 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2497     (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
2498     (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
2499     (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
2500     (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
2501     (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
2502     (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
2503     (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
2504     (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
2505     (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
2506     (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
2507     (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
2508     (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
2509     (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
2510     (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
2511     (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
2512     (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
2513     (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
2514     (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
2515     (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
2516     (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
2517     (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
2518     (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
2519     (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
2520     (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
2521     (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
2522     (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
2523     (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
2524     (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
2525     (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
2526     (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
2527     (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
2528     (PID.TID 0000.0001) ;
2529 jmc 1.2 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( units: m ) */
2530 jmc 1.1 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2531     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
2532     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
2533     (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 4 */
2534     (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 5 */
2535     (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 6 */
2536     (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 7 */
2537     (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 8 */
2538     (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 9 */
2539     (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 10 */
2540     (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 11 */
2541     (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 12 */
2542     (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 13 */
2543     (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 14 */
2544     (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 15 */
2545     (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 16 */
2546     (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 17 */
2547     (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 18 */
2548     (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 19 */
2549     (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 20 */
2550     (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 21 */
2551     (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 22 */
2552     (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 23 */
2553     (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 24 */
2554     (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 25 */
2555     (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 26 */
2556     (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 27 */
2557     (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 28 */
2558     (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 29 */
2559     (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 30 */
2560     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 31 */
2561     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 32 */
2562     (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 33 */
2563     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 34 */
2564     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 35 */
2565     (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 36 */
2566     (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 37 */
2567     (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 38 */
2568     (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 39 */
2569     (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 40 */
2570     (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 41 */
2571     (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 42 */
2572     (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 43 */
2573     (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 44 */
2574     (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 45 */
2575     (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
2576     (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
2577     (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
2578     (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
2579     (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
2580     (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
2581     (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 52 */
2582     (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 53 */
2583     (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 54 */
2584     (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 55 */
2585     (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 56 */
2586     (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 57 */
2587     (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 58 */
2588     (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 59 */
2589     (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 60 */
2590     (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 61 */
2591     (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 62 */
2592     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 63 */
2593     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 64 */
2594     (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 65 */
2595     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 66 */
2596     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 67 */
2597     (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 68 */
2598     (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 69 */
2599     (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 70 */
2600     (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 71 */
2601     (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 72 */
2602     (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 73 */
2603     (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 74 */
2604     (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 75 */
2605     (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 76 */
2606     (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 77 */
2607     (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 78 */
2608     (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 79 */
2609     (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 80 */
2610     (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 81 */
2611     (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 82 */
2612     (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 83 */
2613     (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 84 */
2614     (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 85 */
2615     (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 86 */
2616     (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 87 */
2617     (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 88 */
2618     (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 89 */
2619     (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 90 */
2620     (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 91 */
2621     (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 92 */
2622     (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 93 */
2623     (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
2624     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
2625     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
2626     (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
2627     (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
2628     (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
2629     (PID.TID 0000.0001) 1.950254041626018E+05, /* I =100 */
2630     (PID.TID 0000.0001) 2.138410773065497E+05, /* I =101 */
2631     (PID.TID 0000.0001) 2.295958105911512E+05, /* I =102 */
2632     (PID.TID 0000.0001) 2.430829951739083E+05, /* I =103 */
2633     (PID.TID 0000.0001) 2.547526806712889E+05, /* I =104 */
2634     (PID.TID 0000.0001) 2.648750305193301E+05, /* I =105 */
2635     (PID.TID 0000.0001) 2.736173771018112E+05, /* I =106 */
2636     (PID.TID 0000.0001) 2.810845823202647E+05, /* I =107 */
2637     (PID.TID 0000.0001) 2.873420591008078E+05, /* I =108 */
2638     (PID.TID 0000.0001) 2.924298293668651E+05, /* I =109 */
2639     (PID.TID 0000.0001) 2.963715635865306E+05, /* I =110 */
2640     (PID.TID 0000.0001) 2.991805843171258E+05, /* I =111 */
2641     (PID.TID 0000.0001) 3.008638765647886E+05, /* I =112 */
2642     (PID.TID 0000.0001) 3.014246674484008E+05, /* I =113 */
2643     (PID.TID 0000.0001) 3.008638765647886E+05, /* I =114 */
2644     (PID.TID 0000.0001) 2.991805843171258E+05, /* I =115 */
2645     (PID.TID 0000.0001) 2.963715635865306E+05, /* I =116 */
2646     (PID.TID 0000.0001) 2.924298293668651E+05, /* I =117 */
2647     (PID.TID 0000.0001) 2.873420591008078E+05, /* I =118 */
2648     (PID.TID 0000.0001) 2.810845823202647E+05, /* I =119 */
2649     (PID.TID 0000.0001) 2.736173771018112E+05, /* I =120 */
2650     (PID.TID 0000.0001) 2.648750305193301E+05, /* I =121 */
2651     (PID.TID 0000.0001) 2.547526806712889E+05, /* I =122 */
2652     (PID.TID 0000.0001) 2.430829951739083E+05, /* I =123 */
2653     (PID.TID 0000.0001) 2.295958105911512E+05, /* I =124 */
2654     (PID.TID 0000.0001) 2.138410773065497E+05, /* I =125 */
2655     (PID.TID 0000.0001) 1.950254041626018E+05, /* I =126 */
2656     (PID.TID 0000.0001) 1.716197227386011E+05, /* I =127 */
2657     (PID.TID 0000.0001) 1.403701524205398E+05, /* I =128 */
2658     (PID.TID 0000.0001) 1.009837800879055E+05, /* I =129 */
2659     (PID.TID 0000.0001) 1.403701524205398E+05, /* I =130 */
2660     (PID.TID 0000.0001) 1.716197227386011E+05, /* I =131 */
2661     (PID.TID 0000.0001) 1.950254041626018E+05, /* I =132 */
2662     (PID.TID 0000.0001) 2.138410773065497E+05, /* I =133 */
2663     (PID.TID 0000.0001) 2.295958105911512E+05, /* I =134 */
2664     (PID.TID 0000.0001) 2.430829951739083E+05, /* I =135 */
2665     (PID.TID 0000.0001) 2.547526806712889E+05, /* I =136 */
2666     (PID.TID 0000.0001) 2.648750305193301E+05, /* I =137 */
2667     (PID.TID 0000.0001) 2.736173771018112E+05, /* I =138 */
2668     (PID.TID 0000.0001) 2.810845823202647E+05, /* I =139 */
2669     (PID.TID 0000.0001) 2.873420591008078E+05, /* I =140 */
2670     (PID.TID 0000.0001) 2.924298293668651E+05, /* I =141 */
2671     (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
2672     (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
2673     (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
2674     (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
2675     (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
2676     (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
2677     (PID.TID 0000.0001) 2.963715635865306E+05, /* I =148 */
2678     (PID.TID 0000.0001) 2.924298293668651E+05, /* I =149 */
2679     (PID.TID 0000.0001) 2.873420591008078E+05, /* I =150 */
2680     (PID.TID 0000.0001) 2.810845823202647E+05, /* I =151 */
2681     (PID.TID 0000.0001) 2.736173771018112E+05, /* I =152 */
2682     (PID.TID 0000.0001) 2.648750305193301E+05, /* I =153 */
2683     (PID.TID 0000.0001) 2.547526806712889E+05, /* I =154 */
2684     (PID.TID 0000.0001) 2.430829951739083E+05, /* I =155 */
2685     (PID.TID 0000.0001) 2.295958105911512E+05, /* I =156 */
2686     (PID.TID 0000.0001) 2.138410773065497E+05, /* I =157 */
2687     (PID.TID 0000.0001) 1.950254041626018E+05, /* I =158 */
2688     (PID.TID 0000.0001) 1.716197227386011E+05, /* I =159 */
2689     (PID.TID 0000.0001) 1.403701524205398E+05, /* I =160 */
2690     (PID.TID 0000.0001) 1.009837800879055E+05, /* I =161 */
2691     (PID.TID 0000.0001) 1.403701524205398E+05, /* I =162 */
2692     (PID.TID 0000.0001) 1.716197227386011E+05, /* I =163 */
2693     (PID.TID 0000.0001) 1.950254041626018E+05, /* I =164 */
2694     (PID.TID 0000.0001) 2.138410773065497E+05, /* I =165 */
2695     (PID.TID 0000.0001) 2.295958105911512E+05, /* I =166 */
2696     (PID.TID 0000.0001) 2.430829951739083E+05, /* I =167 */
2697     (PID.TID 0000.0001) 2.547526806712889E+05, /* I =168 */
2698     (PID.TID 0000.0001) 2.648750305193301E+05, /* I =169 */
2699     (PID.TID 0000.0001) 2.736173771018112E+05, /* I =170 */
2700     (PID.TID 0000.0001) 2.810845823202647E+05, /* I =171 */
2701     (PID.TID 0000.0001) 2.873420591008078E+05, /* I =172 */
2702     (PID.TID 0000.0001) 2.924298293668651E+05, /* I =173 */
2703     (PID.TID 0000.0001) 2.963715635865306E+05, /* I =174 */
2704     (PID.TID 0000.0001) 2.991805843171258E+05, /* I =175 */
2705     (PID.TID 0000.0001) 3.008638765647886E+05, /* I =176 */
2706     (PID.TID 0000.0001) 3.014246674484008E+05, /* I =177 */
2707     (PID.TID 0000.0001) 3.008638765647886E+05, /* I =178 */
2708     (PID.TID 0000.0001) 2.991805843171258E+05, /* I =179 */
2709     (PID.TID 0000.0001) 2.963715635865306E+05, /* I =180 */
2710     (PID.TID 0000.0001) 2.924298293668651E+05, /* I =181 */
2711     (PID.TID 0000.0001) 2.873420591008078E+05, /* I =182 */
2712     (PID.TID 0000.0001) 2.810845823202647E+05, /* I =183 */
2713     (PID.TID 0000.0001) 2.736173771018112E+05, /* I =184 */
2714     (PID.TID 0000.0001) 2.648750305193301E+05, /* I =185 */
2715     (PID.TID 0000.0001) 2.547526806712889E+05, /* I =186 */
2716     (PID.TID 0000.0001) 2.430829951739083E+05, /* I =187 */
2717     (PID.TID 0000.0001) 2.295958105911512E+05, /* I =188 */
2718     (PID.TID 0000.0001) 2.138410773065497E+05, /* I =189 */
2719     (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
2720     (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
2721     (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
2722     (PID.TID 0000.0001) ;
2723 jmc 1.2 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( units: m ) */
2724 jmc 1.1 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2725     (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
2726     (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
2727     (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
2728     (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
2729     (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
2730     (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
2731     (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
2732     (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
2733     (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
2734     (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
2735     (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
2736     (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
2737     (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
2738     (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
2739     (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
2740     (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
2741     (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
2742     (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
2743     (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
2744     (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
2745     (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
2746     (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
2747     (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
2748     (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
2749     (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
2750     (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
2751     (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
2752     (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
2753     (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
2754     (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
2755     (PID.TID 0000.0001) ;
2756 jmc 1.2 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( units: m ) */
2757 jmc 1.1 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2758     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
2759     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
2760     (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 4 */
2761     (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 5 */
2762     (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 6 */
2763     (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 7 */
2764     (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 8 */
2765     (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 9 */
2766     (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 10 */
2767     (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 11 */
2768     (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 12 */
2769     (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 13 */
2770     (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 14 */
2771     (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 15 */
2772     (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 16 */
2773     (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 17 */
2774     (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 18 */
2775     (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 19 */
2776     (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 20 */
2777     (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 21 */
2778     (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 22 */
2779     (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 23 */
2780     (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 24 */
2781     (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 25 */
2782     (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 26 */
2783     (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 27 */
2784     (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 28 */
2785     (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 29 */
2786     (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 30 */
2787     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 31 */
2788     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 32 */
2789     (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 33 */
2790     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 34 */
2791     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 35 */
2792     (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 36 */
2793     (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 37 */
2794     (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 38 */
2795     (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 39 */
2796     (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 40 */
2797     (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 41 */
2798     (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 42 */
2799     (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 43 */
2800     (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 44 */
2801     (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 45 */
2802     (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
2803     (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
2804     (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
2805     (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
2806     (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
2807     (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
2808     (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 52 */
2809     (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 53 */
2810     (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 54 */
2811     (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 55 */
2812     (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 56 */
2813     (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 57 */
2814     (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 58 */
2815     (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 59 */
2816     (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 60 */
2817     (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 61 */
2818     (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 62 */
2819     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 63 */
2820     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 64 */
2821     (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 65 */
2822     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 66 */
2823     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 67 */
2824     (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 68 */
2825     (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 69 */
2826     (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 70 */
2827     (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 71 */
2828     (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 72 */
2829     (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 73 */
2830     (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 74 */
2831     (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 75 */
2832     (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 76 */
2833     (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 77 */
2834     (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 78 */
2835     (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 79 */
2836     (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 80 */
2837     (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 81 */
2838     (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 82 */
2839     (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 83 */
2840     (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 84 */
2841     (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 85 */
2842     (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 86 */
2843     (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 87 */
2844     (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 88 */
2845     (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 89 */
2846     (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 90 */
2847     (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 91 */
2848     (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 92 */
2849     (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 93 */
2850     (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
2851     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
2852     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
2853     (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
2854     (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
2855     (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
2856     (PID.TID 0000.0001) 1.946503699269892E+05, /* I =100 */
2857     (PID.TID 0000.0001) 2.135964483342134E+05, /* I =101 */
2858     (PID.TID 0000.0001) 2.294195678257306E+05, /* I =102 */
2859     (PID.TID 0000.0001) 2.429464709770498E+05, /* I =103 */
2860     (PID.TID 0000.0001) 2.546408290696998E+05, /* I =104 */
2861     (PID.TID 0000.0001) 2.647791839299727E+05, /* I =105 */
2862     (PID.TID 0000.0001) 2.735321911346108E+05, /* I =106 */
2863     (PID.TID 0000.0001) 2.810065951609633E+05, /* I =107 */
2864     (PID.TID 0000.0001) 2.872689479506990E+05, /* I =108 */
2865     (PID.TID 0000.0001) 2.923599955312932E+05, /* I =109 */
2866     (PID.TID 0000.0001) 2.963038832565530E+05, /* I =110 */
2867     (PID.TID 0000.0001) 2.991142470004740E+05, /* I =111 */
2868     (PID.TID 0000.0001) 3.007982711627968E+05, /* I =112 */
2869     (PID.TID 0000.0001) 3.013593857228136E+05, /* I =113 */
2870     (PID.TID 0000.0001) 3.007982711627968E+05, /* I =114 */
2871     (PID.TID 0000.0001) 2.991142470004740E+05, /* I =115 */
2872     (PID.TID 0000.0001) 2.963038832565530E+05, /* I =116 */
2873     (PID.TID 0000.0001) 2.923599955312932E+05, /* I =117 */
2874     (PID.TID 0000.0001) 2.872689479506990E+05, /* I =118 */
2875     (PID.TID 0000.0001) 2.810065951609633E+05, /* I =119 */
2876     (PID.TID 0000.0001) 2.735321911346108E+05, /* I =120 */
2877     (PID.TID 0000.0001) 2.647791839299727E+05, /* I =121 */
2878     (PID.TID 0000.0001) 2.546408290696998E+05, /* I =122 */
2879     (PID.TID 0000.0001) 2.429464709770498E+05, /* I =123 */
2880     (PID.TID 0000.0001) 2.294195678257306E+05, /* I =124 */
2881     (PID.TID 0000.0001) 2.135964483342134E+05, /* I =125 */
2882     (PID.TID 0000.0001) 1.946503699269892E+05, /* I =126 */
2883     (PID.TID 0000.0001) 1.709574999026266E+05, /* I =127 */
2884     (PID.TID 0000.0001) 1.391343389937106E+05, /* I =128 */
2885     (PID.TID 0000.0001) 1.114203141013064E+05, /* I =129 */
2886     (PID.TID 0000.0001) 1.391343389937106E+05, /* I =130 */
2887     (PID.TID 0000.0001) 1.709574999026266E+05, /* I =131 */
2888     (PID.TID 0000.0001) 1.946503699269892E+05, /* I =132 */
2889     (PID.TID 0000.0001) 2.135964483342134E+05, /* I =133 */
2890     (PID.TID 0000.0001) 2.294195678257306E+05, /* I =134 */
2891     (PID.TID 0000.0001) 2.429464709770498E+05, /* I =135 */
2892     (PID.TID 0000.0001) 2.546408290696998E+05, /* I =136 */
2893     (PID.TID 0000.0001) 2.647791839299727E+05, /* I =137 */
2894     (PID.TID 0000.0001) 2.735321911346108E+05, /* I =138 */
2895     (PID.TID 0000.0001) 2.810065951609633E+05, /* I =139 */
2896     (PID.TID 0000.0001) 2.872689479506990E+05, /* I =140 */
2897     (PID.TID 0000.0001) 2.923599955312932E+05, /* I =141 */
2898     (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
2899     (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
2900     (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
2901     (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
2902     (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
2903     (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
2904     (PID.TID 0000.0001) 2.963038832565530E+05, /* I =148 */
2905     (PID.TID 0000.0001) 2.923599955312932E+05, /* I =149 */
2906     (PID.TID 0000.0001) 2.872689479506990E+05, /* I =150 */
2907     (PID.TID 0000.0001) 2.810065951609633E+05, /* I =151 */
2908     (PID.TID 0000.0001) 2.735321911346108E+05, /* I =152 */
2909     (PID.TID 0000.0001) 2.647791839299727E+05, /* I =153 */
2910     (PID.TID 0000.0001) 2.546408290696998E+05, /* I =154 */
2911     (PID.TID 0000.0001) 2.429464709770498E+05, /* I =155 */
2912     (PID.TID 0000.0001) 2.294195678257306E+05, /* I =156 */
2913     (PID.TID 0000.0001) 2.135964483342134E+05, /* I =157 */
2914     (PID.TID 0000.0001) 1.946503699269892E+05, /* I =158 */
2915     (PID.TID 0000.0001) 1.709574999026266E+05, /* I =159 */
2916     (PID.TID 0000.0001) 1.391343389937106E+05, /* I =160 */
2917     (PID.TID 0000.0001) 1.114203141013064E+05, /* I =161 */
2918     (PID.TID 0000.0001) 1.391343389937106E+05, /* I =162 */
2919     (PID.TID 0000.0001) 1.709574999026266E+05, /* I =163 */
2920     (PID.TID 0000.0001) 1.946503699269892E+05, /* I =164 */
2921     (PID.TID 0000.0001) 2.135964483342134E+05, /* I =165 */
2922     (PID.TID 0000.0001) 2.294195678257306E+05, /* I =166 */
2923     (PID.TID 0000.0001) 2.429464709770498E+05, /* I =167 */
2924     (PID.TID 0000.0001) 2.546408290696998E+05, /* I =168 */
2925     (PID.TID 0000.0001) 2.647791839299727E+05, /* I =169 */
2926     (PID.TID 0000.0001) 2.735321911346108E+05, /* I =170 */
2927     (PID.TID 0000.0001) 2.810065951609633E+05, /* I =171 */
2928     (PID.TID 0000.0001) 2.872689479506990E+05, /* I =172 */
2929     (PID.TID 0000.0001) 2.923599955312932E+05, /* I =173 */
2930     (PID.TID 0000.0001) 2.963038832565530E+05, /* I =174 */
2931     (PID.TID 0000.0001) 2.991142470004740E+05, /* I =175 */
2932     (PID.TID 0000.0001) 3.007982711627968E+05, /* I =176 */
2933     (PID.TID 0000.0001) 3.013593857228136E+05, /* I =177 */
2934     (PID.TID 0000.0001) 3.007982711627968E+05, /* I =178 */
2935     (PID.TID 0000.0001) 2.991142470004740E+05, /* I =179 */
2936     (PID.TID 0000.0001) 2.963038832565530E+05, /* I =180 */
2937     (PID.TID 0000.0001) 2.923599955312932E+05, /* I =181 */
2938     (PID.TID 0000.0001) 2.872689479506990E+05, /* I =182 */
2939     (PID.TID 0000.0001) 2.810065951609633E+05, /* I =183 */
2940     (PID.TID 0000.0001) 2.735321911346108E+05, /* I =184 */
2941     (PID.TID 0000.0001) 2.647791839299727E+05, /* I =185 */
2942     (PID.TID 0000.0001) 2.546408290696998E+05, /* I =186 */
2943     (PID.TID 0000.0001) 2.429464709770498E+05, /* I =187 */
2944     (PID.TID 0000.0001) 2.294195678257306E+05, /* I =188 */
2945     (PID.TID 0000.0001) 2.135964483342134E+05, /* I =189 */
2946     (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
2947     (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
2948     (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
2949     (PID.TID 0000.0001) ;
2950 jmc 1.2 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( units: m ) */
2951 jmc 1.1 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2952     (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
2953     (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
2954     (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
2955     (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
2956     (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
2957     (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
2958     (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
2959     (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
2960     (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
2961     (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
2962     (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
2963     (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
2964     (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
2965     (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
2966     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
2967     (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
2968     (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
2969     (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
2970     (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
2971     (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
2972     (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
2973     (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
2974     (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
2975     (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
2976     (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
2977     (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
2978     (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
2979     (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
2980     (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
2981     (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
2982     (PID.TID 0000.0001) ;
2983 jmc 1.2 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( units: m ) */
2984 jmc 1.1 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2985     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
2986     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
2987     (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 4 */
2988     (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 5 */
2989     (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 6 */
2990     (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 7 */
2991     (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 8 */
2992     (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 9 */
2993     (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 10 */
2994     (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 11 */
2995     (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 12 */
2996     (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 13 */
2997     (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 14 */
2998     (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 15 */
2999     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 16: 17 */
3000     (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 18 */
3001     (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 19 */
3002     (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 20 */
3003     (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 21 */
3004     (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 22 */
3005     (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 23 */
3006     (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 24 */
3007     (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 25 */
3008     (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 26 */
3009     (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 27 */
3010     (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 28 */
3011     (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 29 */
3012     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 30 */
3013     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 31 */
3014     (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 32: 33 */
3015     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 34 */
3016     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 35 */
3017     (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 36 */
3018     (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 37 */
3019     (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 38 */
3020     (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 39 */
3021     (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 40 */
3022     (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 41 */
3023     (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 42 */
3024     (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 43 */
3025     (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 44 */
3026     (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 45 */
3027     (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
3028     (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
3029     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 48: 49 */
3030     (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
3031     (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
3032     (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 52 */
3033     (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 53 */
3034     (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 54 */
3035     (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 55 */
3036     (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 56 */
3037     (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 57 */
3038     (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 58 */
3039     (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 59 */
3040     (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 60 */
3041     (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 61 */
3042     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 62 */
3043     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 63 */
3044     (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 64: 65 */
3045     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 66 */
3046     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 67 */
3047     (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 68 */
3048     (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 69 */
3049     (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 70 */
3050     (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 71 */
3051     (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 72 */
3052     (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 73 */
3053     (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 74 */
3054     (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 75 */
3055     (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 76 */
3056     (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 77 */
3057     (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 78 */
3058     (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 79 */
3059     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 80: 81 */
3060     (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 82 */
3061     (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 83 */
3062     (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 84 */
3063     (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 85 */
3064     (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 86 */
3065     (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 87 */
3066     (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 88 */
3067     (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 89 */
3068     (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 90 */
3069     (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 91 */
3070     (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 92 */
3071     (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 93 */
3072     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
3073     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
3074     (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 96: 97 */
3075     (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
3076     (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
3077     (PID.TID 0000.0001) 2.042717761866506E+05, /* I =100 */
3078     (PID.TID 0000.0001) 2.216367828252819E+05, /* I =101 */
3079     (PID.TID 0000.0001) 2.363029564123586E+05, /* I =102 */
3080     (PID.TID 0000.0001) 2.489113743322025E+05, /* I =103 */
3081     (PID.TID 0000.0001) 2.598293319150326E+05, /* I =104 */
3082     (PID.TID 0000.0001) 2.692787333338535E+05, /* I =105 */
3083     (PID.TID 0000.0001) 2.773972106720365E+05, /* I =106 */
3084     (PID.TID 0000.0001) 2.842706922224557E+05, /* I =107 */
3085     (PID.TID 0000.0001) 2.899523122489403E+05, /* I =108 */
3086     (PID.TID 0000.0001) 2.944741346384699E+05, /* I =109 */
3087     (PID.TID 0000.0001) 2.978547649292580E+05, /* I =110 */
3088     (PID.TID 0000.0001) 3.001044073506459E+05, /* I =111 */
3089     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =112:113 */
3090     (PID.TID 0000.0001) 3.001044073506459E+05, /* I =114 */
3091     (PID.TID 0000.0001) 2.978547649292580E+05, /* I =115 */
3092     (PID.TID 0000.0001) 2.944741346384699E+05, /* I =116 */
3093     (PID.TID 0000.0001) 2.899523122489403E+05, /* I =117 */
3094     (PID.TID 0000.0001) 2.842706922224557E+05, /* I =118 */
3095     (PID.TID 0000.0001) 2.773972106720365E+05, /* I =119 */
3096     (PID.TID 0000.0001) 2.692787333338535E+05, /* I =120 */
3097     (PID.TID 0000.0001) 2.598293319150326E+05, /* I =121 */
3098     (PID.TID 0000.0001) 2.489113743322025E+05, /* I =122 */
3099     (PID.TID 0000.0001) 2.363029564123586E+05, /* I =123 */
3100     (PID.TID 0000.0001) 2.216367828252819E+05, /* I =124 */
3101     (PID.TID 0000.0001) 2.042717761866506E+05, /* I =125 */
3102     (PID.TID 0000.0001) 1.829777599966776E+05, /* I =126 */
3103     (PID.TID 0000.0001) 1.549545757850771E+05, /* I =127 */
3104     (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =128:129 */
3105     (PID.TID 0000.0001) 1.549545757850771E+05, /* I =130 */
3106     (PID.TID 0000.0001) 1.829777599966776E+05, /* I =131 */
3107     (PID.TID 0000.0001) 2.042717761866506E+05, /* I =132 */
3108     (PID.TID 0000.0001) 2.216367828252819E+05, /* I =133 */
3109     (PID.TID 0000.0001) 2.363029564123586E+05, /* I =134 */
3110     (PID.TID 0000.0001) 2.489113743322025E+05, /* I =135 */
3111     (PID.TID 0000.0001) 2.598293319150326E+05, /* I =136 */
3112     (PID.TID 0000.0001) 2.692787333338535E+05, /* I =137 */
3113     (PID.TID 0000.0001) 2.773972106720365E+05, /* I =138 */
3114     (PID.TID 0000.0001) 2.842706922224557E+05, /* I =139 */
3115     (PID.TID 0000.0001) 2.899523122489403E+05, /* I =140 */
3116     (PID.TID 0000.0001) 2.944741346384699E+05, /* I =141 */
3117     (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
3118     (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
3119     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =144:145 */
3120     (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
3121     (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
3122     (PID.TID 0000.0001) 2.944741346384699E+05, /* I =148 */
3123     (PID.TID 0000.0001) 2.899523122489403E+05, /* I =149 */
3124     (PID.TID 0000.0001) 2.842706922224557E+05, /* I =150 */
3125     (PID.TID 0000.0001) 2.773972106720365E+05, /* I =151 */
3126     (PID.TID 0000.0001) 2.692787333338535E+05, /* I =152 */
3127     (PID.TID 0000.0001) 2.598293319150326E+05, /* I =153 */
3128     (PID.TID 0000.0001) 2.489113743322025E+05, /* I =154 */
3129     (PID.TID 0000.0001) 2.363029564123586E+05, /* I =155 */
3130     (PID.TID 0000.0001) 2.216367828252819E+05, /* I =156 */
3131     (PID.TID 0000.0001) 2.042717761866506E+05, /* I =157 */
3132     (PID.TID 0000.0001) 1.829777599966776E+05, /* I =158 */
3133     (PID.TID 0000.0001) 1.549545757850771E+05, /* I =159 */
3134     (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =160:161 */
3135     (PID.TID 0000.0001) 1.549545757850771E+05, /* I =162 */
3136     (PID.TID 0000.0001) 1.829777599966776E+05, /* I =163 */
3137     (PID.TID 0000.0001) 2.042717761866506E+05, /* I =164 */
3138     (PID.TID 0000.0001) 2.216367828252819E+05, /* I =165 */
3139     (PID.TID 0000.0001) 2.363029564123586E+05, /* I =166 */
3140     (PID.TID 0000.0001) 2.489113743322025E+05, /* I =167 */
3141     (PID.TID 0000.0001) 2.598293319150326E+05, /* I =168 */
3142     (PID.TID 0000.0001) 2.692787333338535E+05, /* I =169 */
3143     (PID.TID 0000.0001) 2.773972106720365E+05, /* I =170 */
3144     (PID.TID 0000.0001) 2.842706922224557E+05, /* I =171 */
3145     (PID.TID 0000.0001) 2.899523122489403E+05, /* I =172 */
3146     (PID.TID 0000.0001) 2.944741346384699E+05, /* I =173 */
3147     (PID.TID 0000.0001) 2.978547649292580E+05, /* I =174 */
3148     (PID.TID 0000.0001) 3.001044073506459E+05, /* I =175 */
3149     (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =176:177 */
3150     (PID.TID 0000.0001) 3.001044073506459E+05, /* I =178 */
3151     (PID.TID 0000.0001) 2.978547649292580E+05, /* I =179 */
3152     (PID.TID 0000.0001) 2.944741346384699E+05, /* I =180 */
3153     (PID.TID 0000.0001) 2.899523122489403E+05, /* I =181 */
3154     (PID.TID 0000.0001) 2.842706922224557E+05, /* I =182 */
3155     (PID.TID 0000.0001) 2.773972106720365E+05, /* I =183 */
3156     (PID.TID 0000.0001) 2.692787333338535E+05, /* I =184 */
3157     (PID.TID 0000.0001) 2.598293319150326E+05, /* I =185 */
3158     (PID.TID 0000.0001) 2.489113743322025E+05, /* I =186 */
3159     (PID.TID 0000.0001) 2.363029564123586E+05, /* I =187 */
3160     (PID.TID 0000.0001) 2.216367828252819E+05, /* I =188 */
3161     (PID.TID 0000.0001) 2.042717761866506E+05, /* I =189 */
3162     (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
3163     (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
3164     (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
3165     (PID.TID 0000.0001) ;
3166 jmc 1.2 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( units: m ) */
3167 jmc 1.1 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
3168     (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
3169     (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
3170     (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
3171     (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
3172     (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
3173     (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
3174     (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
3175     (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
3176     (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
3177     (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
3178     (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
3179     (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
3180     (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
3181     (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
3182     (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
3183     (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
3184     (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
3185     (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
3186     (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
3187     (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
3188     (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
3189     (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
3190     (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
3191     (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
3192     (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
3193     (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
3194     (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
3195     (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
3196     (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
3197     (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
3198     (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
3199     (PID.TID 0000.0001) ;
3200 jmc 1.2 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( units: m ) */
3201 jmc 1.1 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
3202     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
3203     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
3204     (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 4 */
3205     (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 5 */
3206     (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 6 */
3207     (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 7 */
3208     (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 8 */
3209     (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 9 */
3210     (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 10 */
3211     (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 11 */
3212     (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 12 */
3213     (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 13 */
3214     (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 14 */
3215     (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 15 */
3216     (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 16 */
3217     (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 17 */
3218     (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 18 */
3219     (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 19 */
3220     (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 20 */
3221     (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 21 */
3222     (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 22 */
3223     (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 23 */
3224     (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 24 */
3225     (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 25 */
3226     (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 26 */
3227     (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 27 */
3228     (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 28 */
3229     (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 29 */
3230     (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 30 */
3231     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 31 */
3232     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 32 */
3233     (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
3234     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 34 */
3235     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 35 */
3236     (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 36 */
3237     (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 37 */
3238     (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 38 */
3239     (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 39 */
3240     (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 40 */
3241     (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 41 */
3242     (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 42 */
3243     (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 43 */
3244     (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 44 */
3245     (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 45 */
3246     (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
3247     (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
3248     (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
3249     (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
3250     (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
3251     (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
3252     (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 52 */
3253     (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 53 */
3254     (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 54 */
3255     (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 55 */
3256     (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 56 */
3257     (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 57 */
3258     (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 58 */
3259     (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 59 */
3260     (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 60 */
3261     (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 61 */
3262     (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 62 */
3263     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 63 */
3264     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 64 */
3265     (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3266     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 66 */
3267     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 67 */
3268     (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 68 */
3269     (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 69 */
3270     (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 70 */
3271     (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 71 */
3272     (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 72 */
3273     (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 73 */
3274     (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 74 */
3275     (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 75 */
3276     (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 76 */
3277     (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 77 */
3278     (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 78 */
3279     (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 79 */
3280     (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 80 */
3281     (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 81 */
3282     (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 82 */
3283     (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 83 */
3284     (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 84 */
3285     (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 85 */
3286     (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 86 */
3287     (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 87 */
3288     (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 88 */
3289     (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 89 */
3290     (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 90 */
3291     (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 91 */
3292     (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 92 */
3293     (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 93 */
3294     (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
3295     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
3296     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
3297     (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3298     (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
3299     (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
3300     (PID.TID 0000.0001) 1.937548202849060E+05, /* I =100 */
3301     (PID.TID 0000.0001) 2.130490056267208E+05, /* I =101 */
3302     (PID.TID 0000.0001) 2.290479919481738E+05, /* I =102 */
3303     (PID.TID 0000.0001) 2.426774358027003E+05, /* I =103 */
3304     (PID.TID 0000.0001) 2.544372984215561E+05, /* I =104 */
3305     (PID.TID 0000.0001) 2.646201463834826E+05, /* I =105 */
3306     (PID.TID 0000.0001) 2.734046499619031E+05, /* I =106 */
3307     (PID.TID 0000.0001) 2.809019351693761E+05, /* I =107 */
3308     (PID.TID 0000.0001) 2.871811105274442E+05, /* I =108 */
3309     (PID.TID 0000.0001) 2.922844849381675E+05, /* I =109 */
3310     (PID.TID 0000.0001) 2.962371870847826E+05, /* I =110 */
3311     (PID.TID 0000.0001) 2.990534755671296E+05, /* I =111 */
3312     (PID.TID 0000.0001) 3.007409169495504E+05, /* I =112 */
3313     (PID.TID 0000.0001) 3.013031486919771E+05, /* I =113 */
3314     (PID.TID 0000.0001) 3.007409169495504E+05, /* I =114 */
3315     (PID.TID 0000.0001) 2.990534755671296E+05, /* I =115 */
3316     (PID.TID 0000.0001) 2.962371870847826E+05, /* I =116 */
3317     (PID.TID 0000.0001) 2.922844849381675E+05, /* I =117 */
3318     (PID.TID 0000.0001) 2.871811105274442E+05, /* I =118 */
3319     (PID.TID 0000.0001) 2.809019351693761E+05, /* I =119 */
3320     (PID.TID 0000.0001) 2.734046499619031E+05, /* I =120 */
3321     (PID.TID 0000.0001) 2.646201463834826E+05, /* I =121 */
3322     (PID.TID 0000.0001) 2.544372984215561E+05, /* I =122 */
3323     (PID.TID 0000.0001) 2.426774358027003E+05, /* I =123 */
3324     (PID.TID 0000.0001) 2.290479919481738E+05, /* I =124 */
3325     (PID.TID 0000.0001) 2.130490056267208E+05, /* I =125 */
3326     (PID.TID 0000.0001) 1.937548202849060E+05, /* I =126 */
3327     (PID.TID 0000.0001) 1.691744868129062E+05, /* I =127 */
3328     (PID.TID 0000.0001) 1.333130744933864E+05, /* I =128 */
3329     (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3330     (PID.TID 0000.0001) 1.333130744933864E+05, /* I =130 */
3331     (PID.TID 0000.0001) 1.691744868129062E+05, /* I =131 */
3332     (PID.TID 0000.0001) 1.937548202849060E+05, /* I =132 */
3333     (PID.TID 0000.0001) 2.130490056267208E+05, /* I =133 */
3334     (PID.TID 0000.0001) 2.290479919481738E+05, /* I =134 */
3335     (PID.TID 0000.0001) 2.426774358027003E+05, /* I =135 */
3336     (PID.TID 0000.0001) 2.544372984215561E+05, /* I =136 */
3337     (PID.TID 0000.0001) 2.646201463834826E+05, /* I =137 */
3338     (PID.TID 0000.0001) 2.734046499619031E+05, /* I =138 */
3339     (PID.TID 0000.0001) 2.809019351693761E+05, /* I =139 */
3340     (PID.TID 0000.0001) 2.871811105274442E+05, /* I =140 */
3341     (PID.TID 0000.0001) 2.922844849381675E+05, /* I =141 */
3342     (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
3343     (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
3344     (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
3345     (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
3346     (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
3347     (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
3348     (PID.TID 0000.0001) 2.962371870847826E+05, /* I =148 */
3349     (PID.TID 0000.0001) 2.922844849381675E+05, /* I =149 */
3350     (PID.TID 0000.0001) 2.871811105274442E+05, /* I =150 */
3351     (PID.TID 0000.0001) 2.809019351693761E+05, /* I =151 */
3352     (PID.TID 0000.0001) 2.734046499619031E+05, /* I =152 */
3353     (PID.TID 0000.0001) 2.646201463834826E+05, /* I =153 */
3354     (PID.TID 0000.0001) 2.544372984215561E+05, /* I =154 */
3355     (PID.TID 0000.0001) 2.426774358027003E+05, /* I =155 */
3356     (PID.TID 0000.0001) 2.290479919481738E+05, /* I =156 */
3357     (PID.TID 0000.0001) 2.130490056267208E+05, /* I =157 */
3358     (PID.TID 0000.0001) 1.937548202849060E+05, /* I =158 */
3359     (PID.TID 0000.0001) 1.691744868129062E+05, /* I =159 */
3360     (PID.TID 0000.0001) 1.333130744933864E+05, /* I =160 */
3361     (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3362     (PID.TID 0000.0001) 1.333130744933864E+05, /* I =162 */
3363     (PID.TID 0000.0001) 1.691744868129062E+05, /* I =163 */
3364     (PID.TID 0000.0001) 1.937548202849060E+05, /* I =164 */
3365     (PID.TID 0000.0001) 2.130490056267208E+05, /* I =165 */
3366     (PID.TID 0000.0001) 2.290479919481738E+05, /* I =166 */
3367     (PID.TID 0000.0001) 2.426774358027003E+05, /* I =167 */
3368     (PID.TID 0000.0001) 2.544372984215561E+05, /* I =168 */
3369     (PID.TID 0000.0001) 2.646201463834826E+05, /* I =169 */
3370     (PID.TID 0000.0001) 2.734046499619031E+05, /* I =170 */
3371     (PID.TID 0000.0001) 2.809019351693761E+05, /* I =171 */
3372     (PID.TID 0000.0001) 2.871811105274442E+05, /* I =172 */
3373     (PID.TID 0000.0001) 2.922844849381675E+05, /* I =173 */
3374     (PID.TID 0000.0001) 2.962371870847826E+05, /* I =174 */
3375     (PID.TID 0000.0001) 2.990534755671296E+05, /* I =175 */
3376     (PID.TID 0000.0001) 3.007409169495504E+05, /* I =176 */
3377     (PID.TID 0000.0001) 3.013031486919771E+05, /* I =177 */
3378     (PID.TID 0000.0001) 3.007409169495504E+05, /* I =178 */
3379     (PID.TID 0000.0001) 2.990534755671296E+05, /* I =179 */
3380     (PID.TID 0000.0001) 2.962371870847826E+05, /* I =180 */
3381     (PID.TID 0000.0001) 2.922844849381675E+05, /* I =181 */
3382     (PID.TID 0000.0001) 2.871811105274442E+05, /* I =182 */
3383     (PID.TID 0000.0001) 2.809019351693761E+05, /* I =183 */
3384     (PID.TID 0000.0001) 2.734046499619031E+05, /* I =184 */
3385     (PID.TID 0000.0001) 2.646201463834826E+05, /* I =185 */
3386     (PID.TID 0000.0001) 2.544372984215561E+05, /* I =186 */
3387     (PID.TID 0000.0001) 2.426774358027003E+05, /* I =187 */
3388     (PID.TID 0000.0001) 2.290479919481738E+05, /* I =188 */
3389     (PID.TID 0000.0001) 2.130490056267208E+05, /* I =189 */
3390     (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
3391     (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
3392     (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
3393     (PID.TID 0000.0001) ;
3394 jmc 1.2 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( units: m ) */
3395 jmc 1.1 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3396     (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
3397     (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
3398     (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
3399     (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
3400     (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
3401     (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
3402     (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
3403     (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
3404     (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
3405     (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
3406     (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
3407     (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
3408     (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
3409     (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
3410     (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
3411     (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
3412     (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
3413     (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
3414     (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
3415     (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
3416     (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
3417     (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
3418     (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
3419     (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
3420     (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
3421     (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
3422     (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
3423     (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
3424     (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
3425     (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
3426     (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
3427     (PID.TID 0000.0001) ;
3428 jmc 1.2 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( units: m ) */
3429 jmc 1.1 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
3430     (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
3431     (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
3432     (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 4 */
3433     (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 5 */
3434     (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 6 */
3435     (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 7 */
3436     (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 8 */
3437     (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 9 */
3438     (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 10 */
3439     (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 11 */
3440     (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 12 */
3441     (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 13 */
3442     (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 14 */
3443     (PID.TID 0000.0001)