/[MITgcm]/MITgcm/verification/exp5/results/output.txt
ViewVC logotype

Annotation of /MITgcm/verification/exp5/results/output.txt

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph


Revision 1.1 - (hide annotations) (download)
Mon Mar 22 16:22:05 1999 UTC (22 years, 4 months ago) by adcroft
Branch: MAIN
CVS Tags: checkpoint34, branch-atmos-merge-zonalfilt, checkpoint26, branch-atmos-merge-phase6, checkpoint20, checkpoint21, checkpoint22, checkpoint24, checkpoint27, checkpoint33, branch-atmos-merge-shapiro, checkpoint25, branch-atmos-merge-phase3, checkpoint29, checkpoint28, branch-atmos-merge-phase5, branch-atmos-merge-phase4, branch-atmos-merge-phase7, branch-atmos-merge-phase1, checkpoint32, checkpoint31, checkpoint23, checkpoint30, branch-atmos-merge-phase2, branch-atmos-merge-start
Branch point for: branch-atmos-merge
File MIME type: text/plain
New experiment: convection with doubly periodic boundaries.

1 adcroft 1.1 (PID.TID 0000.0001)
2     (PID.TID 0000.0001) // ======================================================
3     (PID.TID 0000.0001) // MITgcm UV
4     (PID.TID 0000.0001) // =========
5     (PID.TID 0000.0001) // ======================================================
6     (PID.TID 0000.0001) // execution environment starting up...
7     (PID.TID 0000.0001) // Run starting Wed Apr 1 14:19:48 1998
8     (PID.TID 0000.0001) // on melville.lcs.mit.edu
9     (PID.TID 0000.0001) // account cnh
10     (PID.TID 0000.0001) // MITgcm UV Release: $Name: $
11     (PID.TID 0000.0001)
12     (PID.TID 0000.0001) // =======================================================
13     (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
14     (PID.TID 0000.0001) // =======================================================
15     (PID.TID 0000.0001) ># Example "eedata" file
16     (PID.TID 0000.0001) ># Lines beginning "#" are comments
17     (PID.TID 0000.0001) ># nTx - No. threads per process in X
18     (PID.TID 0000.0001) ># nTy - No. threads per process in Y
19     (PID.TID 0000.0001) > &EEPARMS
20     (PID.TID 0000.0001) > &
21     (PID.TID 0000.0001) ># Note: Some systems use & as the
22     (PID.TID 0000.0001) ># namelist terminator. Other systems
23     (PID.TID 0000.0001) ># use a / character (as shown here).
24     (PID.TID 0000.0001)
25     (PID.TID 0000.0001) // =======================================================
26     (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
27     (PID.TID 0000.0001) // ( and "eedata" )
28     (PID.TID 0000.0001) // =======================================================
29     (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
30     (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
31     (PID.TID 0000.0001) nSx = 1 ; /* No. tiles in X per process */
32     (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
33     (PID.TID 0000.0001) sNx = 64 ; /* Tile size in X */
34     (PID.TID 0000.0001) sNy = 64 ; /* Tile size in Y */
35     (PID.TID 0000.0001) OLx = 3 ; /* Tile overlap distance in X */
36     (PID.TID 0000.0001) OLy = 3 ; /* Tile overlap distance in Y */
37     (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
38     (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
39     (PID.TID 0000.0001) Nr = 20 ; /* No. levels in the vertical */
40     (PID.TID 0000.0001) nX = 64 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
41     (PID.TID 0000.0001) nY = 64 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
42     (PID.TID 0000.0001) nTiles = 1 ; /* Total no. tiles per process ( = nSx*nSy ) */
43     (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
44     (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
45     (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
46     (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
47     (PID.TID 0000.0001) /* it must be launched appropriately e.g */
48     (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
49     (PID.TID 0000.0001)
50     (PID.TID 0000.0001) // ======================================================
51     (PID.TID 0000.0001) // Mapping of tiles to threads
52     (PID.TID 0000.0001) // ======================================================
53     (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 1, 1: 1)
54     (PID.TID 0000.0001)
55     (PID.TID 0000.0001) // ======================================================
56     (PID.TID 0000.0001) // Tile <-> Tile connectvity table
57     (PID.TID 0000.0001) // ======================================================
58     (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000001)
59     (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000001, Comm = put
60     (PID.TID 0000.0001) // bi = 000001, bj = 000001
61     (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000001, Comm = put
62     (PID.TID 0000.0001) // bi = 000001, bj = 000001
63     (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000001, Comm = put
64     (PID.TID 0000.0001) // bi = 000001, bj = 000001
65     (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000001, Comm = put
66     (PID.TID 0000.0001) // bi = 000001, bj = 000001
67     (PID.TID 0000.0001)
68     (PID.TID 0000.0001) // =======================================================
69     (PID.TID 0000.0001) // Model parameter file "data"
70     (PID.TID 0000.0001) // =======================================================
71     (PID.TID 0000.0001) ># ====================
72     (PID.TID 0000.0001) ># | Model parameters |
73     (PID.TID 0000.0001) ># ====================
74     (PID.TID 0000.0001) >#
75     (PID.TID 0000.0001) ># Continuous equation parameters
76     (PID.TID 0000.0001) > &PARM01
77     (PID.TID 0000.0001) > tRef=20*0.
78     (PID.TID 0000.0001) > sRef=20*35.,
79     (PID.TID 0000.0001) > viscAh=1.E0,
80     (PID.TID 0000.0001) > viscAz=1.E0,
81     (PID.TID 0000.0001) > no_slip_sides=.FALSE.,
82     (PID.TID 0000.0001) > no_slip_bottom=.FALSE.,
83     (PID.TID 0000.0001) > viscA4=0.E12,
84     (PID.TID 0000.0001) > diffKhT=1.E0,
85     (PID.TID 0000.0001) > diffKzT=1.E0,
86     (PID.TID 0000.0001) > diffKhS=1.E0,
87     (PID.TID 0000.0001) > diffKzS=1.E0,
88     (PID.TID 0000.0001) > GMkBackground=0.,
89     (PID.TID 0000.0001) > f0=1250.,
90     (PID.TID 0000.0001) > beta=0.E-11,
91     (PID.TID 0000.0001) > tAlpha=1.,
92     (PID.TID 0000.0001) > sBeta =0.,
93     (PID.TID 0000.0001) > gravity=1.4E8,
94     (PID.TID 0000.0001) > rhoConst=1.,
95     (PID.TID 0000.0001) > rhoNil=1.,
96     (PID.TID 0000.0001) > heatCapacity_Cp=1.,
97     (PID.TID 0000.0001) > rigidLid=.FALSE.,
98     (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
99     (PID.TID 0000.0001) > eosType='LINEAR',
100     (PID.TID 0000.0001) > openBoundaries=.FALSE.,
101     (PID.TID 0000.0001) > nonHydrostatic=.TRUE.,
102     (PID.TID 0000.0001) > readBinaryPrec=64,
103     (PID.TID 0000.0001) > &
104     (PID.TID 0000.0001) >
105     (PID.TID 0000.0001) ># Elliptic solver parameters
106     (PID.TID 0000.0001) > &PARM02
107     (PID.TID 0000.0001) > cg2dMaxIters=1000,
108     (PID.TID 0000.0001) > cg2dTargetResidual=1.E-9,
109     (PID.TID 0000.0001) > cg3dMaxIters=40,
110     (PID.TID 0000.0001) > cg3dTargetResidual=1.E-9,
111     (PID.TID 0000.0001) > &
112     (PID.TID 0000.0001) >
113     (PID.TID 0000.0001) ># Time stepping parameters
114     (PID.TID 0000.0001) > &PARM03
115     (PID.TID 0000.0001) > nIter0=0,
116     (PID.TID 0000.0001) > nTimeSteps=10,
117     (PID.TID 0000.0001) > deltaT=2.0E-4,
118     (PID.TID 0000.0001) > abEps=0.1,
119     (PID.TID 0000.0001) > pChkptFreq=0.0,
120     (PID.TID 0000.0001) > chkptFreq=0.0,
121     (PID.TID 0000.0001) > dumpFreq=0.1,
122     (PID.TID 0000.0001) > &
123     (PID.TID 0000.0001) >
124     (PID.TID 0000.0001) ># Gridding parameters
125     (PID.TID 0000.0001) > &PARM04
126     (PID.TID 0000.0001) > usingCartesianGrid=.TRUE.,
127     (PID.TID 0000.0001) > usingSphericalPolarGrid=.FALSE.,
128     (PID.TID 0000.0001) > dXspacing=0.0625,
129     (PID.TID 0000.0001) > dYspacing=0.0625,
130     (PID.TID 0000.0001) > delZ=20*0.1,
131     (PID.TID 0000.0001) > &
132     (PID.TID 0000.0001) >
133     (PID.TID 0000.0001) ># Input datasets
134     (PID.TID 0000.0001) > &PARM05
135     (PID.TID 0000.0001) > surfQfile='Qnet.circle',
136     (PID.TID 0000.0001) > &
137     (PID.TID 0000.0001) >
138     (PID.TID 0000.0001) ># Open-boundaries
139     (PID.TID 0000.0001) > &PARM06
140     (PID.TID 0000.0001) > &
141     (PID.TID 0000.0001)
142     (PID.TID 0000.0001) // =======================================================
143     (PID.TID 0000.0001) // Field Model depths at iteration 1
144     (PID.TID 0000.0001) // CMIN = -2.000000000000000E+00
145     (PID.TID 0000.0001) // CMAX = -2.000000000000000E+00
146     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
147     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
148     (PID.TID 0000.0001) // 0.0: .
149     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 67: 1)
150     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 67: -2: -1)
151     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
152     (PID.TID 0000.0001) // =======================================================
153     (PID.TID 0000.0001) K = 1
154     (PID.TID 0000.0001) // I=7 I=17 I=27 I=37 I=47 I=57 I=67
155     (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123456|890123456|890123456|890123456|
156     (PID.TID 0000.0001) // 67 ----------------------------------------------------------------------
157     (PID.TID 0000.0001) // 66 ----------------------------------------------------------------------
158     (PID.TID 0000.0001) // 65 ----------------------------------------------------------------------
159     (PID.TID 0000.0001) // 64 ----------------------------------------------------------------------
160     (PID.TID 0000.0001) // 63 ----------------------------------------------------------------------
161     (PID.TID 0000.0001) // 62 ----------------------------------------------------------------------
162     (PID.TID 0000.0001) // 61 ----------------------------------------------------------------------
163     (PID.TID 0000.0001) // 60 ----------------------------------------------------------------------
164     (PID.TID 0000.0001) // 59 ----------------------------------------------------------------------
165     (PID.TID 0000.0001) // 58 ----------------------------------------------------------------------
166     (PID.TID 0000.0001) // 57 ----------------------------------------------------------------------
167     (PID.TID 0000.0001) // 56 ----------------------------------------------------------------------
168     (PID.TID 0000.0001) // 55 ----------------------------------------------------------------------
169     (PID.TID 0000.0001) // 54 ----------------------------------------------------------------------
170     (PID.TID 0000.0001) // 53 ----------------------------------------------------------------------
171     (PID.TID 0000.0001) // 52 ----------------------------------------------------------------------
172     (PID.TID 0000.0001) // 51 ----------------------------------------------------------------------
173     (PID.TID 0000.0001) // 50 ----------------------------------------------------------------------
174     (PID.TID 0000.0001) // 49 ----------------------------------------------------------------------
175     (PID.TID 0000.0001) // 48 ----------------------------------------------------------------------
176     (PID.TID 0000.0001) // 47 ----------------------------------------------------------------------
177     (PID.TID 0000.0001) // 46 ----------------------------------------------------------------------
178     (PID.TID 0000.0001) // 45 ----------------------------------------------------------------------
179     (PID.TID 0000.0001) // 44 ----------------------------------------------------------------------
180     (PID.TID 0000.0001) // 43 ----------------------------------------------------------------------
181     (PID.TID 0000.0001) // 42 ----------------------------------------------------------------------
182     (PID.TID 0000.0001) // 41 ----------------------------------------------------------------------
183     (PID.TID 0000.0001) // 40 ----------------------------------------------------------------------
184     (PID.TID 0000.0001) // 39 ----------------------------------------------------------------------
185     (PID.TID 0000.0001) // 38 ----------------------------------------------------------------------
186     (PID.TID 0000.0001) // 37 ----------------------------------------------------------------------
187     (PID.TID 0000.0001) // 36 ----------------------------------------------------------------------
188     (PID.TID 0000.0001) // 35 ----------------------------------------------------------------------
189     (PID.TID 0000.0001) // 34 ----------------------------------------------------------------------
190     (PID.TID 0000.0001) // 33 ----------------------------------------------------------------------
191     (PID.TID 0000.0001) // 32 ----------------------------------------------------------------------
192     (PID.TID 0000.0001) // 31 ----------------------------------------------------------------------
193     (PID.TID 0000.0001) // 30 ----------------------------------------------------------------------
194     (PID.TID 0000.0001) // 29 ----------------------------------------------------------------------
195     (PID.TID 0000.0001) // 28 ----------------------------------------------------------------------
196     (PID.TID 0000.0001) // 27 ----------------------------------------------------------------------
197     (PID.TID 0000.0001) // 26 ----------------------------------------------------------------------
198     (PID.TID 0000.0001) // 25 ----------------------------------------------------------------------
199     (PID.TID 0000.0001) // 24 ----------------------------------------------------------------------
200     (PID.TID 0000.0001) // 23 ----------------------------------------------------------------------
201     (PID.TID 0000.0001) // 22 ----------------------------------------------------------------------
202     (PID.TID 0000.0001) // 21 ----------------------------------------------------------------------
203     (PID.TID 0000.0001) // 20 ----------------------------------------------------------------------
204     (PID.TID 0000.0001) // 19 ----------------------------------------------------------------------
205     (PID.TID 0000.0001) // 18 ----------------------------------------------------------------------
206     (PID.TID 0000.0001) // 17 ----------------------------------------------------------------------
207     (PID.TID 0000.0001) // 16 ----------------------------------------------------------------------
208     (PID.TID 0000.0001) // 15 ----------------------------------------------------------------------
209     (PID.TID 0000.0001) // 14 ----------------------------------------------------------------------
210     (PID.TID 0000.0001) // 13 ----------------------------------------------------------------------
211     (PID.TID 0000.0001) // 12 ----------------------------------------------------------------------
212     (PID.TID 0000.0001) // 11 ----------------------------------------------------------------------
213     (PID.TID 0000.0001) // 10 ----------------------------------------------------------------------
214     (PID.TID 0000.0001) // 9 ----------------------------------------------------------------------
215     (PID.TID 0000.0001) // 8 ----------------------------------------------------------------------
216     (PID.TID 0000.0001) // 7 ----------------------------------------------------------------------
217     (PID.TID 0000.0001) // 6 ----------------------------------------------------------------------
218     (PID.TID 0000.0001) // 5 ----------------------------------------------------------------------
219     (PID.TID 0000.0001) // 4 ----------------------------------------------------------------------
220     (PID.TID 0000.0001) // 3 ----------------------------------------------------------------------
221     (PID.TID 0000.0001) // 2 ----------------------------------------------------------------------
222     (PID.TID 0000.0001) // 1 ----------------------------------------------------------------------
223     (PID.TID 0000.0001) // 0 ----------------------------------------------------------------------
224     (PID.TID 0000.0001) // -1 ----------------------------------------------------------------------
225     (PID.TID 0000.0001) // -2 ----------------------------------------------------------------------
226     (PID.TID 0000.0001) // =======================================================
227     (PID.TID 0000.0001) // END OF FIELD =
228     (PID.TID 0000.0001) // =======================================================
229     (PID.TID 0000.0001)
230     (PID.TID 0000.0001) // =======================================================
231     (PID.TID 0000.0001) // Field Model Depths K Index at iteration 1
232     (PID.TID 0000.0001) // CMIN = 2.000000000000000E+01
233     (PID.TID 0000.0001) // CMAX = 2.000000000000000E+01
234     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
235     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
236     (PID.TID 0000.0001) // 0.0: .
237     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 67: 1)
238     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 67: -2: -1)
239     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
240     (PID.TID 0000.0001) // =======================================================
241     (PID.TID 0000.0001) K = 1
242     (PID.TID 0000.0001) // I=7 I=17 I=27 I=37 I=47 I=57 I=67
243     (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123456|890123456|890123456|890123456|
244     (PID.TID 0000.0001) // 67 ----------------------------------------------------------------------
245     (PID.TID 0000.0001) // 66 ----------------------------------------------------------------------
246     (PID.TID 0000.0001) // 65 ----------------------------------------------------------------------
247     (PID.TID 0000.0001) // 64 ----------------------------------------------------------------------
248     (PID.TID 0000.0001) // 63 ----------------------------------------------------------------------
249     (PID.TID 0000.0001) // 62 ----------------------------------------------------------------------
250     (PID.TID 0000.0001) // 61 ----------------------------------------------------------------------
251     (PID.TID 0000.0001) // 60 ----------------------------------------------------------------------
252     (PID.TID 0000.0001) // 59 ----------------------------------------------------------------------
253     (PID.TID 0000.0001) // 58 ----------------------------------------------------------------------
254     (PID.TID 0000.0001) // 57 ----------------------------------------------------------------------
255     (PID.TID 0000.0001) // 56 ----------------------------------------------------------------------
256     (PID.TID 0000.0001) // 55 ----------------------------------------------------------------------
257     (PID.TID 0000.0001) // 54 ----------------------------------------------------------------------
258     (PID.TID 0000.0001) // 53 ----------------------------------------------------------------------
259     (PID.TID 0000.0001) // 52 ----------------------------------------------------------------------
260     (PID.TID 0000.0001) // 51 ----------------------------------------------------------------------
261     (PID.TID 0000.0001) // 50 ----------------------------------------------------------------------
262     (PID.TID 0000.0001) // 49 ----------------------------------------------------------------------
263     (PID.TID 0000.0001) // 48 ----------------------------------------------------------------------
264     (PID.TID 0000.0001) // 47 ----------------------------------------------------------------------
265     (PID.TID 0000.0001) // 46 ----------------------------------------------------------------------
266     (PID.TID 0000.0001) // 45 ----------------------------------------------------------------------
267     (PID.TID 0000.0001) // 44 ----------------------------------------------------------------------
268     (PID.TID 0000.0001) // 43 ----------------------------------------------------------------------
269     (PID.TID 0000.0001) // 42 ----------------------------------------------------------------------
270     (PID.TID 0000.0001) // 41 ----------------------------------------------------------------------
271     (PID.TID 0000.0001) // 40 ----------------------------------------------------------------------
272     (PID.TID 0000.0001) // 39 ----------------------------------------------------------------------
273     (PID.TID 0000.0001) // 38 ----------------------------------------------------------------------
274     (PID.TID 0000.0001) // 37 ----------------------------------------------------------------------
275     (PID.TID 0000.0001) // 36 ----------------------------------------------------------------------
276     (PID.TID 0000.0001) // 35 ----------------------------------------------------------------------
277     (PID.TID 0000.0001) // 34 ----------------------------------------------------------------------
278     (PID.TID 0000.0001) // 33 ----------------------------------------------------------------------
279     (PID.TID 0000.0001) // 32 ----------------------------------------------------------------------
280     (PID.TID 0000.0001) // 31 ----------------------------------------------------------------------
281     (PID.TID 0000.0001) // 30 ----------------------------------------------------------------------
282     (PID.TID 0000.0001) // 29 ----------------------------------------------------------------------
283     (PID.TID 0000.0001) // 28 ----------------------------------------------------------------------
284     (PID.TID 0000.0001) // 27 ----------------------------------------------------------------------
285     (PID.TID 0000.0001) // 26 ----------------------------------------------------------------------
286     (PID.TID 0000.0001) // 25 ----------------------------------------------------------------------
287     (PID.TID 0000.0001) // 24 ----------------------------------------------------------------------
288     (PID.TID 0000.0001) // 23 ----------------------------------------------------------------------
289     (PID.TID 0000.0001) // 22 ----------------------------------------------------------------------
290     (PID.TID 0000.0001) // 21 ----------------------------------------------------------------------
291     (PID.TID 0000.0001) // 20 ----------------------------------------------------------------------
292     (PID.TID 0000.0001) // 19 ----------------------------------------------------------------------
293     (PID.TID 0000.0001) // 18 ----------------------------------------------------------------------
294     (PID.TID 0000.0001) // 17 ----------------------------------------------------------------------
295     (PID.TID 0000.0001) // 16 ----------------------------------------------------------------------
296     (PID.TID 0000.0001) // 15 ----------------------------------------------------------------------
297     (PID.TID 0000.0001) // 14 ----------------------------------------------------------------------
298     (PID.TID 0000.0001) // 13 ----------------------------------------------------------------------
299     (PID.TID 0000.0001) // 12 ----------------------------------------------------------------------
300     (PID.TID 0000.0001) // 11 ----------------------------------------------------------------------
301     (PID.TID 0000.0001) // 10 ----------------------------------------------------------------------
302     (PID.TID 0000.0001) // 9 ----------------------------------------------------------------------
303     (PID.TID 0000.0001) // 8 ----------------------------------------------------------------------
304     (PID.TID 0000.0001) // 7 ----------------------------------------------------------------------
305     (PID.TID 0000.0001) // 6 ----------------------------------------------------------------------
306     (PID.TID 0000.0001) // 5 ----------------------------------------------------------------------
307     (PID.TID 0000.0001) // 4 ----------------------------------------------------------------------
308     (PID.TID 0000.0001) // 3 ----------------------------------------------------------------------
309     (PID.TID 0000.0001) // 2 ----------------------------------------------------------------------
310     (PID.TID 0000.0001) // 1 ----------------------------------------------------------------------
311     (PID.TID 0000.0001) // 0 ----------------------------------------------------------------------
312     (PID.TID 0000.0001) // -1 ----------------------------------------------------------------------
313     (PID.TID 0000.0001) // -2 ----------------------------------------------------------------------
314     (PID.TID 0000.0001) // =======================================================
315     (PID.TID 0000.0001) // END OF FIELD =
316     (PID.TID 0000.0001) // =======================================================
317     (PID.TID 0000.0001)
318     (PID.TID 0000.0001) // =======================================================
319     (PID.TID 0000.0001) // Field Initial Temperature at iteration 1
320     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
321     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
322     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
323     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
324     (PID.TID 0000.0001) // 0.0: .
325     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 64: 1)
326     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 64: 1: -1)
327     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
328     (PID.TID 0000.0001) // =======================================================
329     (PID.TID 0000.0001) K = 1
330     (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60
331     (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|1234
332     (PID.TID 0000.0001) 64 ................................................................
333     (PID.TID 0000.0001) 63 ................................................................
334     (PID.TID 0000.0001) 62 ................................................................
335     (PID.TID 0000.0001) 61 ................................................................
336     (PID.TID 0000.0001) 60 ................................................................
337     (PID.TID 0000.0001) 59 ................................................................
338     (PID.TID 0000.0001) 58 ................................................................
339     (PID.TID 0000.0001) 57 ................................................................
340     (PID.TID 0000.0001) 56 ................................................................
341     (PID.TID 0000.0001) 55 ................................................................
342     (PID.TID 0000.0001) 54 ................................................................
343     (PID.TID 0000.0001) 53 ................................................................
344     (PID.TID 0000.0001) 52 ................................................................
345     (PID.TID 0000.0001) 51 ................................................................
346     (PID.TID 0000.0001) 50 ................................................................
347     (PID.TID 0000.0001) 49 ................................................................
348     (PID.TID 0000.0001) 48 ................................................................
349     (PID.TID 0000.0001) 47 ................................................................
350     (PID.TID 0000.0001) 46 ................................................................
351     (PID.TID 0000.0001) 45 ................................................................
352     (PID.TID 0000.0001) 44 ................................................................
353     (PID.TID 0000.0001) 43 ................................................................
354     (PID.TID 0000.0001) 42 ................................................................
355     (PID.TID 0000.0001) 41 ................................................................
356     (PID.TID 0000.0001) 40 ................................................................
357     (PID.TID 0000.0001) 39 ................................................................
358     (PID.TID 0000.0001) 38 ................................................................
359     (PID.TID 0000.0001) 37 ................................................................
360     (PID.TID 0000.0001) 36 ................................................................
361     (PID.TID 0000.0001) 35 ................................................................
362     (PID.TID 0000.0001) 34 ................................................................
363     (PID.TID 0000.0001) 33 ................................................................
364     (PID.TID 0000.0001) 32 ................................................................
365     (PID.TID 0000.0001) 31 ................................................................
366     (PID.TID 0000.0001) 30 ................................................................
367     (PID.TID 0000.0001) 29 ................................................................
368     (PID.TID 0000.0001) 28 ................................................................
369     (PID.TID 0000.0001) 27 ................................................................
370     (PID.TID 0000.0001) 26 ................................................................
371     (PID.TID 0000.0001) 25 ................................................................
372     (PID.TID 0000.0001) 24 ................................................................
373     (PID.TID 0000.0001) 23 ................................................................
374     (PID.TID 0000.0001) 22 ................................................................
375     (PID.TID 0000.0001) 21 ................................................................
376     (PID.TID 0000.0001) 20 ................................................................
377     (PID.TID 0000.0001) 19 ................................................................
378     (PID.TID 0000.0001) 18 ................................................................
379     (PID.TID 0000.0001) 17 ................................................................
380     (PID.TID 0000.0001) 16 ................................................................
381     (PID.TID 0000.0001) 15 ................................................................
382     (PID.TID 0000.0001) 14 ................................................................
383     (PID.TID 0000.0001) 13 ................................................................
384     (PID.TID 0000.0001) 12 ................................................................
385     (PID.TID 0000.0001) 11 ................................................................
386     (PID.TID 0000.0001) 10 ................................................................
387     (PID.TID 0000.0001) 9 ................................................................
388     (PID.TID 0000.0001) 8 ................................................................
389     (PID.TID 0000.0001) 7 ................................................................
390     (PID.TID 0000.0001) 6 ................................................................
391     (PID.TID 0000.0001) 5 ................................................................
392     (PID.TID 0000.0001) 4 ................................................................
393     (PID.TID 0000.0001) 3 ................................................................
394     (PID.TID 0000.0001) 2 ................................................................
395     (PID.TID 0000.0001) 1 ................................................................
396     (PID.TID 0000.0001) // =======================================================
397     (PID.TID 0000.0001) // END OF FIELD =
398     (PID.TID 0000.0001) // =======================================================
399     (PID.TID 0000.0001)
400     (PID.TID 0000.0001) // =======================================================
401     (PID.TID 0000.0001) // Field Initial Salinity at iteration 1
402     (PID.TID 0000.0001) // CMIN = 3.500000000000000E+01
403     (PID.TID 0000.0001) // CMAX = 3.500000000000000E+01
404     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
405     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
406     (PID.TID 0000.0001) // 0.0: .
407     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 64: 1)
408     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 64: 1: -1)
409     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
410     (PID.TID 0000.0001) // =======================================================
411     (PID.TID 0000.0001) K = 1
412     (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60
413     (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|1234
414     (PID.TID 0000.0001) 64 ----------------------------------------------------------------
415     (PID.TID 0000.0001) 63 ----------------------------------------------------------------
416     (PID.TID 0000.0001) 62 ----------------------------------------------------------------
417     (PID.TID 0000.0001) 61 ----------------------------------------------------------------
418     (PID.TID 0000.0001) 60 ----------------------------------------------------------------
419     (PID.TID 0000.0001) 59 ----------------------------------------------------------------
420     (PID.TID 0000.0001) 58 ----------------------------------------------------------------
421     (PID.TID 0000.0001) 57 ----------------------------------------------------------------
422     (PID.TID 0000.0001) 56 ----------------------------------------------------------------
423     (PID.TID 0000.0001) 55 ----------------------------------------------------------------
424     (PID.TID 0000.0001) 54 ----------------------------------------------------------------
425     (PID.TID 0000.0001) 53 ----------------------------------------------------------------
426     (PID.TID 0000.0001) 52 ----------------------------------------------------------------
427     (PID.TID 0000.0001) 51 ----------------------------------------------------------------
428     (PID.TID 0000.0001) 50 ----------------------------------------------------------------
429     (PID.TID 0000.0001) 49 ----------------------------------------------------------------
430     (PID.TID 0000.0001) 48 ----------------------------------------------------------------
431     (PID.TID 0000.0001) 47 ----------------------------------------------------------------
432     (PID.TID 0000.0001) 46 ----------------------------------------------------------------
433     (PID.TID 0000.0001) 45 ----------------------------------------------------------------
434     (PID.TID 0000.0001) 44 ----------------------------------------------------------------
435     (PID.TID 0000.0001) 43 ----------------------------------------------------------------
436     (PID.TID 0000.0001) 42 ----------------------------------------------------------------
437     (PID.TID 0000.0001) 41 ----------------------------------------------------------------
438     (PID.TID 0000.0001) 40 ----------------------------------------------------------------
439     (PID.TID 0000.0001) 39 ----------------------------------------------------------------
440     (PID.TID 0000.0001) 38 ----------------------------------------------------------------
441     (PID.TID 0000.0001) 37 ----------------------------------------------------------------
442     (PID.TID 0000.0001) 36 ----------------------------------------------------------------
443     (PID.TID 0000.0001) 35 ----------------------------------------------------------------
444     (PID.TID 0000.0001) 34 ----------------------------------------------------------------
445     (PID.TID 0000.0001) 33 ----------------------------------------------------------------
446     (PID.TID 0000.0001) 32 ----------------------------------------------------------------
447     (PID.TID 0000.0001) 31 ----------------------------------------------------------------
448     (PID.TID 0000.0001) 30 ----------------------------------------------------------------
449     (PID.TID 0000.0001) 29 ----------------------------------------------------------------
450     (PID.TID 0000.0001) 28 ----------------------------------------------------------------
451     (PID.TID 0000.0001) 27 ----------------------------------------------------------------
452     (PID.TID 0000.0001) 26 ----------------------------------------------------------------
453     (PID.TID 0000.0001) 25 ----------------------------------------------------------------
454     (PID.TID 0000.0001) 24 ----------------------------------------------------------------
455     (PID.TID 0000.0001) 23 ----------------------------------------------------------------
456     (PID.TID 0000.0001) 22 ----------------------------------------------------------------
457     (PID.TID 0000.0001) 21 ----------------------------------------------------------------
458     (PID.TID 0000.0001) 20 ----------------------------------------------------------------
459     (PID.TID 0000.0001) 19 ----------------------------------------------------------------
460     (PID.TID 0000.0001) 18 ----------------------------------------------------------------
461     (PID.TID 0000.0001) 17 ----------------------------------------------------------------
462     (PID.TID 0000.0001) 16 ----------------------------------------------------------------
463     (PID.TID 0000.0001) 15 ----------------------------------------------------------------
464     (PID.TID 0000.0001) 14 ----------------------------------------------------------------
465     (PID.TID 0000.0001) 13 ----------------------------------------------------------------
466     (PID.TID 0000.0001) 12 ----------------------------------------------------------------
467     (PID.TID 0000.0001) 11 ----------------------------------------------------------------
468     (PID.TID 0000.0001) 10 ----------------------------------------------------------------
469     (PID.TID 0000.0001) 9 ----------------------------------------------------------------
470     (PID.TID 0000.0001) 8 ----------------------------------------------------------------
471     (PID.TID 0000.0001) 7 ----------------------------------------------------------------
472     (PID.TID 0000.0001) 6 ----------------------------------------------------------------
473     (PID.TID 0000.0001) 5 ----------------------------------------------------------------
474     (PID.TID 0000.0001) 4 ----------------------------------------------------------------
475     (PID.TID 0000.0001) 3 ----------------------------------------------------------------
476     (PID.TID 0000.0001) 2 ----------------------------------------------------------------
477     (PID.TID 0000.0001) 1 ----------------------------------------------------------------
478     (PID.TID 0000.0001) // =======================================================
479     (PID.TID 0000.0001) // END OF FIELD =
480     (PID.TID 0000.0001) // =======================================================
481     (PID.TID 0000.0001)
482     (PID.TID 0000.0001) // CG2D normalisation factor = 0.3571428571428571503294860E-08
483     (PID.TID 0000.0001)
484     (PID.TID 0000.0001) // CG3D normalisation factor = 0.7142857142857142344845230E-07
485     (PID.TID 0000.0001)
486     (PID.TID 0000.0001) // =======================================================
487     (PID.TID 0000.0001) // Model configuration
488     (PID.TID 0000.0001) // =======================================================
489     (PID.TID 0000.0001) //
490     (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
491     (PID.TID 0000.0001) //
492     (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or oK ) */
493     (PID.TID 0000.0001) 20 @ 0.000000000000000E+00 /* K = 1: 20 */
494     (PID.TID 0000.0001) ;
495     (PID.TID 0000.0001) sRef = /* Reference salinity profile ( ppt ) */
496     (PID.TID 0000.0001) 20 @ 3.500000000000000E+01 /* K = 1: 20 */
497     (PID.TID 0000.0001) ;
498     (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
499     (PID.TID 0000.0001) 1.000000000000000E+00
500     (PID.TID 0000.0001) ;
501     (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
502     (PID.TID 0000.0001) 0.000000000000000E+00
503     (PID.TID 0000.0001) ;
504     (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
505     (PID.TID 0000.0001) F
506     (PID.TID 0000.0001) ;
507     (PID.TID 0000.0001) viscAz = /* Vertical eddy viscosity ( m^2/s ) */
508     (PID.TID 0000.0001) 1.000000000000000E+00
509     (PID.TID 0000.0001) ;
510     (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
511     (PID.TID 0000.0001) 1.000000000000000E+00
512     (PID.TID 0000.0001) ;
513     (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
514     (PID.TID 0000.0001) 1.000000000000000E+00
515     (PID.TID 0000.0001) ;
516     (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
517     (PID.TID 0000.0001) 0.000000000000000E+00
518     (PID.TID 0000.0001) ;
519     (PID.TID 0000.0001) diffKzT = /* Laplacian diffusion of heat vertically ( m^2/s ) */
520     (PID.TID 0000.0001) 1.000000000000000E+00
521     (PID.TID 0000.0001) ;
522     (PID.TID 0000.0001) diffKrT = /* Laplacian diffusion of heat vertically ( m^2/s ) */
523     (PID.TID 0000.0001) 1.000000000000000E+00
524     (PID.TID 0000.0001) ;
525     (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
526     (PID.TID 0000.0001) 1.000000000000000E+00
527     (PID.TID 0000.0001) ;
528     (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
529     (PID.TID 0000.0001) 0.000000000000000E+00
530     (PID.TID 0000.0001) ;
531     (PID.TID 0000.0001) diffKzS = /* Laplacian diffusion of salt vertically ( m^2/s ) */
532     (PID.TID 0000.0001) 1.000000000000000E+00
533     (PID.TID 0000.0001) ;
534     (PID.TID 0000.0001) diffKrS = /* Laplacian diffusion of salt vertically ( m^2/s ) */
535     (PID.TID 0000.0001) 1.000000000000000E+00
536     (PID.TID 0000.0001) ;
537     (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/degree ) */
538     (PID.TID 0000.0001) 1.000000000000000E+00
539     (PID.TID 0000.0001) ;
540     (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/ppt ) */
541     (PID.TID 0000.0001) 0.000000000000000E+00
542     (PID.TID 0000.0001) ;
543     (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
544     (PID.TID 0000.0001) 1.000000000000000E+00
545     (PID.TID 0000.0001) ;
546     (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
547     (PID.TID 0000.0001) 1.000000000000000E+00
548     (PID.TID 0000.0001) ;
549     (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
550     (PID.TID 0000.0001) 1.400000000000000E+08
551     (PID.TID 0000.0001) ;
552     (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
553     (PID.TID 0000.0001) 1.400000000000000E+08
554     (PID.TID 0000.0001) ;
555     (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
556     (PID.TID 0000.0001) 1.250000000000000E+03
557     (PID.TID 0000.0001) ;
558     (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
559     (PID.TID 0000.0001) 0.000000000000000E+00
560     (PID.TID 0000.0001) ;
561     (PID.TID 0000.0001) freeSurfFac = /* Implcit free surface factor */
562     (PID.TID 0000.0001) 1.000000000000000E+00
563     (PID.TID 0000.0001) ;
564     (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
565     (PID.TID 0000.0001) T
566     (PID.TID 0000.0001) ;
567     (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
568     (PID.TID 0000.0001) F
569     (PID.TID 0000.0001) ;
570     (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
571     (PID.TID 0000.0001) T
572     (PID.TID 0000.0001) ;
573     (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
574     (PID.TID 0000.0001) T
575     (PID.TID 0000.0001) ;
576     (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
577     (PID.TID 0000.0001) T
578     (PID.TID 0000.0001) ;
579     (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
580     (PID.TID 0000.0001) T
581     (PID.TID 0000.0001) ;
582     (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
583     (PID.TID 0000.0001) T
584     (PID.TID 0000.0001) ;
585     (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
586     (PID.TID 0000.0001) T
587     (PID.TID 0000.0001) ;
588     (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
589     (PID.TID 0000.0001) T
590     (PID.TID 0000.0001) ;
591     (PID.TID 0000.0001) openBoundaries = /* OpenBoundaries on/off flag */
592     (PID.TID 0000.0001) F
593     (PID.TID 0000.0001) ;
594     (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
595     (PID.TID 0000.0001) T
596     (PID.TID 0000.0001) ;
597     (PID.TID 0000.0001) GMMaxSlope = /* Max. slope allowed in GM/Redi tensor */
598     (PID.TID 0000.0001) 1.000000000000000E-02
599     (PID.TID 0000.0001) ;
600     (PID.TID 0000.0001) GMLength = /* Length to use in Visbeck et al. formula for K (m) */
601     (PID.TID 0000.0001) 2.000000000000000E+05
602     (PID.TID 0000.0001) ;
603     (PID.TID 0000.0001) GMAlpha = /* alpha to use in Visbeck et al. formula for K */
604     (PID.TID 0000.0001) 0.000000000000000E+00
605     (PID.TID 0000.0001) ;
606     (PID.TID 0000.0001) GMdepth = /* Depth to integrate for Visbeck et. al Richardson # (m) */
607     (PID.TID 0000.0001) 1.000000000000000E+03
608     (PID.TID 0000.0001) ;
609     (PID.TID 0000.0001) GMkbackground = /* background value of GM/Redi coefficient m^2/s */
610     (PID.TID 0000.0001) 0.000000000000000E+00
611     (PID.TID 0000.0001) ;
612     (PID.TID 0000.0001) //
613     (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
614     (PID.TID 0000.0001) //
615     (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
616     (PID.TID 0000.0001) 1000
617     (PID.TID 0000.0001) ;
618     (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
619     (PID.TID 0000.0001) 1
620     (PID.TID 0000.0001) ;
621     (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
622     (PID.TID 0000.0001) 1.000000000000000E-09
623     (PID.TID 0000.0001) ;
624     (PID.TID 0000.0001) //
625     (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
626     (PID.TID 0000.0001) //
627     (PID.TID 0000.0001) nIter0 = /* Base timestep number */
628     (PID.TID 0000.0001) 0
629     (PID.TID 0000.0001) ;
630     (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
631     (PID.TID 0000.0001) 10
632     (PID.TID 0000.0001) ;
633     (PID.TID 0000.0001) deltaTmom = /* Momentum equation timestep ( s ) */
634     (PID.TID 0000.0001) 2.000000000000000E-04
635     (PID.TID 0000.0001) ;
636     (PID.TID 0000.0001) deltaTtracer = /* Tracer equation timestep ( s ) */
637     (PID.TID 0000.0001) 2.000000000000000E-04
638     (PID.TID 0000.0001) ;
639     (PID.TID 0000.0001) deltaTClock = /* Model clock timestep ( s ) */
640     (PID.TID 0000.0001) 2.000000000000000E-04
641     (PID.TID 0000.0001) ;
642     (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
643     (PID.TID 0000.0001) 2.000000000000000E-04
644     (PID.TID 0000.0001) ;
645     (PID.TID 0000.0001) abEps = /* Adams-Bashforth stabilizing weight */
646     (PID.TID 0000.0001) 1.000000000000000E-01
647     (PID.TID 0000.0001) ;
648     (PID.TID 0000.0001) tauCD = /* CD coupling time-scale ( s ) */
649     (PID.TID 0000.0001) 2.000000000000000E-04
650     (PID.TID 0000.0001) ;
651     (PID.TID 0000.0001) rCD = /* Normalised CD coupling parameter */
652     (PID.TID 0000.0001) 0.000000000000000E+00
653     (PID.TID 0000.0001) ;
654     (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
655     (PID.TID 0000.0001) 0.000000000000000E+00
656     (PID.TID 0000.0001) ;
657     (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
658     (PID.TID 0000.0001) 2.000000000000000E-03
659     (PID.TID 0000.0001) ;
660     (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
661     (PID.TID 0000.0001) 0.000000000000000E+00
662     (PID.TID 0000.0001) ;
663     (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
664     (PID.TID 0000.0001) 0.000000000000000E+00
665     (PID.TID 0000.0001) ;
666     (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
667     (PID.TID 0000.0001) 1.000000000000000E-01
668     (PID.TID 0000.0001) ;
669     (PID.TID 0000.0001) //
670     (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
671     (PID.TID 0000.0001) //
672     (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True / False ) */
673     (PID.TID 0000.0001) T
674     (PID.TID 0000.0001) ;
675     (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True / False ) */
676     (PID.TID 0000.0001) F
677     (PID.TID 0000.0001) ;
678     (PID.TID 0000.0001) delZ = /* W spacing ( m ) */
679     (PID.TID 0000.0001) 20 @ 1.000000000000000E-01 /* K = 1: 20 */
680     (PID.TID 0000.0001) ;
681     (PID.TID 0000.0001) delP = /* W spacing ( Pa ) */
682     (PID.TID 0000.0001) 20 @ 1.234567000000000E+05 /* K = 1: 20 */
683     (PID.TID 0000.0001) ;
684     (PID.TID 0000.0001) delR = /* W spacing ( units of r ) */
685     (PID.TID 0000.0001) 20 @ 1.000000000000000E-01 /* K = 1: 20 */
686     (PID.TID 0000.0001) ;
687     (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
688     (PID.TID 0000.0001) 64 @ 6.250000000000000E-02 /* I = 1: 64 */
689     (PID.TID 0000.0001) ;
690     (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
691     (PID.TID 0000.0001) 64 @ 6.250000000000000E-02 /* J = 1: 64 */
692     (PID.TID 0000.0001) ;
693     (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
694     (PID.TID 0000.0001) 0.000000000000000E+00
695     (PID.TID 0000.0001) ;
696     (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
697     (PID.TID 0000.0001) 0.000000000000000E+00
698     (PID.TID 0000.0001) ;
699     (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
700     (PID.TID 0000.0001) 6.370000000000000E+06
701     (PID.TID 0000.0001) ;
702     (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
703     (PID.TID 0000.0001) 3.125000000000000E-02, /* I = 1 */
704     (PID.TID 0000.0001) 9.375000000000000E-02, /* I = 2 */
705     (PID.TID 0000.0001) 1.562500000000000E-01, /* I = 3 */
706     (PID.TID 0000.0001) 2.187500000000000E-01, /* I = 4 */
707     (PID.TID 0000.0001) 2.812500000000000E-01, /* I = 5 */
708     (PID.TID 0000.0001) 3.437500000000000E-01, /* I = 6 */
709     (PID.TID 0000.0001) 4.062500000000000E-01, /* I = 7 */
710     (PID.TID 0000.0001) 4.687500000000000E-01, /* I = 8 */
711     (PID.TID 0000.0001) 5.312500000000000E-01, /* I = 9 */
712     (PID.TID 0000.0001) 5.937500000000000E-01, /* I = 10 */
713     (PID.TID 0000.0001) 6.562500000000000E-01, /* I = 11 */
714     (PID.TID 0000.0001) 7.187500000000000E-01, /* I = 12 */
715     (PID.TID 0000.0001) 7.812500000000000E-01, /* I = 13 */
716     (PID.TID 0000.0001) 8.437500000000000E-01, /* I = 14 */
717     (PID.TID 0000.0001) 9.062500000000000E-01, /* I = 15 */
718     (PID.TID 0000.0001) 9.687500000000000E-01, /* I = 16 */
719     (PID.TID 0000.0001) 1.031250000000000E+00, /* I = 17 */
720     (PID.TID 0000.0001) 1.093750000000000E+00, /* I = 18 */
721     (PID.TID 0000.0001) 1.156250000000000E+00, /* I = 19 */
722     (PID.TID 0000.0001) 1.218750000000000E+00, /* I = 20 */
723     (PID.TID 0000.0001) 1.281250000000000E+00, /* I = 21 */
724     (PID.TID 0000.0001) 1.343750000000000E+00, /* I = 22 */
725     (PID.TID 0000.0001) 1.406250000000000E+00, /* I = 23 */
726     (PID.TID 0000.0001) 1.468750000000000E+00, /* I = 24 */
727     (PID.TID 0000.0001) 1.531250000000000E+00, /* I = 25 */
728     (PID.TID 0000.0001) 1.593750000000000E+00, /* I = 26 */
729     (PID.TID 0000.0001) 1.656250000000000E+00, /* I = 27 */
730     (PID.TID 0000.0001) 1.718750000000000E+00, /* I = 28 */
731     (PID.TID 0000.0001) 1.781250000000000E+00, /* I = 29 */
732     (PID.TID 0000.0001) 1.843750000000000E+00, /* I = 30 */
733     (PID.TID 0000.0001) 1.906250000000000E+00, /* I = 31 */
734     (PID.TID 0000.0001) 1.968750000000000E+00, /* I = 32 */
735     (PID.TID 0000.0001) 2.031250000000000E+00, /* I = 33 */
736     (PID.TID 0000.0001) 2.093750000000000E+00, /* I = 34 */
737     (PID.TID 0000.0001) 2.156250000000000E+00, /* I = 35 */
738     (PID.TID 0000.0001) 2.218750000000000E+00, /* I = 36 */
739     (PID.TID 0000.0001) 2.281250000000000E+00, /* I = 37 */
740     (PID.TID 0000.0001) 2.343750000000000E+00, /* I = 38 */
741     (PID.TID 0000.0001) 2.406250000000000E+00, /* I = 39 */
742     (PID.TID 0000.0001) 2.468750000000000E+00, /* I = 40 */
743     (PID.TID 0000.0001) 2.531250000000000E+00, /* I = 41 */
744     (PID.TID 0000.0001) 2.593750000000000E+00, /* I = 42 */
745     (PID.TID 0000.0001) 2.656250000000000E+00, /* I = 43 */
746     (PID.TID 0000.0001) 2.718750000000000E+00, /* I = 44 */
747     (PID.TID 0000.0001) 2.781250000000000E+00, /* I = 45 */
748     (PID.TID 0000.0001) 2.843750000000000E+00, /* I = 46 */
749     (PID.TID 0000.0001) 2.906250000000000E+00, /* I = 47 */
750     (PID.TID 0000.0001) 2.968750000000000E+00, /* I = 48 */
751     (PID.TID 0000.0001) 3.031250000000000E+00, /* I = 49 */
752     (PID.TID 0000.0001) 3.093750000000000E+00, /* I = 50 */
753     (PID.TID 0000.0001) 3.156250000000000E+00, /* I = 51 */
754     (PID.TID 0000.0001) 3.218750000000000E+00, /* I = 52 */
755     (PID.TID 0000.0001) 3.281250000000000E+00, /* I = 53 */
756     (PID.TID 0000.0001) 3.343750000000000E+00, /* I = 54 */
757     (PID.TID 0000.0001) 3.406250000000000E+00, /* I = 55 */
758     (PID.TID 0000.0001) 3.468750000000000E+00, /* I = 56 */
759     (PID.TID 0000.0001) 3.531250000000000E+00, /* I = 57 */
760     (PID.TID 0000.0001) 3.593750000000000E+00, /* I = 58 */
761     (PID.TID 0000.0001) 3.656250000000000E+00, /* I = 59 */
762     (PID.TID 0000.0001) 3.718750000000000E+00, /* I = 60 */
763     (PID.TID 0000.0001) 3.781250000000000E+00, /* I = 61 */
764     (PID.TID 0000.0001) 3.843750000000000E+00, /* I = 62 */
765     (PID.TID 0000.0001) 3.906250000000000E+00, /* I = 63 */
766     (PID.TID 0000.0001) 3.968750000000000E+00 /* I = 64 */
767     (PID.TID 0000.0001) ;
768     (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
769     (PID.TID 0000.0001) 3.125000000000000E-02, /* J = 1 */
770     (PID.TID 0000.0001) 9.375000000000000E-02, /* J = 2 */
771     (PID.TID 0000.0001) 1.562500000000000E-01, /* J = 3 */
772     (PID.TID 0000.0001) 2.187500000000000E-01, /* J = 4 */
773     (PID.TID 0000.0001) 2.812500000000000E-01, /* J = 5 */
774     (PID.TID 0000.0001) 3.437500000000000E-01, /* J = 6 */
775     (PID.TID 0000.0001) 4.062500000000000E-01, /* J = 7 */
776     (PID.TID 0000.0001) 4.687500000000000E-01, /* J = 8 */
777     (PID.TID 0000.0001) 5.312500000000000E-01, /* J = 9 */
778     (PID.TID 0000.0001) 5.937500000000000E-01, /* J = 10 */
779     (PID.TID 0000.0001) 6.562500000000000E-01, /* J = 11 */
780     (PID.TID 0000.0001) 7.187500000000000E-01, /* J = 12 */
781     (PID.TID 0000.0001) 7.812500000000000E-01, /* J = 13 */
782     (PID.TID 0000.0001) 8.437500000000000E-01, /* J = 14 */
783     (PID.TID 0000.0001) 9.062500000000000E-01, /* J = 15 */
784     (PID.TID 0000.0001) 9.687500000000000E-01, /* J = 16 */
785     (PID.TID 0000.0001) 1.031250000000000E+00, /* J = 17 */
786     (PID.TID 0000.0001) 1.093750000000000E+00, /* J = 18 */
787     (PID.TID 0000.0001) 1.156250000000000E+00, /* J = 19 */
788     (PID.TID 0000.0001) 1.218750000000000E+00, /* J = 20 */
789     (PID.TID 0000.0001) 1.281250000000000E+00, /* J = 21 */
790     (PID.TID 0000.0001) 1.343750000000000E+00, /* J = 22 */
791     (PID.TID 0000.0001) 1.406250000000000E+00, /* J = 23 */
792     (PID.TID 0000.0001) 1.468750000000000E+00, /* J = 24 */
793     (PID.TID 0000.0001) 1.531250000000000E+00, /* J = 25 */
794     (PID.TID 0000.0001) 1.593750000000000E+00, /* J = 26 */
795     (PID.TID 0000.0001) 1.656250000000000E+00, /* J = 27 */
796     (PID.TID 0000.0001) 1.718750000000000E+00, /* J = 28 */
797     (PID.TID 0000.0001) 1.781250000000000E+00, /* J = 29 */
798     (PID.TID 0000.0001) 1.843750000000000E+00, /* J = 30 */
799     (PID.TID 0000.0001) 1.906250000000000E+00, /* J = 31 */
800     (PID.TID 0000.0001) 1.968750000000000E+00, /* J = 32 */
801     (PID.TID 0000.0001) 2.031250000000000E+00, /* J = 33 */
802     (PID.TID 0000.0001) 2.093750000000000E+00, /* J = 34 */
803     (PID.TID 0000.0001) 2.156250000000000E+00, /* J = 35 */
804     (PID.TID 0000.0001) 2.218750000000000E+00, /* J = 36 */
805     (PID.TID 0000.0001) 2.281250000000000E+00, /* J = 37 */
806     (PID.TID 0000.0001) 2.343750000000000E+00, /* J = 38 */
807     (PID.TID 0000.0001) 2.406250000000000E+00, /* J = 39 */
808     (PID.TID 0000.0001) 2.468750000000000E+00, /* J = 40 */
809     (PID.TID 0000.0001) 2.531250000000000E+00, /* J = 41 */
810     (PID.TID 0000.0001) 2.593750000000000E+00, /* J = 42 */
811     (PID.TID 0000.0001) 2.656250000000000E+00, /* J = 43 */
812     (PID.TID 0000.0001) 2.718750000000000E+00, /* J = 44 */
813     (PID.TID 0000.0001) 2.781250000000000E+00, /* J = 45 */
814     (PID.TID 0000.0001) 2.843750000000000E+00, /* J = 46 */
815     (PID.TID 0000.0001) 2.906250000000000E+00, /* J = 47 */
816     (PID.TID 0000.0001) 2.968750000000000E+00, /* J = 48 */
817     (PID.TID 0000.0001) 3.031250000000000E+00, /* J = 49 */
818     (PID.TID 0000.0001) 3.093750000000000E+00, /* J = 50 */
819     (PID.TID 0000.0001) 3.156250000000000E+00, /* J = 51 */
820     (PID.TID 0000.0001) 3.218750000000000E+00, /* J = 52 */
821     (PID.TID 0000.0001) 3.281250000000000E+00, /* J = 53 */
822     (PID.TID 0000.0001) 3.343750000000000E+00, /* J = 54 */
823     (PID.TID 0000.0001) 3.406250000000000E+00, /* J = 55 */
824     (PID.TID 0000.0001) 3.468750000000000E+00, /* J = 56 */
825     (PID.TID 0000.0001) 3.531250000000000E+00, /* J = 57 */
826     (PID.TID 0000.0001) 3.593750000000000E+00, /* J = 58 */
827     (PID.TID 0000.0001) 3.656250000000000E+00, /* J = 59 */
828     (PID.TID 0000.0001) 3.718750000000000E+00, /* J = 60 */
829     (PID.TID 0000.0001) 3.781250000000000E+00, /* J = 61 */
830     (PID.TID 0000.0001) 3.843750000000000E+00, /* J = 62 */
831     (PID.TID 0000.0001) 3.906250000000000E+00, /* J = 63 */
832     (PID.TID 0000.0001) 3.968750000000000E+00 /* J = 64 */
833     (PID.TID 0000.0001) ;
834     (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
835     (PID.TID 0000.0001) -5.000000000000000E-02, /* K = 1 */
836     (PID.TID 0000.0001) -1.500000000000000E-01, /* K = 2 */
837     (PID.TID 0000.0001) -2.500000000000000E-01, /* K = 3 */
838     (PID.TID 0000.0001) -3.500000000000000E-01, /* K = 4 */
839     (PID.TID 0000.0001) -4.500000000000000E-01, /* K = 5 */
840     (PID.TID 0000.0001) -5.499999999999999E-01, /* K = 6 */
841     (PID.TID 0000.0001) -6.499999999999999E-01, /* K = 7 */
842     (PID.TID 0000.0001) -7.499999999999999E-01, /* K = 8 */
843     (PID.TID 0000.0001) -8.499999999999999E-01, /* K = 9 */
844     (PID.TID 0000.0001) -9.499999999999998E-01, /* K = 10 */
845     (PID.TID 0000.0001) -1.050000000000000E+00, /* K = 11 */
846     (PID.TID 0000.0001) -1.150000000000000E+00, /* K = 12 */
847     (PID.TID 0000.0001) -1.250000000000000E+00, /* K = 13 */
848     (PID.TID 0000.0001) -1.350000000000000E+00, /* K = 14 */
849     (PID.TID 0000.0001) -1.450000000000000E+00, /* K = 15 */
850     (PID.TID 0000.0001) -1.550000000000000E+00, /* K = 16 */
851     (PID.TID 0000.0001) -1.650000000000000E+00, /* K = 17 */
852     (PID.TID 0000.0001) -1.750000000000000E+00, /* K = 18 */
853     (PID.TID 0000.0001) -1.850000000000001E+00, /* K = 19 */
854     (PID.TID 0000.0001) -1.950000000000001E+00 /* K = 20 */
855     (PID.TID 0000.0001) ;
856     (PID.TID 0000.0001)
857     (PID.TID 0000.0001) // =======================================================
858     (PID.TID 0000.0001) // Model current state
859     (PID.TID 0000.0001) // =======================================================
860     (PID.TID 0000.0001)
861     (PID.TID 0000.0001) // Wrote file(s) U.*0000000000
862     (PID.TID 0000.0001) // Wrote file(s) V.*0000000000
863     (PID.TID 0000.0001) // Wrote file(s) T.*0000000000
864     (PID.TID 0000.0001) // Wrote file(s) S.*0000000000
865     (PID.TID 0000.0001) // Wrote file(s) PS.*0000000000
866     (PID.TID 0000.0001) // Wrote file(s) PNH.*0000000000
867     (PID.TID 0000.0001) // Wrote file(s) W.*0000000000
868     (PID.TID 0000.0001) // Model state written, timestep 0
869     (PID.TID 0000.0001)
870     (PID.TID 0000.0001) // Read file(s) Qnet.circle*
871     (PID.TID 0000.0001) // =======================================================
872     (PID.TID 0000.0001) // Field Surface Heat Flux at iteration 1
873     (PID.TID 0000.0001) // CMIN = 1.000001566435617E+00
874     (PID.TID 0000.0001) // CMAX = 1.009998111769610E+00
875     (PID.TID 0000.0001) // CINT = 3.702424197775009E-04
876     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
877     (PID.TID 0000.0001) // 0.0: .
878     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 67: 1)
879     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 67: -2: -1)
880     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
881     (PID.TID 0000.0001) // =======================================================
882     (PID.TID 0000.0001) K = 1
883     (PID.TID 0000.0001) // I=7 I=17 I=27 I=37 I=47 I=57 I=67
884     (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123456|890123456|890123456|890123456|
885     (PID.TID 0000.0001) // 67 wzbwmaapbfbxtyabslvahcfskkeoswpzgahmhgnugvsvbdltdcgm-hpajhypctzdwzbwma
886     (PID.TID 0000.0001) // 66 jvvquuljbvtv+wdpacdqsokdilsynkkblfxftq+cehrcdtfelkksrwzczxcv-hmojvvquu
887     (PID.TID 0000.0001) // 65 efvmkzp-jcnbggmb+n-xommngmjeqmulcvhi-ohziaooezwtwkrso+hbtbcmxdktefvmkz
888     (PID.TID 0000.0001) // 64 hieuylrqcd+mluxgasfo+kpdbvlduihrlre-tvz+nzbrmismxnssfdzhd+uzrysthieuyl
889     (PID.TID 0000.0001) // 63 bnnquytzmkpdoliuznrbugtdwhfubxnqgshokiauqpb+fbef-srpxsjrhgzqfiajbnnquy
890     (PID.TID 0000.0001) // 62 zupybckhahjm-csqcyonlvl+syjygtnjfabirmnubrfhiolfnajthyvalraq+twezupybc
891     (PID.TID 0000.0001) // 61 xsontnpsyrshnhrgffpkvy+ppntimbqtartaamgxgzqivsqclwsrd-hxzvsbu-mzxsontn
892     (PID.TID 0000.0001) // 60 cxbyorqklwxlhvjkrcbngrbhcmbbbfhwybwcxvsubtqfkp-owghqnsubhuebnsg-cxbyor
893     (PID.TID 0000.0001) // 59 muxxraqieezrkjgnegwoqa-tmlfdehwcue+ifziqxequlnzobqwjgrs+pvuzokhmmuxxra
894     (PID.TID 0000.0001) // 58 uwnqdgmsksubatjevqy-fd+udfqu-ksqzruulumrlajdcfykdcoufjxenjcqjfufuwnqdg
895     (PID.TID 0000.0001) // 57 mwkcrjghwnnxtmkx+uzgiosqtarukw+nahwiglxqnlychnb-zlpcqyknvfprdpuzmwkcrj
896     (PID.TID 0000.0001) // 56 oeruqrjw-bzjszkuprdjvbjhvposegkhaopinvdaiozuhidvvgxl+kniyfro-pkxoeruqr
897     (PID.TID 0000.0001) // 55 zsgcjdzusrisetovjfrlvjgwtbjqeesrvsjl-vysipqtnr-l+nzqlfuinj-vscm+zsgcjd
898     (PID.TID 0000.0001) // 54 ai+itfsehkqai-celbciu-ieuzxlgayqimlyldvabthiijvjiytkf-afmoeazzwcai+itf
899     (PID.TID 0000.0001) // 53 pdadgjhhgwyfivieiaqfsnqef-oschvcdnyykjlafzyufzihglcyfjcpupjmw+fipdadgj
900     (PID.TID 0000.0001) // 52 oiyxghymvctnigepplntavdfhfecmfalwspjhjusfnkzgqgipcleurmkbrvoymrnoiyxgh
901     (PID.TID 0000.0001) // 51 nmjjqkysqicbrr-gyfmbprtxlod+nuxkpuaeazbybpmuiqrembfbdlztynyuhaaanmjjqk
902     (PID.TID 0000.0001) // 50 nftmwagqgdbersvkkgadduadxcuiogzieslnwqnv-zmaxqgpxpspnnchgywkgvyxnftmwa
903     (PID.TID 0000.0001) // 49 a+trjxnfvbfyjxepozrtggphvaglznrkkjkxnokrarbxlnnimhfmzmwhgbfcbtnqa+trjx
904     (PID.TID 0000.0001) // 48 m-rkx+qemopmhuoetkeks-mjjwfmas+spdcazdvcf-hfmayhzniuhqadkiqspthpm-rkx+
905     (PID.TID 0000.0001) // 47 ysgoleehwoid-oqob-mhjmakpwjc-cjxbdztpkecegypbxijhknikxpsxqoldxboysgole
906     (PID.TID 0000.0001) // 46 qbpodnun+cwcrncjefgw+fa-zqkbtsvqfjdkhukmrrdzpcgvfxjujjfrelrmsgokqbpodn
907     (PID.TID 0000.0001) // 45 mvgpgphzlkxivaihbdbjetbyuwwo+ewegvpkrvlcwzfdbhcjypnmdplh+uvpbedymvgpgp
908     (PID.TID 0000.0001) // 44 smahnwysuzxvlciocahyxtqntjysyacceyfzws+sntmaclqzgvmsjdyeafjtsvtnsmahnw
909     (PID.TID 0000.0001) // 43 +j-hniynvqgrrjyvqoiqltuvyrnssizbbdihatesmhkklqiacxfvxisrraiwrkts+j-hni
910     (PID.TID 0000.0001) // 42 calqong+meyjq-ssoiyvtjijti+cwdhuadkauocdspxivivjcgqgrfqgvcag+ysycalqon
911     (PID.TID 0000.0001) // 41 joaderu+fdnbtrhppjojoae-vqyvfcvfovlrnsqhwyfulyobuitqbcghjwphofxzjoader
912     (PID.TID 0000.0001) // 40 omekhiynfsfnm+-vztuqxkgfzopvbiklkrznbvbtmiwtyyucvmnznzvpgzfpcnnzomekhi
913     (PID.TID 0000.0001) // 39 xohgyyqsgaqapktfezkjotaxfescfdcqywehbx+luktjajrolwchzqncrjivpprexohgyy
914     (PID.TID 0000.0001) // 38 fpufymneqsafuckgjvgprdjeuprldcf-difjt+wyapuptyjnpuu+bvgkoqmhimeufpufym
915     (PID.TID 0000.0001) // 37 xivjjrifvjge-rpxa+cjztszcfldnfrfheg-zqafwxzbobqbefdfvhyfgiwq-tejxivjjr
916     (PID.TID 0000.0001) // 36 pdqxbpr+dioglsmdxph-isjybjjzxsuwhqztzrbf-nll+joebolcwdwiuwrwkuqjpdqxbp
917     (PID.TID 0000.0001) // 35 pvqyicbzjaubyrthw+cq-kzhlocxzpjkthxakq-qaoyrkeaaofyihugoxrndmmtbpvqyic
918     (PID.TID 0000.0001) // 34 o-xfqq-fiujrzlkvhw-rhetjuoy+zuqxjdhzagkvfihrvdoyzwdvhgwvvlodpvg+o-xfqq
919     (PID.TID 0000.0001) // 33 nybmcmdgrnecpvdjispcyqbolblwvaqwi+yvnthcuydnrwvdxyntpid-odt+eeujnybmcm
920     (PID.TID 0000.0001) // 32 m+pufevtsdpajmbxghffgcyhcfnfljetclaxwmwnbmuwzlnmt+krynxlibpdestom+pufe
921     (PID.TID 0000.0001) // 31 mvalbemsufjvtbkgprzkkbedymvooyoffngvhbnxymmhlofmjzzqk+vxvhbbziblmvalbe
922     (PID.TID 0000.0001) // 30 qcaaskyutnrznajn+cronkzf+larguqukooltidgklapksrzfxb+njkpmdecjfyzqcaask
923     (PID.TID 0000.0001) // 29 qnmtxvnzzobeyotnxudmbuavexiwphwyitlukghssjrovu-pniyslndtedmjtstjqnmtxv
924     (PID.TID 0000.0001) // 28 behetz+menf+xscqmobi-+hlqqmeskpuavzfqppgrkbgkrsfjmihnxzvcycczilvbehetz
925     (PID.TID 0000.0001) // 27 qwffzlbgdsrerjyrrkvhdc+bbiapzjsj+sdvkw+dqkg+m-++evncikmqfdmudtyvqwffzl
926     (PID.TID 0000.0001) // 26 oubwu-kuxdgcyqkihlxqepslqmdvgosbfwlvjtqzweozoxumu-uixz-ccpzfcxcroubwu-
927     (PID.TID 0000.0001) // 25 p-vxy+ocmk-lkuqnhnckmblwhtg-knxoxdfdbparyhvavbvyafkkkarspphizakfp-vxy+
928     (PID.TID 0000.0001) // 24 oan-wbligsufxg-ycucdhw-ounrlkzbikkokoxjziwkluizaatlwqjenrdeyvwbkoan-wb
929     (PID.TID 0000.0001) // 23 murqsnltxxazwogagvtfkcbrtqywtrufpurulr-wfgsqv-lrdshzhzjec-fziepjmurqsn
930     (PID.TID 0000.0001) // 22 itkzfele+inykdjuyi-bya+eessxvxmoowolukciwjrhkyhvwrbfnvsihmypfavkitkzfe
931     (PID.TID 0000.0001) // 21 cojkoofjbvrhbnyehfbxjpcltnmrmvthqurdew+vruuttqtpeyywyxwicuitkek+cojkoo
932     (PID.TID 0000.0001) // 20 rbxmwnmstnedonugnzvdqmaxcobzgwmlorcumnpnpbamhaun-llnaahbswowclqkrbxmwn
933     (PID.TID 0000.0001) // 19 +xtvflatybsvmktemffqnvkez-ovjqmgmvkjggk+bsgvftzzmcbabomwrdjfwxvo+xtvfl
934     (PID.TID 0000.0001) // 18 dbybhnipgjbqmfhjptjctcqonkkymjdxepzxdlxkbaqbqhsufxx+qsfvdefhhzm+dbybhn
935     (PID.TID 0000.0001) // 17 hffzykmwhknjkuzdkteuovexbedlobnigfglrmnzqeswowytef-soxc-qffiboz-hffzyk
936     (PID.TID 0000.0001) // 16 rxowhhkscth+qgrpdiawwwlnzdlq-xmhjkt+tt+eqiweslb-clsykbrdupxpxkonrxowhh
937     (PID.TID 0000.0001) // 15 acw+a+lrboixifmnkycszbfvhc+r-+ltuwmiqtmmrdxmmxupnmzsyhxjqjynscjlacw+a+
938     (PID.TID 0000.0001) // 14 okywyc++bcmcghdpcvaghuodsnmxaeotkagayglgqbslgnfxalgjateicjujaucvokywyc
939     (PID.TID 0000.0001) // 13 cfqupaxr+urqftzvg+ouheuuyhekahfamqd+rpkmcvuuvpkytrrnoibzlwlkqwwzcfqupa
940     (PID.TID 0000.0001) // 12 amaiuoesnp+ojxyfjiweookudwquowjyllqsvduhxljfvuixungeehrsxkrtlmyoamaiuo
941     (PID.TID 0000.0001) // 11 gxxmiqhpmjfdimgomwmxnywly+ssgabjdeadjwwocvdqstlmuccxdiemiualjbtxgxxmiq
942     (PID.TID 0000.0001) // 10 narmobxyvjbxhhbpmcjixixffhnoeryuvrxlzgskusweojkhmuqglz-a-wyksnlxnarmob
943     (PID.TID 0000.0001) // 9 xiiwsk-aejwklxtbtaqctnebmzlyudpbnybzouyrauqdon-ujixhnlzmmuumplolxiiwsk
944     (PID.TID 0000.0001) // 8 devrhsvgdrjyzuvdfqxkcszhkutghwnthoaiwhqnlzzqrbrdcokdzcgmvesumqekdevrhs
945     (PID.TID 0000.0001) // 7 ytvdjncnpudrywwumxmcso+hxzhgrlgsbryrtpmigrmgliwwbcpuregdcc-tmmfaytvdjn
946     (PID.TID 0000.0001) // 6 yukdlhhnjeyai+jrpraftcuzzjjrbyvvepsetxmnslaswyovjtvvkwbyvuokketgyukdlh
947     (PID.TID 0000.0001) // 5 srrtdnvsquoyypnbzltwmatnm-szekjjoeatqiqtfijncdjqyrfnfqnmpx+ansmrsrrtdn
948     (PID.TID 0000.0001) // 4 lvdv+nyjqdvsqlvthpu-xhfob+xvskfdciwsyatkjylsjlscrxoetmiypmzbbdwhlvdv+n
949     (PID.TID 0000.0001) // 3 wzbwmaapbfbxtyabslvahcfskkeoswpzgahmhgnugvsvbdltdcgm-hpajhypctzdwzbwma
950     (PID.TID 0000.0001) // 2 jvvquuljbvtv+wdpacdqsokdilsynkkblfxftq+cehrcdtfelkksrwzczxcv-hmojvvquu
951     (PID.TID 0000.0001) // 1 efvmkzp-jcnbggmb+n-xommngmjeqmulcvhi-ohziaooezwtwkrso+hbtbcmxdktefvmkz
952     (PID.TID 0000.0001) // 0 hieuylrqcd+mluxgasfo+kpdbvlduihrlre-tvz+nzbrmismxnssfdzhd+uzrysthieuyl
953     (PID.TID 0000.0001) // -1 bnnquytzmkpdoliuznrbugtdwhfubxnqgshokiauqpb+fbef-srpxsjrhgzqfiajbnnquy
954     (PID.TID 0000.0001) // -2 zupybckhahjm-csqcyonlvl+syjygtnjfabirmnubrfhiolfnajthyvalraq+twezupybc
955     (PID.TID 0000.0001) // =======================================================
956     (PID.TID 0000.0001) // END OF FIELD =
957     (PID.TID 0000.0001) // =======================================================
958     (PID.TID 0000.0001)
959     (PID.TID 0000.0001) // =======================================================
960     (PID.TID 0000.0001) // Field S/R LOAD_WIND_STRESS_CLIMATOLOGY FU at iteration 1
961     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
962     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
963     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
964     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
965     (PID.TID 0000.0001) // 0.0: .
966     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 67: 1)
967     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 67: -2: -1)
968     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
969     (PID.TID 0000.0001) // =======================================================
970     (PID.TID 0000.0001) K = 1
971     (PID.TID 0000.0001) // I=7 I=17 I=27 I=37 I=47 I=57 I=67
972     (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123456|890123456|890123456|890123456|
973     (PID.TID 0000.0001) // 67 ......................................................................
974     (PID.TID 0000.0001) // 66 ......................................................................
975     (PID.TID 0000.0001) // 65 ......................................................................
976     (PID.TID 0000.0001) // 64 ......................................................................
977     (PID.TID 0000.0001) // 63 ......................................................................
978     (PID.TID 0000.0001) // 62 ......................................................................
979     (PID.TID 0000.0001) // 61 ......................................................................
980     (PID.TID 0000.0001) // 60 ......................................................................
981     (PID.TID 0000.0001) // 59 ......................................................................
982     (PID.TID 0000.0001) // 58 ......................................................................
983     (PID.TID 0000.0001) // 57 ......................................................................
984     (PID.TID 0000.0001) // 56 ......................................................................
985     (PID.TID 0000.0001) // 55 ......................................................................
986     (PID.TID 0000.0001) // 54 ......................................................................
987     (PID.TID 0000.0001) // 53 ......................................................................
988     (PID.TID 0000.0001) // 52 ......................................................................
989     (PID.TID 0000.0001) // 51 ......................................................................
990     (PID.TID 0000.0001) // 50 ......................................................................
991     (PID.TID 0000.0001) // 49 ......................................................................
992     (PID.TID 0000.0001) // 48 ......................................................................
993     (PID.TID 0000.0001) // 47 ......................................................................
994     (PID.TID 0000.0001) // 46 ......................................................................
995     (PID.TID 0000.0001) // 45 ......................................................................
996     (PID.TID 0000.0001) // 44 ......................................................................
997     (PID.TID 0000.0001) // 43 ......................................................................
998     (PID.TID 0000.0001) // 42 ......................................................................
999     (PID.TID 0000.0001) // 41 ......................................................................
1000     (PID.TID 0000.0001) // 40 ......................................................................
1001     (PID.TID 0000.0001) // 39 ......................................................................
1002     (PID.TID 0000.0001) // 38 ......................................................................
1003     (PID.TID 0000.0001) // 37 ......................................................................
1004     (PID.TID 0000.0001) // 36 ......................................................................
1005     (PID.TID 0000.0001) // 35 ......................................................................
1006     (PID.TID 0000.0001) // 34 ......................................................................
1007     (PID.TID 0000.0001) // 33 ......................................................................
1008     (PID.TID 0000.0001) // 32 ......................................................................
1009     (PID.TID 0000.0001) // 31 ......................................................................
1010     (PID.TID 0000.0001) // 30 ......................................................................
1011     (PID.TID 0000.0001) // 29 ......................................................................
1012     (PID.TID 0000.0001) // 28 ......................................................................
1013     (PID.TID 0000.0001) // 27 ......................................................................
1014     (PID.TID 0000.0001) // 26 ......................................................................
1015     (PID.TID 0000.0001) // 25 ......................................................................
1016     (PID.TID 0000.0001) // 24 ......................................................................
1017     (PID.TID 0000.0001) // 23 ......................................................................
1018     (PID.TID 0000.0001) // 22 ......................................................................
1019     (PID.TID 0000.0001) // 21 ......................................................................
1020     (PID.TID 0000.0001) // 20 ......................................................................
1021     (PID.TID 0000.0001) // 19 ......................................................................
1022     (PID.TID 0000.0001) // 18 ......................................................................
1023     (PID.TID 0000.0001) // 17 ......................................................................
1024     (PID.TID 0000.0001) // 16 ......................................................................
1025     (PID.TID 0000.0001) // 15 ......................................................................
1026     (PID.TID 0000.0001) // 14 ......................................................................
1027     (PID.TID 0000.0001) // 13 ......................................................................
1028     (PID.TID 0000.0001) // 12 ......................................................................
1029     (PID.TID 0000.0001) // 11 ......................................................................
1030     (PID.TID 0000.0001) // 10 ......................................................................
1031     (PID.TID 0000.0001) // 9 ......................................................................
1032     (PID.TID 0000.0001) // 8 ......................................................................
1033     (PID.TID 0000.0001) // 7 ......................................................................
1034     (PID.TID 0000.0001) // 6 ......................................................................
1035     (PID.TID 0000.0001) // 5 ......................................................................
1036     (PID.TID 0000.0001) // 4 ......................................................................
1037     (PID.TID 0000.0001) // 3 ......................................................................
1038     (PID.TID 0000.0001) // 2 ......................................................................
1039     (PID.TID 0000.0001) // 1 ......................................................................
1040     (PID.TID 0000.0001) // 0 ......................................................................
1041     (PID.TID 0000.0001) // -1 ......................................................................
1042     (PID.TID 0000.0001) // -2 ......................................................................
1043     (PID.TID 0000.0001) // =======================================================
1044     (PID.TID 0000.0001) // END OF FIELD =
1045     (PID.TID 0000.0001) // =======================================================
1046     (PID.TID 0000.0001)
1047     (PID.TID 0000.0001) // =======================================================
1048     (PID.TID 0000.0001) // Field S/R LOAD_WIND_STRESS_CLIMATOLOGY FV at iteration 1
1049     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
1050     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
1051     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
1052     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
1053     (PID.TID 0000.0001) // 0.0: .
1054     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 67: 1)
1055     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 67: -2: -1)
1056     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
1057     (PID.TID 0000.0001) // =======================================================
1058     (PID.TID 0000.0001) K = 1
1059     (PID.TID 0000.0001) // I=7 I=17 I=27 I=37 I=47 I=57 I=67
1060     (PID.TID 0000.0001) // |--J--|**0123456|890123456|890123456|890123456|890123456|890123456|890123456|
1061     (PID.TID 0000.0001) // 67 ......................................................................
1062     (PID.TID 0000.0001) // 66 ......................................................................
1063     (PID.TID 0000.0001) // 65 ......................................................................
1064     (PID.TID 0000.0001) // 64 ......................................................................
1065     (PID.TID 0000.0001) // 63 ......................................................................
1066     (PID.TID 0000.0001) // 62 ......................................................................
1067     (PID.TID 0000.0001) // 61 ......................................................................
1068     (PID.TID 0000.0001) // 60 ......................................................................
1069     (PID.TID 0000.0001) // 59 ......................................................................
1070     (PID.TID 0000.0001) // 58 ......................................................................
1071     (PID.TID 0000.0001) // 57 ......................................................................
1072     (PID.TID 0000.0001) // 56 ......................................................................
1073     (PID.TID 0000.0001) // 55 ......................................................................
1074     (PID.TID 0000.0001) // 54 ......................................................................
1075     (PID.TID 0000.0001) // 53 ......................................................................
1076     (PID.TID 0000.0001) // 52 ......................................................................
1077     (PID.TID 0000.0001) // 51 ......................................................................
1078     (PID.TID 0000.0001) // 50 ......................................................................
1079     (PID.TID 0000.0001) // 49 ......................................................................
1080     (PID.TID 0000.0001) // 48 ......................................................................
1081     (PID.TID 0000.0001) // 47 ......................................................................
1082     (PID.TID 0000.0001) // 46 ......................................................................
1083     (PID.TID 0000.0001) // 45 ......................................................................
1084     (PID.TID 0000.0001) // 44 ......................................................................
1085     (PID.TID 0000.0001) // 43 ......................................................................
1086     (PID.TID 0000.0001) // 42 ......................................................................
1087     (PID.TID 0000.0001) // 41 ......................................................................
1088     (PID.TID 0000.0001) // 40 ......................................................................
1089     (PID.TID 0000.0001) // 39 ......................................................................
1090     (PID.TID 0000.0001) // 38 ......................................................................
1091     (PID.TID 0000.0001) // 37 ......................................................................
1092     (PID.TID 0000.0001) // 36 ......................................................................
1093     (PID.TID 0000.0001) // 35 ......................................................................
1094     (PID.TID 0000.0001) // 34 ......................................................................
1095     (PID.TID 0000.0001) // 33 ......................................................................
1096     (PID.TID 0000.0001) // 32 ......................................................................
1097     (PID.TID 0000.0001) // 31 ......................................................................
1098     (PID.TID 0000.0001) // 30 ......................................................................
1099     (PID.TID 0000.0001) // 29 ......................................................................
1100     (PID.TID 0000.0001) // 28 ......................................................................
1101     (PID.TID 0000.0001) // 27 ......................................................................
1102     (PID.TID 0000.0001) // 26 ......................................................................
1103     (PID.TID 0000.0001) // 25 ......................................................................
1104     (PID.TID 0000.0001) // 24 ......................................................................
1105     (PID.TID 0000.0001) // 23 ......................................................................
1106     (PID.TID 0000.0001) // 22 ......................................................................
1107     (PID.TID 0000.0001) // 21 ......................................................................
1108     (PID.TID 0000.0001) // 20 ......................................................................
1109     (PID.TID 0000.0001) // 19 ......................................................................
1110     (PID.TID 0000.0001) // 18 ......................................................................
1111     (PID.TID 0000.0001) // 17 ......................................................................
1112     (PID.TID 0000.0001) // 16 ......................................................................
1113     (PID.TID 0000.0001) // 15 ......................................................................
1114     (PID.TID 0000.0001) // 14 ......................................................................
1115     (PID.TID 0000.0001) // 13 ......................................................................
1116     (PID.TID 0000.0001) // 12 ......................................................................
1117     (PID.TID 0000.0001) // 11 ......................................................................
1118     (PID.TID 0000.0001) // 10 ......................................................................
1119     (PID.TID 0000.0001) // 9 ......................................................................
1120     (PID.TID 0000.0001) // 8 ......................................................................
1121     (PID.TID 0000.0001) // 7 ......................................................................
1122     (PID.TID 0000.0001) // 6 ......................................................................
1123     (PID.TID 0000.0001) // 5 ......................................................................
1124     (PID.TID 0000.0001) // 4 ......................................................................
1125     (PID.TID 0000.0001) // 3 ......................................................................
1126     (PID.TID 0000.0001) // 2 ......................................................................
1127     (PID.TID 0000.0001) // 1 ......................................................................
1128     (PID.TID 0000.0001) // 0 ......................................................................
1129     (PID.TID 0000.0001) // -1 ......................................................................
1130     (PID.TID 0000.0001) // -2 ......................................................................
1131     (PID.TID 0000.0001) // =======================================================
1132     (PID.TID 0000.0001) // END OF FIELD =
1133     (PID.TID 0000.0001) // =======================================================
1134     (PID.TID 0000.0001)
1135     (PID.TID 0000.0001) // =======================================================
1136     (PID.TID 0000.0001) // Field Current uVel at iteration 0
1137     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
1138     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
1139     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
1140     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
1141     (PID.TID 0000.0001) // 0.0: .
1142     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 64: 1)
1143     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 64: 1: -1)
1144     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
1145     (PID.TID 0000.0001) // =======================================================
1146     (PID.TID 0000.0001) K = 1
1147     (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60
1148     (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|1234
1149     (PID.TID 0000.0001) 64 ................................................................
1150     (PID.TID 0000.0001) 63 ................................................................
1151     (PID.TID 0000.0001) 62 ................................................................
1152     (PID.TID 0000.0001) 61 ................................................................
1153     (PID.TID 0000.0001) 60 ................................................................
1154     (PID.TID 0000.0001) 59 ................................................................
1155     (PID.TID 0000.0001) 58 ................................................................
1156     (PID.TID 0000.0001) 57 ................................................................
1157     (PID.TID 0000.0001) 56 ................................................................
1158     (PID.TID 0000.0001) 55 ................................................................
1159     (PID.TID 0000.0001) 54 ................................................................
1160     (PID.TID 0000.0001) 53 ................................................................
1161     (PID.TID 0000.0001) 52 ................................................................
1162     (PID.TID 0000.0001) 51 ................................................................
1163     (PID.TID 0000.0001) 50 ................................................................
1164     (PID.TID 0000.0001) 49 ................................................................
1165     (PID.TID 0000.0001) 48 ................................................................
1166     (PID.TID 0000.0001) 47 ................................................................
1167     (PID.TID 0000.0001) 46 ................................................................
1168     (PID.TID 0000.0001) 45 ................................................................
1169     (PID.TID 0000.0001) 44 ................................................................
1170     (PID.TID 0000.0001) 43 ................................................................
1171     (PID.TID 0000.0001) 42 ................................................................
1172     (PID.TID 0000.0001) 41 ................................................................
1173     (PID.TID 0000.0001) 40 ................................................................
1174     (PID.TID 0000.0001) 39 ................................................................
1175     (PID.TID 0000.0001) 38 ................................................................
1176     (PID.TID 0000.0001) 37 ................................................................
1177     (PID.TID 0000.0001) 36 ................................................................
1178     (PID.TID 0000.0001) 35 ................................................................
1179     (PID.TID 0000.0001) 34 ................................................................
1180     (PID.TID 0000.0001) 33 ................................................................
1181     (PID.TID 0000.0001) 32 ................................................................
1182     (PID.TID 0000.0001) 31 ................................................................
1183     (PID.TID 0000.0001) 30 ................................................................
1184     (PID.TID 0000.0001) 29 ................................................................
1185     (PID.TID 0000.0001) 28 ................................................................
1186     (PID.TID 0000.0001) 27 ................................................................
1187     (PID.TID 0000.0001) 26 ................................................................
1188     (PID.TID 0000.0001) 25 ................................................................
1189     (PID.TID 0000.0001) 24 ................................................................
1190     (PID.TID 0000.0001) 23 ................................................................
1191     (PID.TID 0000.0001) 22 ................................................................
1192     (PID.TID 0000.0001) 21 ................................................................
1193     (PID.TID 0000.0001) 20 ................................................................
1194     (PID.TID 0000.0001) 19 ................................................................
1195     (PID.TID 0000.0001) 18 ................................................................
1196     (PID.TID 0000.0001) 17 ................................................................
1197     (PID.TID 0000.0001) 16 ................................................................
1198     (PID.TID 0000.0001) 15 ................................................................
1199     (PID.TID 0000.0001) 14 ................................................................
1200     (PID.TID 0000.0001) 13 ................................................................
1201     (PID.TID 0000.0001) 12 ................................................................
1202     (PID.TID 0000.0001) 11 ................................................................
1203     (PID.TID 0000.0001) 10 ................................................................
1204     (PID.TID 0000.0001) 9 ................................................................
1205     (PID.TID 0000.0001) 8 ................................................................
1206     (PID.TID 0000.0001) 7 ................................................................
1207     (PID.TID 0000.0001) 6 ................................................................
1208     (PID.TID 0000.0001) 5 ................................................................
1209     (PID.TID 0000.0001) 4 ................................................................
1210     (PID.TID 0000.0001) 3 ................................................................
1211     (PID.TID 0000.0001) 2 ................................................................
1212     (PID.TID 0000.0001) 1 ................................................................
1213     (PID.TID 0000.0001) // =======================================================
1214     (PID.TID 0000.0001) // END OF FIELD =
1215     (PID.TID 0000.0001) // =======================================================
1216     (PID.TID 0000.0001)
1217     (PID.TID 0000.0001) // =======================================================
1218     (PID.TID 0000.0001) // Field Current vVel at iteration 0
1219     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
1220     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
1221     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
1222     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
1223     (PID.TID 0000.0001) // 0.0: .
1224     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 64: 1)
1225     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 64: 1: -1)
1226     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
1227     (PID.TID 0000.0001) // =======================================================
1228     (PID.TID 0000.0001) K = 1
1229     (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60
1230     (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|1234
1231     (PID.TID 0000.0001) 64 ................................................................
1232     (PID.TID 0000.0001) 63 ................................................................
1233     (PID.TID 0000.0001) 62 ................................................................
1234     (PID.TID 0000.0001) 61 ................................................................
1235     (PID.TID 0000.0001) 60 ................................................................
1236     (PID.TID 0000.0001) 59 ................................................................
1237     (PID.TID 0000.0001) 58 ................................................................
1238     (PID.TID 0000.0001) 57 ................................................................
1239     (PID.TID 0000.0001) 56 ................................................................
1240     (PID.TID 0000.0001) 55 ................................................................
1241     (PID.TID 0000.0001) 54 ................................................................
1242     (PID.TID 0000.0001) 53 ................................................................
1243     (PID.TID 0000.0001) 52 ................................................................
1244     (PID.TID 0000.0001) 51 ................................................................
1245     (PID.TID 0000.0001) 50 ................................................................
1246     (PID.TID 0000.0001) 49 ................................................................
1247     (PID.TID 0000.0001) 48 ................................................................
1248     (PID.TID 0000.0001) 47 ................................................................
1249     (PID.TID 0000.0001) 46 ................................................................
1250     (PID.TID 0000.0001) 45 ................................................................
1251     (PID.TID 0000.0001) 44 ................................................................
1252     (PID.TID 0000.0001) 43 ................................................................
1253     (PID.TID 0000.0001) 42 ................................................................
1254     (PID.TID 0000.0001) 41 ................................................................
1255     (PID.TID 0000.0001) 40 ................................................................
1256     (PID.TID 0000.0001) 39 ................................................................
1257     (PID.TID 0000.0001) 38 ................................................................
1258     (PID.TID 0000.0001) 37 ................................................................
1259     (PID.TID 0000.0001) 36 ................................................................
1260     (PID.TID 0000.0001) 35 ................................................................
1261     (PID.TID 0000.0001) 34 ................................................................
1262     (PID.TID 0000.0001) 33 ................................................................
1263     (PID.TID 0000.0001) 32 ................................................................
1264     (PID.TID 0000.0001) 31 ................................................................
1265     (PID.TID 0000.0001) 30 ................................................................
1266     (PID.TID 0000.0001) 29 ................................................................
1267     (PID.TID 0000.0001) 28 ................................................................
1268     (PID.TID 0000.0001) 27 ................................................................
1269     (PID.TID 0000.0001) 26 ................................................................
1270     (PID.TID 0000.0001) 25 ................................................................
1271     (PID.TID 0000.0001) 24 ................................................................
1272     (PID.TID 0000.0001) 23 ................................................................
1273     (PID.TID 0000.0001) 22 ................................................................
1274     (PID.TID 0000.0001) 21 ................................................................
1275     (PID.TID 0000.0001) 20 ................................................................
1276     (PID.TID 0000.0001) 19 ................................................................
1277     (PID.TID 0000.0001) 18 ................................................................
1278     (PID.TID 0000.0001) 17 ................................................................
1279     (PID.TID 0000.0001) 16 ................................................................
1280     (PID.TID 0000.0001) 15 ................................................................
1281     (PID.TID 0000.0001) 14 ................................................................
1282     (PID.TID 0000.0001) 13 ................................................................
1283     (PID.TID 0000.0001) 12 ................................................................
1284     (PID.TID 0000.0001) 11 ................................................................
1285     (PID.TID 0000.0001) 10 ................................................................
1286     (PID.TID 0000.0001) 9 ................................................................
1287     (PID.TID 0000.0001) 8 ................................................................
1288     (PID.TID 0000.0001) 7 ................................................................
1289     (PID.TID 0000.0001) 6 ................................................................
1290     (PID.TID 0000.0001) 5 ................................................................
1291     (PID.TID 0000.0001) 4 ................................................................
1292     (PID.TID 0000.0001) 3 ................................................................
1293     (PID.TID 0000.0001) 2 ................................................................
1294     (PID.TID 0000.0001) 1 ................................................................
1295     (PID.TID 0000.0001) // =======================================================
1296     (PID.TID 0000.0001) // END OF FIELD =
1297     (PID.TID 0000.0001) // =======================================================
1298     (PID.TID 0000.0001)
1299     (PID.TID 0000.0001) // =======================================================
1300     (PID.TID 0000.0001) // Field Current theta at iteration 0
1301     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
1302     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
1303     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
1304     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
1305     (PID.TID 0000.0001) // 0.0: .
1306     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 64: 1)
1307     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 64: 1: -1)
1308     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
1309     (PID.TID 0000.0001) // =======================================================
1310     (PID.TID 0000.0001) K = 1
1311     (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60
1312     (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|1234
1313     (PID.TID 0000.0001) 64 ................................................................
1314     (PID.TID 0000.0001) 63 ................................................................
1315     (PID.TID 0000.0001) 62 ................................................................
1316     (PID.TID 0000.0001) 61 ................................................................
1317     (PID.TID 0000.0001) 60 ................................................................
1318     (PID.TID 0000.0001) 59 ................................................................
1319     (PID.TID 0000.0001) 58 ................................................................
1320     (PID.TID 0000.0001) 57 ................................................................
1321     (PID.TID 0000.0001) 56 ................................................................
1322     (PID.TID 0000.0001) 55 ................................................................
1323     (PID.TID 0000.0001) 54 ................................................................
1324     (PID.TID 0000.0001) 53 ................................................................
1325     (PID.TID 0000.0001) 52 ................................................................
1326     (PID.TID 0000.0001) 51 ................................................................
1327     (PID.TID 0000.0001) 50 ................................................................
1328     (PID.TID 0000.0001) 49 ................................................................
1329     (PID.TID 0000.0001) 48 ................................................................
1330     (PID.TID 0000.0001) 47 ................................................................
1331     (PID.TID 0000.0001) 46 ................................................................
1332     (PID.TID 0000.0001) 45 ................................................................
1333     (PID.TID 0000.0001) 44 ................................................................
1334     (PID.TID 0000.0001) 43 ................................................................
1335     (PID.TID 0000.0001) 42 ................................................................
1336     (PID.TID 0000.0001) 41 ................................................................
1337     (PID.TID 0000.0001) 40 ................................................................
1338     (PID.TID 0000.0001) 39 ................................................................
1339     (PID.TID 0000.0001) 38 ................................................................
1340     (PID.TID 0000.0001) 37 ................................................................
1341     (PID.TID 0000.0001) 36 ................................................................
1342     (PID.TID 0000.0001) 35 ................................................................
1343     (PID.TID 0000.0001) 34 ................................................................
1344     (PID.TID 0000.0001) 33 ................................................................
1345     (PID.TID 0000.0001) 32 ................................................................
1346     (PID.TID 0000.0001) 31 ................................................................
1347     (PID.TID 0000.0001) 30 ................................................................
1348     (PID.TID 0000.0001) 29 ................................................................
1349     (PID.TID 0000.0001) 28 ................................................................
1350     (PID.TID 0000.0001) 27 ................................................................
1351     (PID.TID 0000.0001) 26 ................................................................
1352     (PID.TID 0000.0001) 25 ................................................................
1353     (PID.TID 0000.0001) 24 ................................................................
1354     (PID.TID 0000.0001) 23 ................................................................
1355     (PID.TID 0000.0001) 22 ................................................................
1356     (PID.TID 0000.0001) 21 ................................................................
1357     (PID.TID 0000.0001) 20 ................................................................
1358     (PID.TID 0000.0001) 19 ................................................................
1359     (PID.TID 0000.0001) 18 ................................................................
1360     (PID.TID 0000.0001) 17 ................................................................
1361     (PID.TID 0000.0001) 16 ................................................................
1362     (PID.TID 0000.0001) 15 ................................................................
1363     (PID.TID 0000.0001) 14 ................................................................
1364     (PID.TID 0000.0001) 13 ................................................................
1365     (PID.TID 0000.0001) 12 ................................................................
1366     (PID.TID 0000.0001) 11 ................................................................
1367     (PID.TID 0000.0001) 10 ................................................................
1368     (PID.TID 0000.0001) 9 ................................................................
1369     (PID.TID 0000.0001) 8 ................................................................
1370     (PID.TID 0000.0001) 7 ................................................................
1371     (PID.TID 0000.0001) 6 ................................................................
1372     (PID.TID 0000.0001) 5 ................................................................
1373     (PID.TID 0000.0001) 4 ................................................................
1374     (PID.TID 0000.0001) 3 ................................................................
1375     (PID.TID 0000.0001) 2 ................................................................
1376     (PID.TID 0000.0001) 1 ................................................................
1377     (PID.TID 0000.0001) // =======================================================
1378     (PID.TID 0000.0001) // END OF FIELD =
1379     (PID.TID 0000.0001) // =======================================================
1380     (PID.TID 0000.0001)
1381     (PID.TID 0000.0001) // =======================================================
1382     (PID.TID 0000.0001) // Field Current cg2d_x at iteration 0
1383     (PID.TID 0000.0001) // CMIN = 1.000000000000000E+32
1384     (PID.TID 0000.0001) // CMAX = -1.000000000000000E+32
1385     (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
1386     (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
1387     (PID.TID 0000.0001) // 0.0: .
1388     (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -2: 67: 1)
1389     (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 67: -2: -1)
1390     (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
1391     (PID.TID 0000.0001) // =======================================================
1392     (PID.TID 0000.0001) K = 1
1393     (PID.TID 0000.0001) I=7 I=17 I=27 I=37 I=47 I=57 I=67
1394     (PID.TID 0000.0001) |--J--|**0123456|890123456|890123456|890123456|890123456|890123456|890123456|
1395     (PID.TID 0000.0001) 67 ......................................................................
1396     (PID.TID 0000.0001) 66 ......................................................................
1397     (PID.TID 0000.0001) 65 ......................................................................
1398     (PID.TID 0000.0001) 64 ......................................................................
1399     (PID.TID 0000.0001) 63 ......................................................................
1400     (PID.TID 0000.0001) 62 ......................................................................
1401     (PID.TID 0000.0001) 61 ......................................................................
1402     (PID.TID 0000.0001) 60 ......................................................................
1403     (PID.TID 0000.0001) 59 ......................................................................
1404     (PID.TID 0000.0001) 58 ......................................................................
1405     (PID.TID 0000.0001) 57 ......................................................................
1406     (PID.TID 0000.0001) 56 ......................................................................
1407     (PID.TID 0000.0001) 55 ......................................................................
1408     (PID.TID 0000.0001) 54 ......................................................................
1409     (PID.TID 0000.0001) 53 ......................................................................
1410     (PID.TID 0000.0001) 52 ......................................................................
1411     (PID.TID 0000.0001) 51 ......................................................................
1412     (PID.TID 0000.0001) 50 ......................................................................
1413     (PID.TID 0000.0001) 49 ......................................................................
1414     (PID.TID 0000.0001) 48 ......................................................................
1415     (PID.TID 0000.0001) 47 ......................................................................
1416     (PID.TID 0000.0001) 46 ......................................................................
1417     (PID.TID 0000.0001) 45 ......................................................................
1418     (PID.TID 0000.0001) 44 ......................................................................
1419     (PID.TID 0000.0001) 43 ......................................................................
1420     (PID.TID 0000.0001) 42 ......................................................................
1421     (PID.TID 0000.0001) 41 ......................................................................
1422     (PID.TID 0000.0001) 40 ......................................................................
1423     (PID.TID 0000.0001) 39 ......................................................................
1424     (PID.TID 0000.0001) 38 ......................................................................
1425     (PID.TID 0000.0001) 37 ......................................................................
1426     (PID.TID 0000.0001) 36 ......................................................................
1427     (PID.TID 0000.0001) 35 ......................................................................
1428     (PID.TID 0000.0001) 34 ......................................................................
1429     (PID.TID 0000.0001) 33 ......................................................................
1430     (PID.TID 0000.0001) 32 ......................................................................
1431     (PID.TID 0000.0001) 31 ......................................................................
1432     (PID.TID 0000.0001) 30 ......................................................................
1433     (PID.TID 0000.0001) 29 ......................................................................
1434     (PID.TID 0000.0001) 28 ......................................................................
1435     (PID.TID 0000.0001) 27 ......................................................................
1436     (PID.TID 0000.0001) 26 ......................................................................
1437     (PID.TID 0000.0001) 25 ......................................................................
1438     (PID.TID 0000.0001) 24 ......................................................................
1439     (PID.TID 0000.0001) 23 ......................................................................
1440     (PID.TID 0000.0001) 22 ......................................................................
1441     (PID.TID 0000.0001) 21 ......................................................................
1442     (PID.TID 0000.0001) 20 ......................................................................
1443     (PID.TID 0000.0001) 19 ......................................................................
1444     (PID.TID 0000.0001) 18 ......................................................................
1445     (PID.TID 0000.0001) 17 ......................................................................
1446     (PID.TID 0000.0001) 16 ......................................................................
1447     (PID.TID 0000.0001) 15 ......................................................................
1448     (PID.TID 0000.0001) 14 ......................................................................
1449     (PID.TID 0000.0001) 13 ......................................................................
1450     (PID.TID 0000.0001) 12 ......................................................................
1451     (PID.TID 0000.0001) 11 ......................................................................
1452     (PID.TID 0000.0001) 10 ......................................................................
1453     (PID.TID 0000.0001) 9 ......................................................................
1454     (PID.TID 0000.0001) 8 ......................................................................
1455     (PID.TID 0000.0001) 7 ......................................................................
1456     (PID.TID 0000.0001) 6 ......................................................................
1457     (PID.TID 0000.0001) 5 ......................................................................
1458     (PID.TID 0000.0001) 4 ......................................................................
1459     (PID.TID 0000.0001) 3 ......................................................................
1460     (PID.TID 0000.0001) 2 ......................................................................
1461     (PID.TID 0000.0001) 1 ......................................................................
1462     (PID.TID 0000.0001) 0 ......................................................................
1463     (PID.TID 0000.0001) -1 ......................................................................
1464     (PID.TID 0000.0001) -2 ......................................................................
1465     (PID.TID 0000.0001) // =======================================================
1466     (PID.TID 0000.0001) // END OF FIELD =
1467     (PID.TID 0000.0001) // =======================================================
1468     (PID.TID 0000.0001)
1469     cg2d: Sum(rhs) = 0.00000000000000E+00
1470     CG2D iters, err = 0 0.00000000000000E+00
1471     CG2D iters, err = 0 0.00000000000000E+00
1472     cg3d: Sum(rhs) = 0.00000000000000E+00
1473     CG3D iters, err = 0 0.00000000000000E+00
1474     CG3D: Iteration 0 residual = 0.000000000000000E+000
1475     CG3D iters, err = 0 0.00000000000000E+00
1476     cg2d: Sum(rhs) = 4.60742555219440E-15
1477     CG2D iters, err = 0 2.35741184876957E+01
1478     CG2D iters, err = 75 7.87249577870953E-10
1479     cg3d: Sum(rhs) = -6.47502884643103E-14
1480     CG3D iters, err = 0 2.41887156820096E+01
1481     CG3D: Iteration 0 residual = 24.1887156820096
1482     CG3D: Iteration 1 residual = 6.32465894473284
1483     CG3D: Iteration 2 residual = 2.19233887226808
1484     CG3D: Iteration 3 residual = 1.08906889975530
1485     CG3D: Iteration 4 residual = 0.589709077095962
1486     CG3D: Iteration 5 residual = 0.354168410747427
1487     CG3D: Iteration 6 residual = 0.220130888299521
1488     CG3D: Iteration 7 residual = 0.148361896375407
1489     CG3D: Iteration 8 residual = 0.103024936209174
1490     CG3D: Iteration 9 residual = 7.607603454112849E-002
1491     CG3D: Iteration 10 residual = 5.711579478161528E-002
1492     CG3D: Iteration 11 residual = 4.404152400789253E-002
1493     CG3D: Iteration 12 residual = 3.365780970102368E-002
1494     CG3D: Iteration 13 residual = 2.643074859909686E-002
1495     CG3D: Iteration 14 residual = 2.123530080828272E-002
1496     CG3D: Iteration 15 residual = 1.727182520345552E-002
1497     CG3D: Iteration 16 residual = 1.434144350205005E-002
1498     CG3D: Iteration 17 residual = 1.193956594525617E-002
1499     CG3D: Iteration 18 residual = 1.022423907847638E-002
1500     CG3D: Iteration 19 residual = 8.861277436648085E-003
1501     CG3D: Iteration 20 residual = 7.876935632062451E-003
1502     CG3D: Iteration 21 residual = 7.006649046136165E-003
1503     CG3D: Iteration 22 residual = 6.323608542461731E-003
1504     CG3D: Iteration 23 residual = 5.591382586968375E-003
1505     CG3D: Iteration 24 residual = 5.033024593495296E-003
1506     CG3D: Iteration 25 residual = 4.578671167351073E-003
1507     CG3D: Iteration 26 residual = 4.257423720593300E-003
1508     CG3D: Iteration 27 residual = 3.973718160591140E-003
1509     CG3D: Iteration 28 residual = 3.682183095587456E-003
1510     CG3D: Iteration 29 residual = 3.352145360108209E-003
1511     CG3D: Iteration 30 residual = 3.065280657674852E-003
1512     CG3D: Iteration 31 residual = 2.848623540778653E-003
1513     CG3D: Iteration 32 residual = 2.691404905743974E-003
1514     CG3D: Iteration 33 residual = 2.560277757535318E-003
1515     CG3D: Iteration 34 residual = 2.432385195743208E-003
1516     CG3D: Iteration 35 residual = 2.296777164570928E-003
1517     CG3D: Iteration 36 residual = 2.174268173803716E-003
1518     CG3D: Iteration 37 residual = 2.046697873713122E-003
1519     CG3D: Iteration 38 residual = 1.943237405160448E-003
1520     CG3D: Iteration 39 residual = 1.842899243418289E-003
1521     CG3D iters, err = 40 1.74401423451788E-03
1522     cg2d: Sum(rhs) = -3.21964677141295E-15
1523     CG2D iters, err = 0 7.69137321775504E+00
1524     CG2D iters, err = 73 9.92590406652289E-10
1525     cg3d: Sum(rhs) = -1.11965992033447E-13
1526     CG3D iters, err = 0 2.48225690265089E+01
1527     CG3D: Iteration 0 residual = 24.8225690265089
1528     CG3D: Iteration 1 residual = 7.08537013986852
1529     CG3D: Iteration 2 residual = 2.63384023637272
1530     CG3D: Iteration 3 residual = 1.37409070832936
1531     CG3D: Iteration 4 residual = 0.751585976430465
1532     CG3D: Iteration 5 residual = 0.457673050604196
1533     CG3D: Iteration 6 residual = 0.286785595543294
1534     CG3D: Iteration 7 residual = 0.194440577245785
1535     CG3D: Iteration 8 residual = 0.135881973499390
1536     CG3D: Iteration 9 residual = 0.100774210111312
1537     CG3D: Iteration 10 residual = 7.557532971019403E-002
1538     CG3D: Iteration 11 residual = 5.808002210743934E-002
1539     CG3D: Iteration 12 residual = 4.391587723808601E-002
1540     CG3D: Iteration 13 residual = 3.437400780999519E-002
1541     CG3D: Iteration 14 residual = 2.750512124040579E-002
1542     CG3D: Iteration 15 residual = 2.237473757190833E-002
1543     CG3D: Iteration 16 residual = 1.847207202400955E-002
1544     CG3D: Iteration 17 residual = 1.533267797537208E-002
1545     CG3D: Iteration 18 residual = 1.297559703753266E-002
1546     CG3D: Iteration 19 residual = 1.112406210587411E-002
1547     CG3D: Iteration 20 residual = 9.718801058609575E-003
1548     CG3D: Iteration 21 residual = 8.575011706202274E-003
1549     CG3D: Iteration 22 residual = 7.655890427337378E-003
1550     CG3D: Iteration 23 residual = 6.789974485872147E-003
1551     CG3D: Iteration 24 residual = 6.121072882360599E-003
1552     CG3D: Iteration 25 residual = 5.610558879736233E-003
1553     CG3D: Iteration 26 residual = 5.259384906707707E-003
1554     CG3D: Iteration 27 residual = 4.959915942054732E-003
1555     CG3D: Iteration 28 residual = 4.623812380238794E-003
1556     CG3D: Iteration 29 residual = 4.272486902438908E-003
1557     CG3D: Iteration 30 residual = 3.983020951034979E-003
1558     CG3D: Iteration 31 residual = 3.814955632254517E-003
1559     CG3D: Iteration 32 residual = 3.715818153730191E-003
1560     CG3D: Iteration 33 residual = 3.670667618254248E-003
1561     CG3D: Iteration 34 residual = 3.618843669454535E-003
1562     CG3D: Iteration 35 residual = 3.560430460659068E-003
1563     CG3D: Iteration 36 residual = 3.503145135386499E-003
1564     CG3D: Iteration 37 residual = 3.428768584201613E-003
1565     CG3D: Iteration 38 residual = 3.359258174083925E-003
1566     CG3D: Iteration 39 residual = 3.256468453347627E-003
1567     CG3D iters, err = 40 3.15059830935660E-03
1568     cg2d: Sum(rhs) = 1.26010313294955E-14
1569     CG2D iters, err = 0 1.78479857898072E+01
1570     CG2D iters, err = 73 8.65979776354129E-10
1571     cg3d: Sum(rhs) = 3.44151790399039E-14
1572     CG3D iters, err = 0 2.36980122862151E+01
1573     CG3D: Iteration 0 residual = 23.6980122862151
1574     CG3D: Iteration 1 residual = 5.91476675913169
1575     CG3D: Iteration 2 residual = 1.79861333214656
1576     CG3D: Iteration 3 residual = 0.807190869772768
1577     CG3D: Iteration 4 residual = 0.409355842544437
1578     CG3D: Iteration 5 residual = 0.235000498221177
1579     CG3D: Iteration 6 residual = 0.137242490038615
1580     CG3D: Iteration 7 residual = 8.860193570221124E-002
1581     CG3D: Iteration 8 residual = 5.801766089947321E-002
1582     CG3D: Iteration 9 residual = 4.116126258475289E-002
1583     CG3D: Iteration 10 residual = 3.008482317970048E-002
1584     CG3D: Iteration 11 residual = 2.295701002389875E-002
1585     CG3D: Iteration 12 residual = 1.752947905029734E-002
1586     CG3D: Iteration 13 residual = 1.331044847168241E-002
1587     CG3D: Iteration 14 residual = 1.044583544975906E-002
1588     CG3D: Iteration 15 residual = 8.408668009612437E-003
1589     CG3D: Iteration 16 residual = 6.844438490725589E-003
1590     CG3D: Iteration 17 residual = 5.665526898627329E-003
1591     CG3D: Iteration 18 residual = 4.750832381109803E-003
1592     CG3D: Iteration 19 residual = 4.055248046854902E-003
1593     CG3D: Iteration 20 residual = 3.557155225427515E-003
1594     CG3D: Iteration 21 residual = 3.122410566596633E-003
1595     CG3D: Iteration 22 residual = 2.867116600657605E-003
1596     CG3D: Iteration 23 residual = 2.603156349041550E-003
1597     CG3D: Iteration 24 residual = 2.369271812935292E-003
1598     CG3D: Iteration 25 residual = 2.203212156155059E-003
1599     CG3D: Iteration 26 residual = 2.090691786179141E-003
1600     CG3D: Iteration 27 residual = 2.000082711297653E-003
1601     CG3D: Iteration 28 residual = 1.962004670006740E-003
1602     CG3D: Iteration 29 residual = 1.866480532837512E-003
1603     CG3D: Iteration 30 residual = 1.774118546365657E-003
1604     CG3D: Iteration 31 residual = 1.685608581338685E-003
1605     CG3D: Iteration 32 residual = 1.655591834646026E-003
1606     CG3D: Iteration 33 residual = 1.636083676752095E-003
1607     CG3D: Iteration 34 residual = 1.630665786598586E-003
1608     CG3D: Iteration 35 residual = 1.609448153803081E-003
1609     CG3D: Iteration 36 residual = 1.584711559301348E-003
1610     CG3D: Iteration 37 residual = 1.537462087599092E-003
1611     CG3D: Iteration 38 residual = 1.483791650767581E-003
1612     CG3D: Iteration 39 residual = 1.433723071303368E-003
1613     CG3D iters, err = 40 1.35996097419878E-03
1614     cg2d: Sum(rhs) = -1.66533453693773E-15
1615     CG2D iters, err = 0 8.73599919329298E+00
1616     CG2D iters, err = 70 6.73714068181684E-10
1617     cg3d: Sum(rhs) = -2.43294967505747E-14
1618     CG3D iters, err = 0 2.28250279429075E+01
1619     CG3D: Iteration 0 residual = 22.8250279429075
1620     CG3D: Iteration 1 residual = 5.74357639274879
1621     CG3D: Iteration 2 residual = 1.87411311741008
1622     CG3D: Iteration 3 residual = 0.882994557567905
1623     CG3D: Iteration 4 residual = 0.477631179991309
1624     CG3D: Iteration 5 residual = 0.297332361939147
1625     CG3D: Iteration 6 residual = 0.196470717314387
1626     CG3D: Iteration 7 residual = 0.143229999273830
1627     CG3D: Iteration 8 residual = 0.105939657406819
1628     CG3D: Iteration 9 residual = 8.358155511840666E-002
1629     CG3D: Iteration 10 residual = 6.612456020175687E-002
1630     CG3D: Iteration 11 residual = 5.413685219789448E-002
1631     CG3D: Iteration 12 residual = 4.397302974575125E-002
1632     CG3D: Iteration 13 residual = 3.681383873052842E-002
1633     CG3D: Iteration 14 residual = 3.268122771517904E-002
1634     CG3D: Iteration 15 residual = 2.977894106916868E-002
1635     CG3D: Iteration 16 residual = 2.696699107938868E-002
1636     CG3D: Iteration 17 residual = 2.584211702694464E-002
1637     CG3D: Iteration 18 residual = 2.520752966500190E-002
1638     CG3D: Iteration 19 residual = 2.555873285017259E-002
1639     CG3D: Iteration 20 residual = 2.591266152818061E-002
1640     CG3D: Iteration 21 residual = 2.694554452294234E-002
1641     CG3D: Iteration 22 residual = 2.812491846305177E-002
1642     CG3D: Iteration 23 residual = 2.892720070562181E-002
1643     CG3D: Iteration 24 residual = 2.978792239683585E-002
1644     CG3D: Iteration 25 residual = 3.052560231146150E-002
1645     CG3D: Iteration 26 residual = 3.042797615946973E-002
1646     CG3D: Iteration 27 residual = 2.975856652837236E-002
1647     CG3D: Iteration 28 residual = 2.855931944520535E-002
1648     CG3D: Iteration 29 residual = 2.663068968705761E-002
1649     CG3D: Iteration 30 residual = 2.464578541778769E-002
1650     CG3D: Iteration 31 residual = 2.264736778495642E-002
1651     CG3D: Iteration 32 residual = 2.035640090742276E-002
1652     CG3D: Iteration 33 residual = 1.797112879106721E-002
1653     CG3D: Iteration 34 residual = 1.574601253912917E-002
1654     CG3D: Iteration 35 residual = 1.378000119842555E-002
1655     CG3D: Iteration 36 residual = 1.193543111352997E-002
1656     CG3D: Iteration 37 residual = 1.025914042018507E-002
1657     CG3D: Iteration 38 residual = 8.815469241674131E-003
1658     CG3D: Iteration 39 residual = 7.413963375031079E-003
1659     CG3D iters, err = 40 6.20336857131538E-03
1660     cg2d: Sum(rhs) = 2.20101714631937E-14
1661     CG2D iters, err = 0 1.67117253119014E+01
1662     CG2D iters, err = 71 7.96376463220845E-10
1663     cg3d: Sum(rhs) = 4.25358533118203E-14
1664     CG3D iters, err = 0 2.25840229891184E+01
1665     CG3D: Iteration 0 residual = 22.5840229891184
1666     CG3D: Iteration 1 residual = 5.08862746151542
1667     CG3D: Iteration 2 residual = 1.40045214899516
1668     CG3D: Iteration 3 residual = 0.592956315674674
1669     CG3D: Iteration 4 residual = 0.322214771904517
1670     CG3D: Iteration 5 residual = 0.224694820562840
1671     CG3D: Iteration 6 residual = 0.163259118539991
1672     CG3D: Iteration 7 residual = 0.125323900874223
1673     CG3D: Iteration 8 residual = 9.280759145576030E-002
1674     CG3D: Iteration 9 residual = 7.284518579051075E-002
1675     CG3D: Iteration 10 residual = 5.887269028785488E-002
1676     CG3D: Iteration 11 residual = 4.875786698926519E-002
1677     CG3D: Iteration 12 residual = 4.067440431788983E-002
1678     CG3D: Iteration 13 residual = 3.444747947245357E-002
1679     CG3D: Iteration 14 residual = 3.084295791665993E-002
1680     CG3D: Iteration 15 residual = 2.857390676739258E-002
1681     CG3D: Iteration 16 residual = 2.586733597677541E-002
1682     CG3D: Iteration 17 residual = 2.501752015084772E-002
1683     CG3D: Iteration 18 residual = 2.489562076944438E-002
1684     CG3D: Iteration 19 residual = 2.520406697227047E-002
1685     CG3D: Iteration 20 residual = 2.556346446577249E-002
1686     CG3D: Iteration 21 residual = 2.638579467114045E-002
1687     CG3D: Iteration 22 residual = 2.769948624018148E-002
1688     CG3D: Iteration 23 residual = 2.853420419705277E-002
1689     CG3D: Iteration 24 residual = 2.911079314285553E-002
1690     CG3D: Iteration 25 residual = 2.967748224952663E-002
1691     CG3D: Iteration 26 residual = 2.951966867432404E-002
1692     CG3D: Iteration 27 residual = 2.843887948852553E-002
1693     CG3D: Iteration 28 residual = 2.748570016151415E-002
1694     CG3D: Iteration 29 residual = 2.554569202438006E-002
1695     CG3D: Iteration 30 residual = 2.363427237396843E-002
1696     CG3D: Iteration 31 residual = 2.147652880444873E-002
1697     CG3D: Iteration 32 residual = 1.920688578330485E-002
1698     CG3D: Iteration 33 residual = 1.688064172415215E-002
1699     CG3D: Iteration 34 residual = 1.482304137631361E-002
1700     CG3D: Iteration 35 residual = 1.298781530391414E-002
1701     CG3D: Iteration 36 residual = 1.118785215558504E-002
1702     CG3D: Iteration 37 residual = 9.480794023383126E-003
1703     CG3D: Iteration 38 residual = 8.103337404474026E-003
1704     CG3D: Iteration 39 residual = 6.743304012026450E-003
1705     CG3D iters, err = 40 5.58438519086955E-03
1706     cg2d: Sum(rhs) = 2.20830298491848E-15
1707     CG2D iters, err = 0 1.20414388967445E+01
1708     CG2D iters, err = 69 6.55770946571110E-10
1709     cg3d: Sum(rhs) = -2.47969125701658E-13
1710     CG3D iters, err = 0 1.81853978362931E+01
1711     CG3D: Iteration 0 residual = 18.1853978362931
1712     CG3D: Iteration 1 residual = 4.34335599447885
1713     CG3D: Iteration 2 residual = 2.17628214831319
1714     CG3D: Iteration 3 residual = 1.85890913855462
1715     CG3D: Iteration 4 residual = 1.34760270455791
1716     CG3D: Iteration 5 residual = 0.855536967099638
1717     CG3D: Iteration 6 residual = 0.671746823480257
1718     CG3D: Iteration 7 residual = 0.553435836070328
1719     CG3D: Iteration 8 residual = 0.441340582983041
1720     CG3D: Iteration 9 residual = 0.348307104178325
1721     CG3D: Iteration 10 residual = 0.289849873984713
1722     CG3D: Iteration 11 residual = 0.254211040755616
1723     CG3D: Iteration 12 residual = 0.222168751863936
1724     CG3D: Iteration 13 residual = 0.198316083398695
1725     CG3D: Iteration 14 residual = 0.181149136068781
1726     CG3D: Iteration 15 residual = 0.173810575320768
1727     CG3D: Iteration 16 residual = 0.171264788213997
1728     CG3D: Iteration 17 residual = 0.169283113735660
1729     CG3D: Iteration 18 residual = 0.169952101056155
1730     CG3D: Iteration 19 residual = 0.178502606609402
1731     CG3D: Iteration 20 residual = 0.183418072162529
1732     CG3D: Iteration 21 residual = 0.190049593772087
1733     CG3D: Iteration 22 residual = 0.193574874653806
1734     CG3D: Iteration 23 residual = 0.198443950252210
1735     CG3D: Iteration 24 residual = 0.199930379782597
1736     CG3D: Iteration 25 residual = 0.195171477798003
1737     CG3D: Iteration 26 residual = 0.187929510194954
1738     CG3D: Iteration 27 residual = 0.180454600613609
1739     CG3D: Iteration 28 residual = 0.165036274147848
1740     CG3D: Iteration 29 residual = 0.152588288237637
1741     CG3D: Iteration 30 residual = 0.136117100857571
1742     CG3D: Iteration 31 residual = 0.122159064390994
1743     CG3D: Iteration 32 residual = 0.107383880744526
1744     CG3D: Iteration 33 residual = 9.408723697735050E-002
1745     CG3D: Iteration 34 residual = 8.114003805791078E-002
1746     CG3D: Iteration 35 residual = 6.967291556025379E-002
1747     CG3D: Iteration 36 residual = 5.945007944268656E-002
1748     CG3D: Iteration 37 residual = 4.978037121601833E-002
1749     CG3D: Iteration 38 residual = 4.116282544644471E-002
1750     CG3D: Iteration 39 residual = 3.355325357741794E-002
1751     CG3D iters, err = 40 2.71737309878213E-02
1752     cg2d: Sum(rhs) = -4.09394740330526E-16
1753     CG2D iters, err = 0 1.68521924370571E+01
1754     CG2D iters, err = 69 8.23518363212873E-10
1755     cg3d: Sum(rhs) = -1.35206082441108E-13
1756     CG3D iters, err = 0 1.69839408039138E+01
1757     CG3D: Iteration 0 residual = 16.9839408039138
1758     CG3D: Iteration 1 residual = 4.47094093102155
1759     CG3D: Iteration 2 residual = 3.02484622544359
1760     CG3D: Iteration 3 residual = 2.59074762916092
1761     CG3D: Iteration 4 residual = 1.58353099942688
1762     CG3D: Iteration 5 residual = 1.12359019425032
1763     CG3D: Iteration 6 residual = 0.959319807734460
1764     CG3D: Iteration 7 residual = 0.745022383152598
1765     CG3D: Iteration 8 residual = 0.590193129137327
1766     CG3D: Iteration 9 residual = 0.483197680348949
1767     CG3D: Iteration 10 residual = 0.409845648975015
1768     CG3D: Iteration 11 residual = 0.357404751244279
1769     CG3D: Iteration 12 residual = 0.311618411140101
1770     CG3D: Iteration 13 residual = 0.283434107556853
1771     CG3D: Iteration 14 residual = 0.261460972662641
1772     CG3D: Iteration 15 residual = 0.252685330238188
1773     CG3D: Iteration 16 residual = 0.249399181983931
1774     CG3D: Iteration 17 residual = 0.245505814573001
1775     CG3D: Iteration 18 residual = 0.251229205496009
1776     CG3D: Iteration 19 residual = 0.262969645285391
1777     CG3D: Iteration 20 residual = 0.268106151808577
1778     CG3D: Iteration 21 residual = 0.277608812853841
1779     CG3D: Iteration 22 residual = 0.283809615718292
1780     CG3D: Iteration 23 residual = 0.289231817442738
1781     CG3D: Iteration 24 residual = 0.288536477214610
1782     CG3D: Iteration 25 residual = 0.281526108757315
1783     CG3D: Iteration 26 residual = 0.270931916388599
1784     CG3D: Iteration 27 residual = 0.258495631658000
1785     CG3D: Iteration 28 residual = 0.235595931769098
1786     CG3D: Iteration 29 residual = 0.217411749982997
1787     CG3D: Iteration 30 residual = 0.192736651102605
1788     CG3D: Iteration 31 residual = 0.173911129740183
1789     CG3D: Iteration 32 residual = 0.152115636463403
1790     CG3D: Iteration 33 residual = 0.132517360718885
1791     CG3D: Iteration 34 residual = 0.114473182956152
1792     CG3D: Iteration 35 residual = 9.801618516032717E-002
1793     CG3D: Iteration 36 residual = 8.321155395162173E-002
1794     CG3D: Iteration 37 residual = 6.917912411940148E-002
1795     CG3D: Iteration 38 residual = 5.700773096914864E-002
1796     CG3D: Iteration 39 residual = 4.647022781653169E-002
1797     CG3D iters, err = 40 3.72211549066365E-02
1798     cg2d: Sum(rhs) = 6.52256026967279E-15
1799     CG2D iters, err = 0 1.32287418408640E+01
1800     CG2D iters, err = 69 7.54235519241475E-10
1801     cg3d: Sum(rhs) = -1.31904036304586E-14
1802     CG3D iters, err = 0 1.34169534860781E+01
1803     CG3D: Iteration 0 residual = 13.4169534860781
1804     CG3D: Iteration 1 residual = 10.4022191741972
1805     CG3D: Iteration 2 residual = 7.58894355360691
1806     CG3D: Iteration 3 residual = 4.91235665643220
1807     CG3D: Iteration 4 residual = 3.72660832502837
1808     CG3D: Iteration 5 residual = 2.90592845343406
1809     CG3D: Iteration 6 residual = 2.36259882056056
1810     CG3D: Iteration 7 residual = 1.80906356004922
1811     CG3D: Iteration 8 residual = 1.50055391151294
1812     CG3D: Iteration 9 residual = 1.26558750841256
1813     CG3D: Iteration 10 residual = 1.08509872556539
1814     CG3D: Iteration 11 residual = 0.953721008022071
1815     CG3D: Iteration 12 residual = 0.853539382183718
1816     CG3D: Iteration 13 residual = 0.784558805606391
1817     CG3D: Iteration 14 residual = 0.757153202731346
1818     CG3D: Iteration 15 residual = 0.730423103919953
1819     CG3D: Iteration 16 residual = 0.727479060659588
1820     CG3D: Iteration 17 residual = 0.735591382112225
1821     CG3D: Iteration 18 residual = 0.761040661886754
1822     CG3D: Iteration 19 residual = 0.784708480987683
1823     CG3D: Iteration 20 residual = 0.808882929066173
1824     CG3D: Iteration 21 residual = 0.824903765367325
1825     CG3D: Iteration 22 residual = 0.852591799728570
1826     CG3D: Iteration 23 residual = 0.844200291887313
1827     CG3D: Iteration 24 residual = 0.834080534810949
1828     CG3D: Iteration 25 residual = 0.804970553361497
1829     CG3D: Iteration 26 residual = 0.767166632359086
1830     CG3D: Iteration 27 residual = 0.715365085543850
1831     CG3D: Iteration 28 residual = 0.653113632883993
1832     CG3D: Iteration 29 residual = 0.588244056654357
1833     CG3D: Iteration 30 residual = 0.529930704818184
1834     CG3D: Iteration 31 residual = 0.464766655710416
1835     CG3D: Iteration 32 residual = 0.408111749919034
1836     CG3D: Iteration 33 residual = 0.352208918712155
1837     CG3D: Iteration 34 residual = 0.303607291080694
1838     CG3D: Iteration 35 residual = 0.257907062422095
1839     CG3D: Iteration 36 residual = 0.215446726674193
1840     CG3D: Iteration 37 residual = 0.179306942829450
1841     CG3D: Iteration 38 residual = 0.146224635588802
1842     CG3D: Iteration 39 residual = 0.119128041420263
1843     CG3D iters, err = 40 9.52609753825686E-02
1844     cg2d: Sum(rhs) = -2.49383846906426E-14
1845     CG2D iters, err = 0 1.25028599994867E+01
1846     CG2D iters, err = 71 9.60289122514930E-10
1847     cg3d: Sum(rhs) = -3.11022908816572E-14
1848     CG3D iters, err = 0 5.76655476348451E+00
1849     CG3D: Iteration 0 residual = 5.76655476348451
1850     CG3D: Iteration 1 residual = 4.05783723029025
1851     CG3D: Iteration 2 residual = 2.95652724738124
1852     CG3D: Iteration 3 residual = 1.76778376492767
1853     CG3D: Iteration 4 residual = 1.28685591765152
1854     CG3D: Iteration 5 residual = 0.988731712737960
1855     CG3D: Iteration 6 residual = 0.798542818726960
1856     CG3D: Iteration 7 residual = 0.608934839859612
1857     CG3D: Iteration 8 residual = 0.493756001280534
1858     CG3D: Iteration 9 residual = 0.412780628153002
1859     CG3D: Iteration 10 residual = 0.353314881275546
1860     CG3D: Iteration 11 residual = 0.307103343102965
1861     CG3D: Iteration 12 residual = 0.272654085281613
1862     CG3D: Iteration 13 residual = 0.248695150132755
1863     CG3D: Iteration 14 residual = 0.239308713869198
1864     CG3D: Iteration 15 residual = 0.230704916571557
1865     CG3D: Iteration 16 residual = 0.228102934849275
1866     CG3D: Iteration 17 residual = 0.229743709590961
1867     CG3D: Iteration 18 residual = 0.239738185667687
1868     CG3D: Iteration 19 residual = 0.246473927896982
1869     CG3D: Iteration 20 residual = 0.254893621937793
1870     CG3D: Iteration 21 residual = 0.260320112642177
1871     CG3D: Iteration 22 residual = 0.269086319358711
1872     CG3D: Iteration 23 residual = 0.268409140477164
1873     CG3D: Iteration 24 residual = 0.264181329766488
1874     CG3D: Iteration 25 residual = 0.256657151482941
1875     CG3D: Iteration 26 residual = 0.243168936752668
1876     CG3D: Iteration 27 residual = 0.229171602515770
1877     CG3D: Iteration 28 residual = 0.207986263055118
1878     CG3D: Iteration 29 residual = 0.188364576846928
1879     CG3D: Iteration 30 residual = 0.168863154569039
1880     CG3D: Iteration 31 residual = 0.149214829080147
1881     CG3D: Iteration 32 residual = 0.130797552982358
1882     CG3D: Iteration 33 residual = 0.113219692145088
1883     CG3D: Iteration 34 residual = 9.824162449218289E-002
1884     CG3D: Iteration 35 residual = 8.392177510801763E-002
1885     CG3D: Iteration 36 residual = 7.076076897130222E-002
1886     CG3D: Iteration 37 residual = 5.939692136198319E-002
1887     CG3D: Iteration 38 residual = 4.901061514086585E-002
1888     CG3D: Iteration 39 residual = 4.036357321953495E-002
1889     CG3D iters, err = 40 3.27626829685346E-02
1890     (PID.TID 0000.0001) // Wrote file(s) uVel.*ckptA
1891     (PID.TID 0000.0001) // Wrote file(s) gU.*ckptA
1892     (PID.TID 0000.0001) // Wrote file(s) gUNm1.*ckptA
1893     (PID.TID 0000.0001) // Wrote file(s) vVel.*ckptA
1894     (PID.TID 0000.0001) // Wrote file(s) gV.*ckptA
1895     (PID.TID 0000.0001) // Wrote file(s) gVNm1.*ckptA
1896     (PID.TID 0000.0001) // Wrote file(s) theta.*ckptA
1897     (PID.TID 0000.0001) // Wrote file(s) gT.*ckptA
1898     (PID.TID 0000.0001) // Wrote file(s) gTNm1.*ckptA
1899     (PID.TID 0000.0001) // Wrote file(s) salt.*ckptA
1900     (PID.TID 0000.0001) // Wrote file(s) gS.*ckptA
1901     (PID.TID 0000.0001) // Wrote file(s) gSNm1.*ckptA
1902     (PID.TID 0000.0001) // Wrote file(s) cg2d_x.*ckptA
1903     (PID.TID 0000.0001) // Wrote file(s) wVel.*ckptA
1904     (PID.TID 0000.0001) // Wrote file(s) gW.*ckptA
1905     (PID.TID 0000.0001) // Wrote file(s) gWNm1.*ckptA
1906     (PID.TID 0000.0001) // Model checkpoint written, timestep 10
1907     (PID.TID 0000.0001)
1908     (PID.TID 0000.0001) Seconds in section "ALL":
1909     (PID.TID 0000.0001) User time: 29.8105703964829
1910     (PID.TID 0000.0001) System time: 0.450653012841940
1911     (PID.TID 0000.0001) Wall clock time: 31.1289619207382
1912     (PID.TID 0000.0001) No. starts: 1
1913     (PID.TID 0000.0001) No. stops: 1
1914     (PID.TID 0000.0001) Seconds in section "SPIN-UP":
1915     (PID.TID 0000.0001) User time: 0.973776973783970
1916     (PID.TID 0000.0001) System time: 0.191589992493391
1917     (PID.TID 0000.0001) Wall clock time: 1.50544095039368
1918     (PID.TID 0000.0001) No. starts: 1
1919     (PID.TID 0000.0001) No. stops: 1
1920     (PID.TID 0000.0001) Seconds in section "INITIALISE [SPIN-UP]":
1921     (PID.TID 0000.0001) User time: 0.446488000452518
1922     (PID.TID 0000.0001) System time: 9.829400107264519E-002
1923     (PID.TID 0000.0001) Wall clock time: 0.545653939247131
1924     (PID.TID 0000.0001) No. starts: 1
1925     (PID.TID 0000.0001) No. stops: 1
1926     (PID.TID 0000.0001) Seconds in section "I/O (WRITE) [SPIN-UP]":
1927     (PID.TID 0000.0001) User time: 0.527288973331451
1928     (PID.TID 0000.0001) System time: 9.329599142074585E-002
1929     (PID.TID 0000.0001) Wall clock time: 0.958951950073242
1930     (PID.TID 0000.0001) No. starts: 1
1931     (PID.TID 0000.0001) No. stops: 1
1932     (PID.TID 0000.0001) Seconds in section "MAIN LOOP":
1933     (PID.TID 0000.0001) User time: 26.7992758750916
1934     (PID.TID 0000.0001) System time: 0.110789015889168
1935     (PID.TID 0000.0001) Wall clock time: 26.9223259687424
1936     (PID.TID 0000.0001) No. starts: 1
1937     (PID.TID 0000.0001) No. stops: 1
1938     (PID.TID 0000.0001) Seconds in section "I/O (READ) [MAIN LOOP]":
1939     (PID.TID 0000.0001) User time: 3.415405750274658E-002
1940     (PID.TID 0000.0001) System time: 4.998013377189636E-003
1941     (PID.TID 0000.0001) Wall clock time: 3.745496273040771E-002
1942     (PID.TID 0000.0001) No. starts: 10
1943     (PID.TID 0000.0001) No. stops: 10
1944     (PID.TID 0000.0001) Seconds in section "DYNAMICS [MAIN LOOP]":
1945     (PID.TID 0000.0001) User time: 6.93055760860443
1946     (PID.TID 0000.0001) System time: 1.582700014114380E-002
1947     (PID.TID 0000.0001) Wall clock time: 6.95142197608948
1948     (PID.TID 0000.0001) No. starts: 10
1949     (PID.TID 0000.0001) No. stops: 10
1950     (PID.TID 0000.0001) Seconds in section "CALC_GW [MAIN LOOP]":
1951     (PID.TID 0000.0001) User time: 0.719712257385254
1952     (PID.TID 0000.0001) System time: 4.997998476028442E-003
1953     (PID.TID 0000.0001) Wall clock time: 0.725131273269653
1954     (PID.TID 0000.0001) No. starts: 10
1955     (PID.TID 0000.0001) No. stops: 10
1956     (PID.TID 0000.0001) Seconds in section "I/O (WRITE) [MAIN LOOP]":
1957     (PID.TID 0000.0001) User time: 2.582299709320068E-002
1958     (PID.TID 0000.0001) System time: 9.162992238998413E-003
1959     (PID.TID 0000.0001) Wall clock time: 3.587400913238525E-002
1960     (PID.TID 0000.0001) No. starts: 30
1961     (PID.TID 0000.0001) No. stops: 30
1962     (PID.TID 0000.0001) Seconds in section "SOLVE_FOR_PRESSURE [MAIN LOOP]":
1963     (PID.TID 0000.0001) User time: 18.9674116373062
1964     (PID.TID 0000.0001) System time: 7.413703203201294E-002
1965     (PID.TID 0000.0001) Wall clock time: 19.0474438667297
1966     (PID.TID 0000.0001) No. starts: 10
1967     (PID.TID 0000.0001) No. stops: 10
1968     (PID.TID 0000.0001) Seconds in section "BLOCKING_EXCHANGES [MAIN LOOP]":
1969     (PID.TID 0000.0001) User time: 0.119950294494629
1970     (PID.TID 0000.0001) System time: 0.000000000000000E+000
1971     (PID.TID 0000.0001) Wall clock time: 0.123332977294922
1972     (PID.TID 0000.0001) No. starts: 10
1973     (PID.TID 0000.0001) No. stops: 10
1974     (PID.TID 0000.0001) Seconds in section "SPIN-DOWN":
1975     (PID.TID 0000.0001) User time: 2.03751754760742
1976     (PID.TID 0000.0001) System time: 0.148274004459381
1977     (PID.TID 0000.0001) Wall clock time: 2.70119500160217
1978     (PID.TID 0000.0001) No. starts: 1
1979     (PID.TID 0000.0001) No. stops: 1
1980     (PID.TID 0000.0001) Seconds in section "I/O (WRITE) [SPIN-DOWN]":
1981     (PID.TID 0000.0001) User time: 1.27032470703125
1982     (PID.TID 0000.0001) System time: 0.148274004459381
1983     (PID.TID 0000.0001) Wall clock time: 1.93406796455383
1984     (PID.TID 0000.0001) No. starts: 2
1985     (PID.TID 0000.0001) No. stops: 2
1986     (PID.TID 0000.0001) Seconds in section "DYNAMICS [SPIN-DOWN]":
1987     (PID.TID 0000.0001) User time: 0.693889617919922
1988     (PID.TID 0000.0001) System time: 0.000000000000000E+000
1989     (PID.TID 0000.0001) Wall clock time: 0.693881034851074
1990     (PID.TID 0000.0001) No. starts: 1
1991     (PID.TID 0000.0001) No. stops: 1
1992     (PID.TID 0000.0001) Seconds in section "CALC_GW [SPIN-DOWN]":
1993     (PID.TID 0000.0001) User time: 7.330322265625000E-002
1994     (PID.TID 0000.0001) System time: 0.000000000000000E+000
1995     (PID.TID 0000.0001) Wall clock time: 7.324600219726563E-002
1996     (PID.TID 0000.0001) No. starts: 1
1997     (PID.TID 0000.0001) No. stops: 1
1998     (PID.TID 0000.0001) // ======================================================
1999     (PID.TID 0000.0001) // Tile <-> Tile communication statistics
2000     (PID.TID 0000.0001) // ======================================================
2001     (PID.TID 0000.0001) // o Tile number: 000001
2002     (PID.TID 0000.0001) // No. X exchanges = 1851
2003     (PID.TID 0000.0001) // Max. X spins = 1
2004     (PID.TID 0000.0001) // Min. X spins = 1
2005     (PID.TID 0000.0001) // Total. X spins = 1851
2006     (PID.TID 0000.0001) // Avg. X spins = 1.00E+00
2007     (PID.TID 0000.0001) // No. Y exchanges = 1851
2008     (PID.TID 0000.0001) // Max. Y spins = 1
2009     (PID.TID 0000.0001) // Min. Y spins = 1
2010     (PID.TID 0000.0001) // Total. Y spins = 1851
2011     (PID.TID 0000.0001) // Avg. Y spins = 1.00E+00
2012     (PID.TID 0000.0001) // o Thread number: 000001
2013     (PID.TID 0000.0001) // No. barriers = 0
2014     (PID.TID 0000.0001) // Max. barrier spins = 0
2015     (PID.TID 0000.0001) // Min. barrier spins = 1000000000
2016     (PID.TID 0000.0001) // Total barrier spins = 0
2017     (PID.TID 0000.0001) // Avg. barrier spins = 0.00E+00
2018     NORMAL END

  ViewVC Help
Powered by ViewVC 1.1.22