ViewVC logotype

Contents of /MITgcm/verification/cpl_aim+ocn/results/ocnSTDOUT.0000

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph

Revision 1.9 - (show annotations) (download)
Fri May 4 21:48:47 2007 UTC (14 years, 6 months ago) by jmc
Branch: MAIN
CVS Tags: checkpoint59e, checkpoint59d, checkpoint59g, checkpoint59f, checkpoint59c, checkpoint59b
Changes since 1.8: +258 -252 lines
updated after changing thsice_calc_thickn.F & thsice_extend.F

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint59a
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: a54-1727-075
11 (PID.TID 0000.0001) // Build date: Fri May 4 17:37:09 EDT 2007
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx - No. threads per process in X
19 (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20 (PID.TID 0000.0001) > &EEPARMS
21 (PID.TID 0000.0001) > useCoupler=.TRUE.,
22 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
23 (PID.TID 0000.0001) > nTx=1,
24 (PID.TID 0000.0001) > nTy=1,
25 (PID.TID 0000.0001) > &
26 (PID.TID 0000.0001) ># Note: Some systems use & as the
27 (PID.TID 0000.0001) ># namelist terminator. Other systems
28 (PID.TID 0000.0001) ># use a / character (as shown here).
29 (PID.TID 0000.0001)
30 (PID.TID 0000.0001) // =======================================================
31 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
32 (PID.TID 0000.0001) // ( and "eedata" )
33 (PID.TID 0000.0001) // =======================================================
34 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
35 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
36 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
37 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
38 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
39 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
40 (PID.TID 0000.0001) OLx = 2 ; /* Tile overlap distance in X */
41 (PID.TID 0000.0001) OLy = 2 ; /* Tile overlap distance in Y */
42 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
43 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
44 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
45 (PID.TID 0000.0001) nX = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
46 (PID.TID 0000.0001) nY = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
47 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
48 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
49 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
50 (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
51 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
52 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
53 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
54 (PID.TID 0000.0001) useCoupler= T ; /* Flag used to control communications with */
55 (PID.TID 0000.0001) /* other model components, through a coupler */
56 (PID.TID 0000.0001)
57 (PID.TID 0000.0001) ======= Starting MPI parallel Run =========
58 (PID.TID 0000.0001) My Processor Name = a54-1727-075.acesgrid.org
59 (PID.TID 0000.0001) Located at ( 0, 0) on processor grid (0: 0,0: 0)
60 (PID.TID 0000.0001) Origin at ( 1, 1) on global grid (1: 192,1: 32)
61 (PID.TID 0000.0001) North neighbor = processor 0000
62 (PID.TID 0000.0001) South neighbor = processor 0000
63 (PID.TID 0000.0001) East neighbor = processor 0000
64 (PID.TID 0000.0001) West neighbor = processor 0000
65 (PID.TID 0000.0001) // ======================================================
66 (PID.TID 0000.0001) // Mapping of tiles to threads
67 (PID.TID 0000.0001) // ======================================================
68 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
69 (PID.TID 0000.0001)
70 (PID.TID 0000.0001) // ======================================================
71 (PID.TID 0000.0001) // Tile <-> Tile connectvity table
72 (PID.TID 0000.0001) // ======================================================
73 (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000000)
74 (PID.TID 0000.0001) // WEST: Tile = 000006, Process = 000000, Comm = put
75 (PID.TID 0000.0001) // bi = 000006, bj = 000001
76 (PID.TID 0000.0001) // EAST: Tile = 000002, Process = 000000, Comm = put
77 (PID.TID 0000.0001) // bi = 000002, bj = 000001
78 (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000000, Comm = put
79 (PID.TID 0000.0001) // bi = 000001, bj = 000001
80 (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000000, Comm = put
81 (PID.TID 0000.0001) // bi = 000001, bj = 000001
82 (PID.TID 0000.0001) // Tile number: 000002 (process no. = 000000)
83 (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000000, Comm = put
84 (PID.TID 0000.0001) // bi = 000001, bj = 000001
85 (PID.TID 0000.0001) // EAST: Tile = 000003, Process = 000000, Comm = put
86 (PID.TID 0000.0001) // bi = 000003, bj = 000001
87 (PID.TID 0000.0001) // SOUTH: Tile = 000002, Process = 000000, Comm = put
88 (PID.TID 0000.0001) // bi = 000002, bj = 000001
89 (PID.TID 0000.0001) // NORTH: Tile = 000002, Process = 000000, Comm = put
90 (PID.TID 0000.0001) // bi = 000002, bj = 000001
91 (PID.TID 0000.0001) // Tile number: 000003 (process no. = 000000)
92 (PID.TID 0000.0001) // WEST: Tile = 000002, Process = 000000, Comm = put
93 (PID.TID 0000.0001) // bi = 000002, bj = 000001
94 (PID.TID 0000.0001) // EAST: Tile = 000004, Process = 000000, Comm = put
95 (PID.TID 0000.0001) // bi = 000004, bj = 000001
96 (PID.TID 0000.0001) // SOUTH: Tile = 000003, Process = 000000, Comm = put
97 (PID.TID 0000.0001) // bi = 000003, bj = 000001
98 (PID.TID 0000.0001) // NORTH: Tile = 000003, Process = 000000, Comm = put
99 (PID.TID 0000.0001) // bi = 000003, bj = 000001
100 (PID.TID 0000.0001) // Tile number: 000004 (process no. = 000000)
101 (PID.TID 0000.0001) // WEST: Tile = 000003, Process = 000000, Comm = put
102 (PID.TID 0000.0001) // bi = 000003, bj = 000001
103 (PID.TID 0000.0001) // EAST: Tile = 000005, Process = 000000, Comm = put
104 (PID.TID 0000.0001) // bi = 000005, bj = 000001
105 (PID.TID 0000.0001) // SOUTH: Tile = 000004, Process = 000000, Comm = put
106 (PID.TID 0000.0001) // bi = 000004, bj = 000001
107 (PID.TID 0000.0001) // NORTH: Tile = 000004, Process = 000000, Comm = put
108 (PID.TID 0000.0001) // bi = 000004, bj = 000001
109 (PID.TID 0000.0001) // Tile number: 000005 (process no. = 000000)
110 (PID.TID 0000.0001) // WEST: Tile = 000004, Process = 000000, Comm = put
111 (PID.TID 0000.0001) // bi = 000004, bj = 000001
112 (PID.TID 0000.0001) // EAST: Tile = 000006, Process = 000000, Comm = put
113 (PID.TID 0000.0001) // bi = 000006, bj = 000001
114 (PID.TID 0000.0001) // SOUTH: Tile = 000005, Process = 000000, Comm = put
115 (PID.TID 0000.0001) // bi = 000005, bj = 000001
116 (PID.TID 0000.0001) // NORTH: Tile = 000005, Process = 000000, Comm = put
117 (PID.TID 0000.0001) // bi = 000005, bj = 000001
118 (PID.TID 0000.0001) // Tile number: 000006 (process no. = 000000)
119 (PID.TID 0000.0001) // WEST: Tile = 000005, Process = 000000, Comm = put
120 (PID.TID 0000.0001) // bi = 000005, bj = 000001
121 (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000000, Comm = put
122 (PID.TID 0000.0001) // bi = 000001, bj = 000001
123 (PID.TID 0000.0001) // SOUTH: Tile = 000006, Process = 000000, Comm = put
124 (PID.TID 0000.0001) // bi = 000006, bj = 000001
125 (PID.TID 0000.0001) // NORTH: Tile = 000006, Process = 000000, Comm = put
126 (PID.TID 0000.0001) // bi = 000006, bj = 000001
127 (PID.TID 0000.0001)
128 (PID.TID 0000.0001) ===== W2 TILE TOPLOGY =====
129 (PID.TID 0000.0001) TILE: 1
130 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
131 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
132 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
133 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
134 (PID.TID 0000.0001) TILE: 2
135 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
136 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
137 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
138 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
139 (PID.TID 0000.0001) TILE: 3
140 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
141 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
142 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
143 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
144 (PID.TID 0000.0001) TILE: 4
145 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
146 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
147 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
148 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
149 (PID.TID 0000.0001) TILE: 5
150 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
151 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
152 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
153 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
154 (PID.TID 0000.0001) TILE: 6
155 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
156 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
157 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
158 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
159 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 34: -1, j= 31: 32
160 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 3(proc = 1)
161 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= -1: 34, j= 1: 2
162 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 6(proc = 1)
163 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 31: 32, j= -1: 34
164 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 2(proc = 1)
165 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 1: 2, j= 34: -1
166 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 5(proc = 1)
167 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= -1: 34, j= 31: 32
168 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 3(proc = 1)
169 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 34: -1, j= 1: 2
170 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 6(proc = 1)
171 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 31: 32, j= 34: -1
172 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 4(proc = 1)
173 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 1: 2, j= -1: 34
174 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 1(proc = 1)
175 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 34: -1, j= 31: 32
176 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 5(proc = 1)
177 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= -1: 34, j= 1: 2
178 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 2(proc = 1)
179 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 31: 32, j= -1: 34
180 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 4(proc = 1)
181 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 1: 2, j= 34: -1
182 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 1(proc = 1)
183 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= -1: 34, j= 31: 32
184 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 5(proc = 1)
185 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 34: -1, j= 1: 2
186 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 2(proc = 1)
187 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 31: 32, j= 34: -1
188 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 6(proc = 1)
189 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 1: 2, j= -1: 34
190 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 3(proc = 1)
191 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 34: -1, j= 31: 32
192 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 1(proc = 1)
193 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= -1: 34, j= 1: 2
194 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 4(proc = 1)
195 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 31: 32, j= -1: 34
196 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 6(proc = 1)
197 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 1: 2, j= 34: -1
198 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 3(proc = 1)
199 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= -1: 34, j= 31: 32
200 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 1(proc = 1)
201 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 34: -1, j= 1: 2
202 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 4(proc = 1)
203 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 31: 32, j= 34: -1
204 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 2(proc = 1)
205 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 1: 2, j= -1: 34
206 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 5(proc = 1)
207 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 3(proc = 1)
208 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 6(proc = 1)
209 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 2(proc = 1)
210 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 5(proc = 1)
211 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 3(proc = 1)
212 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 6(proc = 1)
213 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 4(proc = 1)
214 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 1(proc = 1)
215 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 5(proc = 1)
216 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 2(proc = 1)
217 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 4(proc = 1)
218 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 1(proc = 1)
219 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 5(proc = 1)
220 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 2(proc = 1)
221 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 6(proc = 1)
222 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 3(proc = 1)
223 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 1(proc = 1)
224 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 4(proc = 1)
225 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 6(proc = 1)
226 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 3(proc = 1)
227 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 1(proc = 1)
228 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 4(proc = 1)
229 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 2(proc = 1)
230 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 5(proc = 1)
231 (PID.TID 0000.0001) // =======================================================
232 (PID.TID 0000.0001) // Model parameter file "data"
233 (PID.TID 0000.0001) // =======================================================
234 (PID.TID 0000.0001) ># ====================
235 (PID.TID 0000.0001) ># | Model parameters |
236 (PID.TID 0000.0001) ># ====================
237 (PID.TID 0000.0001) >#
238 (PID.TID 0000.0001) ># Continuous equation parameters
239 (PID.TID 0000.0001) > &PARM01
240 (PID.TID 0000.0001) > tRef=15*20.,
241 (PID.TID 0000.0001) > sRef=15*35.,
242 (PID.TID 0000.0001) > viscAh =3.E5,
243 (PID.TID 0000.0001) > viscAr =1.E-3,
244 (PID.TID 0000.0001) > diffKhT=0.,
245 (PID.TID 0000.0001) > diffK4T=0.,
246 (PID.TID 0000.0001) > diffKrT=3.E-5,
247 (PID.TID 0000.0001) > diffKhS=0.,
248 (PID.TID 0000.0001) > diffK4S=0.,
249 (PID.TID 0000.0001) > diffKrS=3.E-5,
250 (PID.TID 0000.0001) > gravity=9.81,
251 (PID.TID 0000.0001) > rhoConst=1030.,
252 (PID.TID 0000.0001) > rhoConstFresh=1000.,
253 (PID.TID 0000.0001) > eosType='JMD95Z',
254 (PID.TID 0000.0001) >#allowFreezing=.TRUE.,
255 (PID.TID 0000.0001) > ivdc_kappa=10.,
256 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
257 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
258 (PID.TID 0000.0001) > exactConserv=.TRUE.,
259 (PID.TID 0000.0001) > select_rStar=2,
260 (PID.TID 0000.0001) > nonlinFreeSurf=4,
261 (PID.TID 0000.0001) > hFacInf=0.2,
262 (PID.TID 0000.0001) > hFacSup=2.0,
263 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
264 (PID.TID 0000.0001) > temp_EvPrRn=0.,
265 (PID.TID 0000.0001) > hFacMin=.1,
266 (PID.TID 0000.0001) > hFacMinDr=20.,
267 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
268 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
269 (PID.TID 0000.0001) > readBinaryPrec=64,
270 (PID.TID 0000.0001) > writeBinaryPrec=64,
271 (PID.TID 0000.0001) >#debugLevel=0,
272 (PID.TID 0000.0001) > &
273 (PID.TID 0000.0001) >
274 (PID.TID 0000.0001) ># Elliptic solver parameters
275 (PID.TID 0000.0001) > &PARM02
276 (PID.TID 0000.0001) > cg2dMaxIters=200,
277 (PID.TID 0000.0001) > cg2dTargetResidual=1.E-9,
278 (PID.TID 0000.0001) >#cg2dTargetResWunit=1.E-14,
279 (PID.TID 0000.0001) > &
280 (PID.TID 0000.0001) >
281 (PID.TID 0000.0001) ># Time stepping parameters
282 (PID.TID 0000.0001) > &PARM03
283 (PID.TID 0000.0001) > nIter0=0,
284 (PID.TID 0000.0001) > nTimeSteps=5,
285 (PID.TID 0000.0001) > deltaTmom =3600.,
286 (PID.TID 0000.0001) > deltaTtracer=3600.,
287 (PID.TID 0000.0001) > deltaTClock =3600.,
288 (PID.TID 0000.0001) > abEps = 0.1,
289 (PID.TID 0000.0001) > pChkptFreq =2592000.,
290 (PID.TID 0000.0001) > taveFreq =2592000.,
291 (PID.TID 0000.0001) > dumpFreq =864000.,
292 (PID.TID 0000.0001) > monitorFreq =86400.,
293 (PID.TID 0000.0001) > monitorFreq =1.,
294 (PID.TID 0000.0001) >#forcing_In_AB=.FALSE.,
295 (PID.TID 0000.0001) > tracForcingOutAB=1,
296 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
297 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
298 (PID.TID 0000.0001) > externForcingCycle=31104000.,
299 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
300 (PID.TID 0000.0001) >#tauThetaClimRelax= 5184000.,
301 (PID.TID 0000.0001) ># restoring timescale for salinity: 2yrs, 20 yrs
302 (PID.TID 0000.0001) >#tauSaltClimRelax = 62208000.,
303 (PID.TID 0000.0001) > tauSaltClimRelax = 622080000.,
304 (PID.TID 0000.0001) > &
305 (PID.TID 0000.0001) >
306 (PID.TID 0000.0001) ># Gridding parameters
307 (PID.TID 0000.0001) > &PARM04
308 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
309 (PID.TID 0000.0001) > horizGridFile='grid_cs32',
310 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
311 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
312 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
313 (PID.TID 0000.0001) > &
314 (PID.TID 0000.0001) >
315 (PID.TID 0000.0001) ># Input datasets
316 (PID.TID 0000.0001) > &PARM05
317 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
318 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
319 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
320 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
321 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
322 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
323 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
324 (PID.TID 0000.0001) > surfQFile ='shiQnet_cs32.bin',
325 (PID.TID 0000.0001) > EmPmRFile ='shiEmPR_cs32.bin',
326 (PID.TID 0000.0001) > &
327 (PID.TID 0000.0001)
328 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM01
329 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM01 : OK
330 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM02
331 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM02 : OK
332 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM03
333 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM03 : OK
334 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM04
335 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM04 : OK
336 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM05
337 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM05 : OK
338 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
339 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
340 (PID.TID 0000.0001) // =======================================================
341 (PID.TID 0000.0001) // Parameter file "data.pkg"
342 (PID.TID 0000.0001) // =======================================================
343 (PID.TID 0000.0001) ># Packages
344 (PID.TID 0000.0001) > &PACKAGES
345 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
346 (PID.TID 0000.0001) >#useMNC=.TRUE.,
347 (PID.TID 0000.0001) > &
348 (PID.TID 0000.0001)
349 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
350 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
351 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
352 (PID.TID 0000.0001) // =======================================================
353 (PID.TID 0000.0001) // Parameter file "data.gmredi"
354 (PID.TID 0000.0001) // =======================================================
355 (PID.TID 0000.0001) ># GM+Redi package parameters:
356 (PID.TID 0000.0001) >
357 (PID.TID 0000.0001) >#-from MOM :
358 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
359 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
360 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
361 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
362 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
363 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
364 (PID.TID 0000.0001) >
365 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
366 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
367 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
368 (PID.TID 0000.0001) >
369 (PID.TID 0000.0001) > &GM_PARM01
370 (PID.TID 0000.0001) > GM_background_K = 800.,
371 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
372 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
373 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
374 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
375 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
376 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
377 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
378 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
379 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
380 (PID.TID 0000.0001) > &
381 (PID.TID 0000.0001) >
382 (PID.TID 0000.0001) >
383 (PID.TID 0000.0001)
384 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
385 (PID.TID 0000.0001) CPL_READPARMS: opening data.cpl
386 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.cpl
387 (PID.TID 0000.0001) // =======================================================
388 (PID.TID 0000.0001) // Parameter file "data.cpl"
389 (PID.TID 0000.0001) // =======================================================
390 (PID.TID 0000.0001) ># Coupling package parameters, OCN component:
391 (PID.TID 0000.0001) ># cpl_earlyExpImpCall :: call coupler early in the time stepping call sequence
392 (PID.TID 0000.0001) ># useImportHFlx :: True => use the Imported HeatFlux from couler
393 (PID.TID 0000.0001) ># useImportFW :: True => use the Imported Fresh Water flux fr cpl
394 (PID.TID 0000.0001) ># useImportTau :: True => use the Imported Wind-Stress from couler
395 (PID.TID 0000.0001) ># useImportSLP :: True => use the Imported Sea-level Atmos. Pressure
396 (PID.TID 0000.0001) ># useImportSIce :: True => use the Imported Sea-Ice loading
397 (PID.TID 0000.0001) ># cpl_taveFreq :: Frequency^-1 for time-Aver. output (s)
398 (PID.TID 0000.0001) > &CPL_OCN_PARAM
399 (PID.TID 0000.0001) ># cpl_earlyExpImpCall=.FALSE.,
400 (PID.TID 0000.0001) ># useImportHFlx=.FALSE.,
401 (PID.TID 0000.0001) ># useImportFW =.FALSE.,
402 (PID.TID 0000.0001) ># useImportTau =.FALSE.,
403 (PID.TID 0000.0001) > useImportSLP =.FALSE.,
404 (PID.TID 0000.0001) ># useImportSIce=.FALSE.,
405 (PID.TID 0000.0001) ># cpl_taveFreq=2592000.,
406 (PID.TID 0000.0001) > cpl_taveFreq=18000.,
407 (PID.TID 0000.0001) > &
408 (PID.TID 0000.0001) >
409 (PID.TID 0000.0001)
410 (PID.TID 0000.0001) CPL_READPARMS: finished reading data.cpl
411 (PID.TID 0000.0001)
412 (PID.TID 0000.0001) // ===================================
413 (PID.TID 0000.0001) // Coupling package parameters :
414 (PID.TID 0000.0001) // ===================================
415 (PID.TID 0000.0001) cpl_earlyExpImpCall= /* call coupler early in the time-stepping */
416 (PID.TID 0000.0001) T
417 (PID.TID 0000.0001) ;
418 (PID.TID 0000.0001) useImportHFlx= /* use Imported Heat-Flx fr Coupler on/off flag */
419 (PID.TID 0000.0001) T
420 (PID.TID 0000.0001) ;
421 (PID.TID 0000.0001) useImportFW = /* use Imported Fresh-Water fr Cpl. on/off flag */
422 (PID.TID 0000.0001) T
423 (PID.TID 0000.0001) ;
424 (PID.TID 0000.0001) useImportTau = /* use Imported Wind-Stress fr Cpl. on/off flag */
425 (PID.TID 0000.0001) T
426 (PID.TID 0000.0001) ;
427 (PID.TID 0000.0001) useImportSLP = /* use Imported Sea-level Atm Press on/off flag */
428 (PID.TID 0000.0001) F
429 (PID.TID 0000.0001) ;
430 (PID.TID 0000.0001) useImportSIce= /* use Imported Sea-Ice loading on/off flag */
431 (PID.TID 0000.0001) T
432 (PID.TID 0000.0001) ;
433 (PID.TID 0000.0001) cpl_taveFreq = /* Frequency^-1 for time-Aver. output (s) */
434 (PID.TID 0000.0001) 1.800000000000000E+04
435 (PID.TID 0000.0001) ;
436 (PID.TID 0000.0001) cpl_timeave_mnc = /* write TimeAv to MNC file on/off flag */
437 (PID.TID 0000.0001) F
438 (PID.TID 0000.0001) ;
439 (PID.TID 0000.0001) cpl_timeave_mdsio = /* write TimeAv to MDSIO file on/off flag */
440 (PID.TID 0000.0001) T
441 (PID.TID 0000.0001) ;
442 (PID.TID 0000.0001) SET_PARMS: done
443 (PID.TID 0000.0001) Enter INI_VERTICAL_GRID: setInterFDr= T ; setCenterDr= F
444 (PID.TID 0000.0001) tile: 1 ; Read from file grid_cs32.face001.bin
445 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
446 (PID.TID 0000.0001) tile: 2 ; Read from file grid_cs32.face002.bin
447 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
448 (PID.TID 0000.0001) tile: 3 ; Read from file grid_cs32.face003.bin
449 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
450 (PID.TID 0000.0001) tile: 4 ; Read from file grid_cs32.face004.bin
451 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
452 (PID.TID 0000.0001) tile: 5 ; Read from file grid_cs32.face005.bin
453 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
454 (PID.TID 0000.0001) tile: 6 ; Read from file grid_cs32.face006.bin
455 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
456 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
457 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
458 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
459 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
460 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
461 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
462 (PID.TID 0000.0001) %MON XG_mean = 1.8796250616675E+00
463 (PID.TID 0000.0001) %MON XG_sd = 1.0410625309932E+02
464 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
465 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
466 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
467 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
468 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
469 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
470 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
471 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
472 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
473 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
474 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
475 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
476 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
477 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
478 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
479 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
480 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
481 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
482 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
483 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
484 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
485 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
486 (PID.TID 0000.0001) %MON YG_mean = -1.2094344438470E-15
487 (PID.TID 0000.0001) %MON YG_sd = 3.9086186579984E+01
488 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
489 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
490 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
491 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
492 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
493 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
494 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
495 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
496 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
497 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
498 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
499 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
500 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
501 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
502 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
503 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
504 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
505 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
506 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
507 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
508 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
509 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
510 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
511 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
512 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
513 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
514 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
515 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
516 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
517 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
518 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
519 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
520 (PID.TID 0000.0001) %MON AngleCS_max = 9.9999994756719E-01
521 (PID.TID 0000.0001) %MON AngleCS_min = -9.9968286884824E-01
522 (PID.TID 0000.0001) %MON AngleCS_mean = 3.3078850405987E-01
523 (PID.TID 0000.0001) %MON AngleCS_sd = 6.2496317138039E-01
524 (PID.TID 0000.0001) %MON AngleSN_max = 9.9968286884824E-01
525 (PID.TID 0000.0001) %MON AngleSN_min = -9.9999994756719E-01
526 (PID.TID 0000.0001) %MON AngleSN_mean = -3.3078850405987E-01
527 (PID.TID 0000.0001) %MON AngleSN_sd = 6.2496317138039E-01
528 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: bathy_Hmin50.bin
529 (PID.TID 0000.0001) // =======================================================
530 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc) at iteration 1
531 (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
532 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
533 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
534 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
535 (PID.TID 0000.0001) // 0.0: .
536 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
537 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
538 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
539 (PID.TID 0000.0001) // =======================================================
540 (PID.TID 0000.0001) K = 1
541 (PID.TID 0000.0001) // I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
542 (PID.TID 0000.0001) // |--J--|101234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
543 (PID.TID 0000.0001) // 34 -ba-abcehjnldcclz+........spps...................................vkqn+xnbbcbba--aabfu+..............hcbaaaaaaaaaccdccbaaabbddddccdffffghfeeeeedeffefilhfcaaaacgceei.......zomggfcaeccaecbbccddefilihecbaacbaajfega-aesfe
544 (PID.TID 0000.0001) // 33 abbbccceiomkfdbbc+.......+s......................................xsrxzz+cddb-----adu+...............hcbaa--aa--accddba--bbbddddccdfffhhgfeeddcceeddfgikhfffdfgccffw........zohhgebbaebbaaaaaccdfhlhfefdcccaabjefbaaafoos
545 (PID.TID 0000.0001) // 32 bddefhhkqqlgfaakqz..v.+..+.....................................++..u+...fdba----adu+................kdcaaa-aaa-accdcb---bbbcdddddefffggfeeedccccbbdcdfgghhiihcbeiw.........+ynjgebaaebaaaa-aacccfikkhecccbbbaaabaadfklnq
546 (PID.TID 0000.0001) // 31 bcffijnpnqneaaat..umrr+s.z.....................................+++++.ztsfeb--dfdfu+................+lkdca--aa--abcccb---bbbbddddeffflhfeeeecbbbb-abbacbcdceffbbfw+..........++ujfbaafbaaa----aacffiljgfffcca--adfikkiihh
547 (PID.TID 0000.0001) // 30 adgillkkkifcadcx.ymmqzqikvnnps.................................+++++wmegifcacdlqx+++...............mligea---a---abbbb---abaaddddeedkmeddefdbbbaa---b--aaaaabaabm..............+viba-iba-------acdefinmlgiieb-chnnnmlmlgf
548 (PID.TID 0000.0001) // 29 cfiljigfjd--efdozy...+ximpnnuz..................................+++yqddhjhcbbchz+......++.........+mmhffc---c----aaba------acdddcbcineddgdbaaa--d--a------aa-bfz...............+qe--qe---aa---aedeegknmlgiigcdfhpokkimlf
549 (PID.TID 0000.0001) // 28 bgkhfcccea-bdei........t........................................++zwgfcfnhccbbhwwy.....+++........+njfeed---d-----aa-------abddcabcnfddegcaaa---f------------dk+................+ja-+ja------bffdddehfd--bedaacfhpnligii
550 (PID.TID 0000.0001) // 27 cghfbaaaa-achmy..........................+++....................++vnbbbcpkeeecflmqxy....++........+lhfeecc--cc------------aaadcbabcfhddccba-----d-----------irw.................++e-++e-----mhmijddda--------ahhfiokhede
551 (PID.TID 0000.0001) // 26 dhfca-----bfiv...........................++sy...................+tq-fdbbnqiheddefhiksz++++........zkhfdccb--cb------------aabdcaaaacfddbca------fa-abb-----vvv...................+wa.+wa---mlmkijhc----------cjjffiheb-a
552 (PID.TID 0000.0001) // 25 chfa------ch+..................w...........njo+................+x-----bcqqojfefiiiijmy.++.........zkhfdbaa--aa-------daa---acccaaaacccca--------udaabbb----tei...................++q.++qdeqnghiljcaaaaidaa----beedeeca--
553 (PID.TID 0000.0001) // 24 eifa--acbcei...................w...........likn+.....++.....++znpa----bbnlmnjhinlksssw............qhfeca------------addc--aeffaaaaaaccb-a----a--+udbbaba---ven....................++..++xywnfgllcbbabegkecba----ddddcaac
554 (PID.TID 0000.0001) // 23 fida-aabchjk...................zz...z.....nhhijz....tqq.....+ujgzgd---abegklkkknols..xuu..........zgfdba------------bcd---affaaadffabbb-----aa-b.+ufb-----l.gx...........s.........+...++zzkfilfccccoz..ulkcd---bccnfddd
555 (PID.TID 0000.0001) // 22 fhfaa---bfgi....................zz..zz..rnjffggm...nlmn+....+sffzya--aabaffdfhimrmp...yuu.++.......zudba------------adc---dda-adffe-aa--------aa..+ufc-baaqvhh..........dcfeeh..........++zggqvifefhz......zobbaccfwuffe
556 (PID.TID 0000.0001) // 21 bcgca----abe.....................yss.ysstlgeeeeoz..ijklt+....lfjzzf---adaadcehllotq....yy+++zzs.....+zcba---a-------cdd--aaa----df------------aa...+upjdcy.vohq.......+idcdfeeefwz..wz....+hhn.vklox.........gdccfjwrigf
557 (PID.TID 0000.0001) // 20 bbcgfcaa-aae+...........................lcgfdddhq.+hiilnz++.+oquxyz--adgaabcfmtooyxz......+yuiiy....++gb------------ddcca-a-----acbaa------bbaaa......ywxy.lulo.lv...kcdgddffefffilyfilyx+fffk.+xyyy.........mgeimvskjkl
558 (PID.TID 0000.0001) // 19 feccdghfeegcbt..........................aafifccgnrzgghjry.+++sr+lq.--edftkblwnnsp.vv......skhggt...+++t-------------bdaf---------edd-------adlaa.........vnhzy.tllqiedccdhggfggffiigfiiggfcbdgy..yz..........xigqophijkk
559 (PID.TID 0000.0001) // 18 wifedfkhfegbbcivlqfoz..............j...jaacfihggokeeffgt..++++..hhlfdedd.qcz+.zwxtsttz..ysrkhot++++++zig------------b--f---------egqqqaa----frb-.......+kkrhw.vqmlnieddcdehgggffgigegigedbaaceiy.............zilrddefikk
560 (PID.TID 0000.0001) // 17 +wfeefikhgcbbccaaacgn.............ic..icaaccfihfoedddeedy..++...nnqwgfee.z++..+zsjjllllljllpjos+++.+zhhi---------e-----ea--------foqqoqqo--hlwge.......+nk+..xiioonhfefddegihhghigfdigfdbaaabdgx..............nheddefikl
561 (PID.TID 0000.0001) // 16 ..wiheddeccdfhfbabdfl............jdb.jdbaddddgifkccccdccd+.++..++ynvz.tku....++zyslllllkhggkmpy++...ihhi---------ea---feb-----a-acnoohfghknvmwnu........qhu..hhhkojgffgeefghihhiieedieedbaaabcdy..............ygddeghilj
562 (PID.TID 0000.0001) // 15 ....ylea--acfihebcbbes..........sfcbsfcbbngfffigcaaabdbcac+.+++++zgmpx..m....++..zslwz.yhhhhnz+++...rhgc--------ab----ige----acaaalllkddfiy..ysw........thk.xgghiligfghfefhhhhiiheedheedcdbbabdmz.............zfdeghikki
563 (PID.TID 0000.0001) // 14 ......c---acgkhdcc--di..........ofddofddchohffikaaaaabaaa-aw+.+ysnggox++rv..........yzzzzrjil+++....qhgd---------a-----i---cccdeabkklldinqssy..x.........+y.uhghikihgfghefgihhhgeeeeeeeeeddbaadhw.............nedeghjjhf
564 (PID.TID 0000.0001) // 13 .....+b----cfkhec---afz.........nhfdnhfdffholghkaaaaaba-a---flkkuswyy+++r...........zzzzz++ry++......yd------------------aeecdeidfkkqnqlmqquukqq............iihiijjhfefgefhjihiffgggfgggffecaabelx...........zjecehijhfe
565 (PID.TID 0000.0001) // 12 .....ec----chjhec---ag..........skiqskiqddeiiiifaaabae--a---dd--iu+++.++++..........+z+++++.+++....++.s----------------a-ceccdejhlllkqlkklssiccd...........wjkkkjjjigeefffgjiiighiiihiiihhhdaabdffghtxx......mfccehjiffd
566 (PID.TID 0000.0001) // 11 ....pdca--achlheba--ai..........nkn.nkn.fdemijidaaaabi-------a--q+....++s...........+++++..........+yyza--------b-----a--ccccddkhieekkossssfbbbb..........njjijhhihijhgggggjjjjijkkkjkkkkjjhcaacddeegpy.....xfdccdhjgfdd
567 (PID.TID 0000.0001) // 10 ....wfdb--achlhea---an.........uos..os..dcemikkfdcaabi-------equ+..................................zyvuq--------cc----a---dcfhkopqjeissrnpfbbccc........zslihhigghgijjihhhhkllkkkkkkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddc
568 (PID.TID 0000.0001) // 9 ....vgec---bfikca--cjl+.......+nnv.+nv.+ccffhkkiddaadha-----as++........z++........................zxuuk----------a---a----djmqrrnlllsoiddcccccd.......+zjijhfgfggffhjkkkiillljihhghhhghgihighdeeffgghimnnjgecbbcdgfeccb
569 (PID.TID 0000.0001) // 8 ...zleca---afjfca--hdfz.......vkky.jky.jceddefijffdddhb--a-afv............ss.........................+yku---u--------------ejnpqqnninnritqdccchk......wihgghgeffffeefhijkjkljiigeeffeeffefffhjhhikkklljklmhffeeeggfdcbaa
570 (PID.TID 0000.0001) // 7 .+zohec--abcfkhecbchbdx.......qiht.fht.faaaabdgijgfededcdcb-f+.............pz.........................+zu---u--------------edefqgqddsz+......+yu+....tiggfggfeeeefeeefiiiijkiihhedddeddddddddjjllliijhfkmmkkjjhijgdcba--
571 (PID.TID 0000.0001) // 6 +yomfddcaabefkifdchaadt......uqdeisceisc----dfefgifffkklldc--v.............pp.........................v.x---x---------a----fbbpqgzenx+........zdlkhhfffffffgfeeeeeeeefhhhhijihhffddcfddcbbbbdhhiihedddb-cfhhhjjjieca----
572 (PID.TID 0000.0001) // 5 +nhgffkghccfhkhffgdaackz....uoibcimlcimlaaacfbddfjjhijeehf-a-c.............su.........................qk.yi-.yi-------gha-fjddqs+xkrz.........q-kdccdeeeeeeedddedddddgghhhhjhhgffcbbfcbbaaaaddfegecca----dfeefhfgdb-----
573 (PID.TID 0000.0001) // 4 ujhgfllfhdffhkfffca-aady...llnabdopfdopfcbdgdbcdehlihgfddc--ms........................................okn.zdn.zd---eciiiicfkeeqy.ysz..........n-dcbbdeddedcdcccdddcddffggghiggfffdbafdbaa---acdcccba--abvfedeffdcca----b
574 (PID.TID 0000.0001) // 3 jggfcceeffffjlkjgaa---bfvheeln-aesphesphfdhgabddeflihhgfecbaaayq+++++.................................kqnz.vnz.vtpkllgdccfkkkkk..++..........+g-caaadcdddcbbbbcdddcccdffffghgffffdcafdcaa----abcaaaa-acxxmecdjmdbba----r
575 (PID.TID 0000.0001) // 2 feecbbccddefilihecbaacbaajfega-aesqhesqhffiea-cdeflkkljifeddcba---bry+...............................vkqn+.sn+.sghfcbcbbbdgfdek.++++.........+l-aaaaccdccbaaabbddddccdffffghfeeeeecbeecba------baaaa-euwxqdbcdkud-----sy
576 (PID.TID 0000.0001) // 1 bbbaaaaaccdfhlhfefdcccaabjefbaaafonhfonhglid--adfgkkkklkhffddca-----s+++.............................xsrxz.txz.tedcbbbbaaadddet.++++.........+l--a-accddba--bbbddddccdfffhhgfeeddccbdccba-------aaaabgns.qcbcchyzqngll++
577 (PID.TID 0000.0001) // 0 aaaaaa-aacccfikkhecccbbbaaabaadfkllikllilmgebaadfijjiiikjhffdcba-----lll...........................++..u+..z+..zmdfbd---a-aeef.xx+..........+++s---accdcb---bbbcdddddefffggfeeedcccbcccbba----aa--alrwwy.kcbccc+...++++.
578 (PID.TID 0000.0001) // -1 aaaaa----aacffiljgfffcca--adfikkiikiiikimiiheccfurkiffhijjigfecb-----l--...........................+++++.z+..z+.wqgbf-------dgzpoy+........+ys+yaa-abcccb---bbbbddddeffflhfeeeecbbcbbbcbbaa----a--bdflm.yuibbcc.......+.
579 (PID.TID 0000.0001) // =======================================================
580 (PID.TID 0000.0001) // END OF FIELD =
581 (PID.TID 0000.0001) // =======================================================
582 (PID.TID 0000.0001)
583 (PID.TID 0000.0001) // =======================================================
584 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc) at iteration 1
585 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
586 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
587 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
588 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
589 (PID.TID 0000.0001) // 0.0: .
590 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
591 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
592 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
593 (PID.TID 0000.0001) // =======================================================
594 (PID.TID 0000.0001) // =======================================================
595 (PID.TID 0000.0001) // END OF FIELD =
596 (PID.TID 0000.0001) // =======================================================
597 (PID.TID 0000.0001)
598 (PID.TID 0000.0001) // =======================================================
599 (PID.TID 0000.0001) // Field hFacC at iteration 1
600 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
601 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
602 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
603 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
604 (PID.TID 0000.0001) // 0.0: .
605 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
606 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
607 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
608 (PID.TID 0000.0001) // =======================================================
609 (PID.TID 0000.0001) // =======================================================
610 (PID.TID 0000.0001) // END OF FIELD =
611 (PID.TID 0000.0001) // =======================================================
612 (PID.TID 0000.0001)
613 (PID.TID 0000.0001) // =======================================================
614 (PID.TID 0000.0001) // Field hFacW at iteration 1
615 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
616 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
617 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
618 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
619 (PID.TID 0000.0001) // 0.0: .
620 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
621 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
622 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
623 (PID.TID 0000.0001) // =======================================================
624 (PID.TID 0000.0001) // =======================================================
625 (PID.TID 0000.0001) // END OF FIELD =
626 (PID.TID 0000.0001) // =======================================================
627 (PID.TID 0000.0001)
628 (PID.TID 0000.0001) // =======================================================
629 (PID.TID 0000.0001) // Field hFacS at iteration 1
630 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
631 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
632 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
633 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
634 (PID.TID 0000.0001) // 0.0: .
635 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
636 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
637 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
638 (PID.TID 0000.0001) // =======================================================
639 (PID.TID 0000.0001) // =======================================================
640 (PID.TID 0000.0001) // END OF FIELD =
641 (PID.TID 0000.0001) // =======================================================
642 (PID.TID 0000.0001)
643 (PID.TID 0000.0001)
644 (PID.TID 0000.0001) // ===================================
645 (PID.TID 0000.0001) // GAD parameters :
646 (PID.TID 0000.0001) // ===================================
647 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
648 (PID.TID 0000.0001) 2
649 (PID.TID 0000.0001) ;
650 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
651 (PID.TID 0000.0001) 2
652 (PID.TID 0000.0001) ;
653 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
654 (PID.TID 0000.0001) F
655 (PID.TID 0000.0001) ;
656 (PID.TID 0000.0001) tempSOM_Advection = /* use 2nd Order Moment Advection for Temp */
657 (PID.TID 0000.0001) F
658 (PID.TID 0000.0001) ;
659 (PID.TID 0000.0001) AdamsBashforthGt = /* apply Adams-Bashforth extrapolation on Gt */
660 (PID.TID 0000.0001) T
661 (PID.TID 0000.0001) ;
662 (PID.TID 0000.0001) AdamsBashforth_T = /* apply Adams-Bashforth extrapolation on Temp */
663 (PID.TID 0000.0001) F
664 (PID.TID 0000.0001) ;
665 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
666 (PID.TID 0000.0001) 2
667 (PID.TID 0000.0001) ;
668 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
669 (PID.TID 0000.0001) 2
670 (PID.TID 0000.0001) ;
671 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
672 (PID.TID 0000.0001) F
673 (PID.TID 0000.0001) ;
674 (PID.TID 0000.0001) saltSOM_Advection = /* use 2nd Order Moment Advection for Salt */
675 (PID.TID 0000.0001) F
676 (PID.TID 0000.0001) ;
677 (PID.TID 0000.0001) AdamsBashforthGs = /* apply Adams-Bashforth extrapolation on Gs */
678 (PID.TID 0000.0001) T
679 (PID.TID 0000.0001) ;
680 (PID.TID 0000.0001) AdamsBashforth_S = /* apply Adams-Bashforth extrapolation on Salt */
681 (PID.TID 0000.0001) F
682 (PID.TID 0000.0001) ;
683 (PID.TID 0000.0001) // ===================================
685 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
686 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
687 (PID.TID 0000.0001) F
688 (PID.TID 0000.0001) ;
689 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
690 (PID.TID 0000.0001) F
691 (PID.TID 0000.0001) ;
692 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
693 (PID.TID 0000.0001) F
694 (PID.TID 0000.0001) ;
695 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity ( m^2/s ) */
696 (PID.TID 0000.0001) 8.000000000000000E+02
697 (PID.TID 0000.0001) ;
698 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity ( m^2/s ) */
699 (PID.TID 0000.0001) 8.000000000000000E+02
700 (PID.TID 0000.0001) ;
701 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity ( m^2/s ) */
702 (PID.TID 0000.0001) 0.000000000000000E+00
703 (PID.TID 0000.0001) ;
704 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. ( ) */
705 (PID.TID 0000.0001) 0.000000000000000E+00
706 (PID.TID 0000.0001) ;
707 (PID.TID 0000.0001) Tapering/Cliping : gkw91
708 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
709 (PID.TID 0000.0001) 1.000000000000000E-12
710 (PID.TID 0000.0001) ;
711 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
712 (PID.TID 0000.0001) 1.000000000000000E+48
713 (PID.TID 0000.0001) ;
714 (PID.TID 0000.0001) %MON fCori_max = 1.4574827780704E-04
715 (PID.TID 0000.0001) %MON fCori_min = -1.4574827780704E-04
716 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
717 (PID.TID 0000.0001) %MON fCori_sd = 8.4202189509968E-05
718 (PID.TID 0000.0001) %MON fCoriG_max = 1.4584247033981E-04
719 (PID.TID 0000.0001) %MON fCoriG_min = -1.4584247033981E-04
720 (PID.TID 0000.0001) %MON fCoriG_mean = 2.3068131329479E-21
721 (PID.TID 0000.0001) %MON fCoriG_sd = 8.5093242784592E-05
722 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4580166994612E-04
723 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2407700865903E-06
724 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1514045869113E-04
725 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0375849106513E-05
726 (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
727 (PID.TID 0000.0001)
728 (PID.TID 0000.0001) CONFIG_CHECK: OK
729 (PID.TID 0000.0001) // =======================================================
730 (PID.TID 0000.0001) // Model configuration
731 (PID.TID 0000.0001) // =======================================================
732 (PID.TID 0000.0001) //
733 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
734 (PID.TID 0000.0001) //
735 (PID.TID 0000.0001) buoyancyRelation = OCEANIC
736 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
737 (PID.TID 0000.0001) F
738 (PID.TID 0000.0001) ;
739 (PID.TID 0000.0001) fluidIsWater= /* fluid major constituent is Water */
740 (PID.TID 0000.0001) T
741 (PID.TID 0000.0001) ;
742 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
743 (PID.TID 0000.0001) F
744 (PID.TID 0000.0001) ;
745 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
746 (PID.TID 0000.0001) T
747 (PID.TID 0000.0001) ;
748 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or K ) */
749 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
750 (PID.TID 0000.0001) ;
751 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( psu ) */
752 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
753 (PID.TID 0000.0001) ;
754 (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
755 (PID.TID 0000.0001) 3.000000000000000E+05
756 (PID.TID 0000.0001) ;
757 (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
758 (PID.TID 0000.0001) 1.000000000000000E+21
759 (PID.TID 0000.0001) ;
760 (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
761 (PID.TID 0000.0001) 0.000000000000000E+00
762 (PID.TID 0000.0001) ;
763 (PID.TID 0000.0001) useFullLeith = /* Use Full Form of Leith Viscosity on/off flag*/
764 (PID.TID 0000.0001) F
765 (PID.TID 0000.0001) ;
766 (PID.TID 0000.0001) useStrainTensionVisc = /* Use StrainTension Form of Viscous Operator on/off flag*/
767 (PID.TID 0000.0001) F
768 (PID.TID 0000.0001) ;
769 (PID.TID 0000.0001) useAreaViscLength = /* Use area for visc length instead of geom. mean*/
770 (PID.TID 0000.0001) F
771 (PID.TID 0000.0001) ;
772 (PID.TID 0000.0001) viscC2leith = /* Leith harmonic visc. factor (on grad(vort),non-dim.) */
773 (PID.TID 0000.0001) 0.000000000000000E+00
774 (PID.TID 0000.0001) ;
775 (PID.TID 0000.0001) viscC2leithD = /* Leith harmonic viscosity factor (on grad(div),non-dim.) */
776 (PID.TID 0000.0001) 0.000000000000000E+00
777 (PID.TID 0000.0001) ;
778 (PID.TID 0000.0001) viscC2smag = /* Smagorinsky harmonic viscosity factor (non-dim.) */
779 (PID.TID 0000.0001) 0.000000000000000E+00
780 (PID.TID 0000.0001) ;
781 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
782 (PID.TID 0000.0001) 0.000000000000000E+00
783 (PID.TID 0000.0001) ;
784 (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
785 (PID.TID 0000.0001) 1.000000000000000E+21
786 (PID.TID 0000.0001) ;
787 (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
788 (PID.TID 0000.0001) 0.000000000000000E+00
789 (PID.TID 0000.0001) ;
790 (PID.TID 0000.0001) viscC4leith = /* Leith biharm viscosity factor (on grad(vort), non-dim.) */
791 (PID.TID 0000.0001) 0.000000000000000E+00
792 (PID.TID 0000.0001) ;
793 (PID.TID 0000.0001) viscC4leithD = /* Leith biharm viscosity factor (on grad(div), non-dim.) */
794 (PID.TID 0000.0001) 0.000000000000000E+00
795 (PID.TID 0000.0001) ;
796 (PID.TID 0000.0001) viscC4Smag = /* Smagorinsky biharm viscosity factor (non-dim) */
797 (PID.TID 0000.0001) 0.000000000000000E+00
798 (PID.TID 0000.0001) ;
799 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
800 (PID.TID 0000.0001) T
801 (PID.TID 0000.0001) ;
802 (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
803 (PID.TID 0000.0001) 2.000000000000000E+00
804 (PID.TID 0000.0001) ;
805 (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
806 (PID.TID 0000.0001) 1.000000000000000E-03
807 (PID.TID 0000.0001) ;
808 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
809 (PID.TID 0000.0001) T
810 (PID.TID 0000.0001) ;
811 (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( 1/s ) */
812 (PID.TID 0000.0001) 0.000000000000000E+00
813 (PID.TID 0000.0001) ;
814 (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coeff. ( 1/m ) */
815 (PID.TID 0000.0001) 0.000000000000000E+00
816 (PID.TID 0000.0001) ;
817 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
818 (PID.TID 0000.0001) 0.000000000000000E+00
819 (PID.TID 0000.0001) ;
820 (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
821 (PID.TID 0000.0001) 0.000000000000000E+00
822 (PID.TID 0000.0001) ;
823 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
824 (PID.TID 0000.0001) 0.000000000000000E+00
825 (PID.TID 0000.0001) ;
826 (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
827 (PID.TID 0000.0001) 0.000000000000000E+00
828 (PID.TID 0000.0001) ;
829 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
830 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
831 (PID.TID 0000.0001) ;
832 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
833 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
834 (PID.TID 0000.0001) ;
835 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 1979 ( m^2/s ) */
836 (PID.TID 0000.0001) 0.000000000000000E+00
837 (PID.TID 0000.0001) ;
838 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
839 (PID.TID 0000.0001) 0.000000000000000E+00
840 (PID.TID 0000.0001) ;
841 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
842 (PID.TID 0000.0001) 2.000000000000000E+02
843 (PID.TID 0000.0001) ;
844 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
845 (PID.TID 0000.0001) -2.000000000000000E+03
846 (PID.TID 0000.0001) ;
847 (PID.TID 0000.0001) Equation of State : eosType = JMD95Z ;
848 (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/oC ) */
849 (PID.TID 0000.0001) 1.234567000000000E+05
850 (PID.TID 0000.0001) ;
851 (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/psu ) */
852 (PID.TID 0000.0001) 1.234567000000000E+05
853 (PID.TID 0000.0001) ;
854 (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
855 (PID.TID 0000.0001) 9.998000000000000E+02
856 (PID.TID 0000.0001) ;
857 (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
858 (PID.TID 0000.0001) 1.030000000000000E+03
859 (PID.TID 0000.0001) ;
860 (PID.TID 0000.0001) rhoFacC = /* normalized Reference density @ cell-Center (-) */
861 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
862 (PID.TID 0000.0001) ;
863 (PID.TID 0000.0001) rhoFacF = /* normalized Reference density @ W-Interface (-) */
864 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
865 (PID.TID 0000.0001) ;
866 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
867 (PID.TID 0000.0001) 1.000000000000000E+03
868 (PID.TID 0000.0001) ;
869 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
870 (PID.TID 0000.0001) 9.810000000000000E+00
871 (PID.TID 0000.0001) ;
872 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
873 (PID.TID 0000.0001) 9.810000000000000E+00
874 (PID.TID 0000.0001) ;
875 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
876 (PID.TID 0000.0001) 8.616400000000000E+04
877 (PID.TID 0000.0001) ;
878 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
879 (PID.TID 0000.0001) 7.292123516990375E-05
880 (PID.TID 0000.0001) ;
881 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
882 (PID.TID 0000.0001) 1.000000000000000E-04
883 (PID.TID 0000.0001) ;
884 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
885 (PID.TID 0000.0001) 9.999999999999999E-12
886 (PID.TID 0000.0001) ;
887 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
888 (PID.TID 0000.0001) 1.000000000000000E+00
889 (PID.TID 0000.0001) ;
890 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
891 (PID.TID 0000.0001) T
892 (PID.TID 0000.0001) ;
893 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
894 (PID.TID 0000.0001) F
895 (PID.TID 0000.0001) ;
896 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
897 (PID.TID 0000.0001) 1.000000000000000E+00
898 (PID.TID 0000.0001) ;
899 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
900 (PID.TID 0000.0001) 1.000000000000000E+00
901 (PID.TID 0000.0001) ;
902 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
903 (PID.TID 0000.0001) T
904 (PID.TID 0000.0001) ;
905 (PID.TID 0000.0001) linFSConserveTr = /* Tracer correction for Lin Free Surface on/off flag*/
906 (PID.TID 0000.0001) F
907 (PID.TID 0000.0001) ;
908 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
909 (PID.TID 0000.0001) T
910 (PID.TID 0000.0001) ;
911 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
912 (PID.TID 0000.0001) 4
913 (PID.TID 0000.0001) ;
914 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
915 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
916 (PID.TID 0000.0001) 2.000000000000000E-01
917 (PID.TID 0000.0001) ;
918 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
919 (PID.TID 0000.0001) 2.000000000000000E+00
920 (PID.TID 0000.0001) ;
921 (PID.TID 0000.0001) select_rStar = /* r* Coordinate options (not yet implemented)*/
922 (PID.TID 0000.0001) 2
923 (PID.TID 0000.0001) ;
924 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
925 (PID.TID 0000.0001) T
926 (PID.TID 0000.0001) ;
927 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
928 (PID.TID 0000.0001) 0.000000000000000E+00
929 (PID.TID 0000.0001) ;
930 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(ppt)*/
931 (PID.TID 0000.0001) 0.000000000000000E+00
932 (PID.TID 0000.0001) ;
933 (PID.TID 0000.0001) use3Dsolver = /* use 3-D pressure solver on/off flag */
934 (PID.TID 0000.0001) F
935 (PID.TID 0000.0001) ;
936 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
937 (PID.TID 0000.0001) F
938 (PID.TID 0000.0001) ;
939 (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
940 (PID.TID 0000.0001) 1.000000000000000E+00
941 (PID.TID 0000.0001) ;
942 (PID.TID 0000.0001) quasiHydrostatic = /* Quasi-Hydrostatic on/off flag */
943 (PID.TID 0000.0001) F
944 (PID.TID 0000.0001) ;
945 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
946 (PID.TID 0000.0001) T
947 (PID.TID 0000.0001) ;
948 (PID.TID 0000.0001) vectorInvariantMomentum= /* Vector-Invariant Momentum on/off */
949 (PID.TID 0000.0001) T
950 (PID.TID 0000.0001) ;
951 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
952 (PID.TID 0000.0001) T
953 (PID.TID 0000.0001) ;
954 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
955 (PID.TID 0000.0001) T
956 (PID.TID 0000.0001) ;
957 (PID.TID 0000.0001) momImplVertAdv =/* Momentum implicit vert. advection on/off*/
958 (PID.TID 0000.0001) F
959 (PID.TID 0000.0001) ;
960 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
961 (PID.TID 0000.0001) F
962 (PID.TID 0000.0001) ;
963 (PID.TID 0000.0001) metricTerms = /* metric-Terms on/off flag */
964 (PID.TID 0000.0001) F
965 (PID.TID 0000.0001) ;
966 (PID.TID 0000.0001) useNHMTerms = /* Non-Hydrostatic Metric-Terms on/off */
967 (PID.TID 0000.0001) F
968 (PID.TID 0000.0001) ;
969 (PID.TID 0000.0001) useConstantF = /* use Constant f0 Coriolis flag */
970 (PID.TID 0000.0001) F
971 (PID.TID 0000.0001) ;
972 (PID.TID 0000.0001) useBetaPlaneF = /* use Beta-Plane Coriolis flag */
973 (PID.TID 0000.0001) F
974 (PID.TID 0000.0001) ;
975 (PID.TID 0000.0001) useSphereF = /* use Spherical Coriolis flag */
976 (PID.TID 0000.0001) T
977 (PID.TID 0000.0001) ;
978 (PID.TID 0000.0001) use3dCoriolis = /* 3-D Coriolis on/off flag */
979 (PID.TID 0000.0001) F
980 (PID.TID 0000.0001) ;
981 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
982 (PID.TID 0000.0001) T
983 (PID.TID 0000.0001) ;
984 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
985 (PID.TID 0000.0001) F
986 (PID.TID 0000.0001) ;
987 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
988 (PID.TID 0000.0001) F
989 (PID.TID 0000.0001) ;
990 (PID.TID 0000.0001) useJamartMomAdv= /* V.I. Non-linear terms Jamart flag */
991 (PID.TID 0000.0001) F
992 (PID.TID 0000.0001) ;
993 (PID.TID 0000.0001) SadournyCoriolis= /* Sadourny Coriolis discr. flag */
994 (PID.TID 0000.0001) F
995 (PID.TID 0000.0001) ;
996 (PID.TID 0000.0001) upwindVorticity= /* Upwind bias vorticity flag */
997 (PID.TID 0000.0001) F
998 (PID.TID 0000.0001) ;
999 (PID.TID 0000.0001) useAbsVorticity= /* Work with f+zeta in Coriolis */
1000 (PID.TID 0000.0001) F
1001 (PID.TID 0000.0001) ;
1002 (PID.TID 0000.0001) highOrderVorticity= /* High order interp. of vort. flag */
1003 (PID.TID 0000.0001) F
1004 (PID.TID 0000.0001) ;
1005 (PID.TID 0000.0001) upwindShear= /* Upwind vertical Shear advection flag */
1006 (PID.TID 0000.0001) F
1007 (PID.TID 0000.0001) ;
1008 (PID.TID 0000.0001) selectKEscheme= /* Kinetic Energy scheme selector */
1009 (PID.TID 0000.0001) 0
1010 (PID.TID 0000.0001) ;
1011 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
1012 (PID.TID 0000.0001) T
1013 (PID.TID 0000.0001) ;
1014 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
1015 (PID.TID 0000.0001) T
1016 (PID.TID 0000.0001) ;
1017 (PID.TID 0000.0001) implicitIntGravWave= /* Implicit Internal Gravity Wave flag */
1018 (PID.TID 0000.0001) F
1019 (PID.TID 0000.0001) ;
1020 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
1021 (PID.TID 0000.0001) T
1022 (PID.TID 0000.0001) ;
1023 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
1024 (PID.TID 0000.0001) T
1025 (PID.TID 0000.0001) ;
1026 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
1027 (PID.TID 0000.0001) F
1028 (PID.TID 0000.0001) ;
1029 (PID.TID 0000.0001) implicitDiffusion =/* Implicit Diffusion on/off flag */
1030 (PID.TID 0000.0001) T
1031 (PID.TID 0000.0001) ;
1032 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
1033 (PID.TID 0000.0001) T
1034 (PID.TID 0000.0001) ;
1035 (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
1036 (PID.TID 0000.0001) T
1037 (PID.TID 0000.0001) ;
1038 (PID.TID 0000.0001) tempImplVertAdv =/* Temp. implicit vert. advection on/off */
1039 (PID.TID 0000.0001) F
1040 (PID.TID 0000.0001) ;
1041 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
1042 (PID.TID 0000.0001) T
1043 (PID.TID 0000.0001) ;
1044 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
1045 (PID.TID 0000.0001) T
1046 (PID.TID 0000.0001) ;
1047 (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
1048 (PID.TID 0000.0001) T
1049 (PID.TID 0000.0001) ;
1050 (PID.TID 0000.0001) saltImplVertAdv =/* Sali. implicit vert. advection on/off */
1051 (PID.TID 0000.0001) F
1052 (PID.TID 0000.0001) ;
1053 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
1054 (PID.TID 0000.0001) T
1055 (PID.TID 0000.0001) ;
1056 (PID.TID 0000.0001) readBinaryPrec = /* Precision used for reading binary files */
1057 (PID.TID 0000.0001) 64
1058 (PID.TID 0000.0001) ;
1059 (PID.TID 0000.0001) writeBinaryPrec = /* Precision used for writing binary files */
1060 (PID.TID 0000.0001) 64
1061 (PID.TID 0000.0001) ;
1062 (PID.TID 0000.0001) globalFiles = /* write "global" (=not per tile) files */
1063 (PID.TID 0000.0001) F
1064 (PID.TID 0000.0001) ;
1065 (PID.TID 0000.0001) useSingleCpuIO = /* only master MPI process does I/O */
1066 (PID.TID 0000.0001) F
1067 (PID.TID 0000.0001) ;
1068 (PID.TID 0000.0001) debugMode = /* Debug Mode on/off flag */
1069 (PID.TID 0000.0001) F
1070 (PID.TID 0000.0001) ;
1071 (PID.TID 0000.0001) debLevA = /* 1rst level of debugging */
1072 (PID.TID 0000.0001) 1
1073 (PID.TID 0000.0001) ;
1074 (PID.TID 0000.0001) debLevB = /* 2nd level of debugging */
1075 (PID.TID 0000.0001) 2
1076 (PID.TID 0000.0001) ;
1077 (PID.TID 0000.0001) debugLevel = /* select debugging level */
1078 (PID.TID 0000.0001) 1
1079 (PID.TID 0000.0001) ;
1080 (PID.TID 0000.0001) //
1081 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
1082 (PID.TID 0000.0001) //
1083 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
1084 (PID.TID 0000.0001) 200
1085 (PID.TID 0000.0001) ;
1086 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
1087 (PID.TID 0000.0001) 1
1088 (PID.TID 0000.0001) ;
1089 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
1090 (PID.TID 0000.0001) 1.000000000000000E-09
1091 (PID.TID 0000.0001) ;
1092 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
1093 (PID.TID 0000.0001) -1.000000000000000E+00
1094 (PID.TID 0000.0001) ;
1095 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
1096 (PID.TID 0000.0001) 1
1097 (PID.TID 0000.0001) ;
1098 (PID.TID 0000.0001) //
1099 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
1100 (PID.TID 0000.0001) //
1101 (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
1102 (PID.TID 0000.0001) 0
1103 (PID.TID 0000.0001) ;
1104 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
1105 (PID.TID 0000.0001) 5
1106 (PID.TID 0000.0001) ;
1107 (PID.TID 0000.0001) deltaTmom = /* Momentum equation timestep ( s ) */
1108 (PID.TID 0000.0001) 3.600000000000000E+03
1109 (PID.TID 0000.0001) ;
1110 (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
1111 (PID.TID 0000.0001) 3.600000000000000E+03
1112 (PID.TID 0000.0001) ;
1113 (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
1114 (PID.TID 0000.0001) 15 @ 3.600000000000000E+03 /* K = 1: 15 */
1115 (PID.TID 0000.0001) ;
1116 (PID.TID 0000.0001) deltaTClock = /* Model clock timestep ( s ) */
1117 (PID.TID 0000.0001) 3.600000000000000E+03
1118 (PID.TID 0000.0001) ;
1119 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1120 (PID.TID 0000.0001) 0.000000000000000E+00
1121 (PID.TID 0000.0001) ;
1122 (PID.TID 0000.0001) momForcingOutAB = /* =1: take Momentum Forcing out of Adams-Bash. stepping */
1123 (PID.TID 0000.0001) 0
1124 (PID.TID 0000.0001) ;
1125 (PID.TID 0000.0001) tracForcingOutAB = /* =1: take T,S,pTr Forcing out of Adams-Bash. stepping */
1126 (PID.TID 0000.0001) 1
1127 (PID.TID 0000.0001) ;
1128 (PID.TID 0000.0001) momDissip_In_AB = /* put Dissipation Tendency in Adams-Bash. stepping */
1129 (PID.TID 0000.0001) T
1130 (PID.TID 0000.0001) ;
1131 (PID.TID 0000.0001) doAB_onGtGs = /* apply AB on Tendencies (rather than on T,S)*/
1132 (PID.TID 0000.0001) T
1133 (PID.TID 0000.0001) ;
1134 (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
1135 (PID.TID 0000.0001) 1.000000000000000E-01
1136 (PID.TID 0000.0001) ;
1137 (PID.TID 0000.0001) baseTime = /* Model base time ( s ). */
1138 (PID.TID 0000.0001) 0.000000000000000E+00
1139 (PID.TID 0000.0001) ;
1140 (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
1141 (PID.TID 0000.0001) 0.000000000000000E+00
1142 (PID.TID 0000.0001) ;
1143 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
1144 (PID.TID 0000.0001) 1.800000000000000E+04
1145 (PID.TID 0000.0001) ;
1146 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
1147 (PID.TID 0000.0001) 2.592000000000000E+06
1148 (PID.TID 0000.0001) ;
1149 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
1150 (PID.TID 0000.0001) 0.000000000000000E+00
1151 (PID.TID 0000.0001) ;
1152 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1153 (PID.TID 0000.0001) T
1154 (PID.TID 0000.0001) ;
1155 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1156 (PID.TID 0000.0001) T
1157 (PID.TID 0000.0001) ;
1158 (PID.TID 0000.0001) pickup_write_mnc = /* Model IO flag. */
1159 (PID.TID 0000.0001) F
1160 (PID.TID 0000.0001) ;
1161 (PID.TID 0000.0001) pickup_read_mnc = /* Model IO flag. */
1162 (PID.TID 0000.0001) F
1163 (PID.TID 0000.0001) ;
1164 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1165 (PID.TID 0000.0001) F
1166 (PID.TID 0000.0001) ;
1167 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1168 (PID.TID 0000.0001) 8.640000000000000E+05
1169 (PID.TID 0000.0001) ;
1170 (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1171 (PID.TID 0000.0001) T
1172 (PID.TID 0000.0001) ;
1173 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1174 (PID.TID 0000.0001) T
1175 (PID.TID 0000.0001) ;
1176 (PID.TID 0000.0001) snapshot_mnc = /* Model IO flag. */
1177 (PID.TID 0000.0001) F
1178 (PID.TID 0000.0001) ;
1179 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1180 (PID.TID 0000.0001) 1.000000000000000E+00
1181 (PID.TID 0000.0001) ;
1182 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1183 (PID.TID 0000.0001) T
1184 (PID.TID 0000.0001) ;
1185 (PID.TID 0000.0001) monitor_mnc = /* Model IO flag. */
1186 (PID.TID 0000.0001) F
1187 (PID.TID 0000.0001) ;
1188 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1189 (PID.TID 0000.0001) 2.592000000000000E+06
1190 (PID.TID 0000.0001) ;
1191 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1192 (PID.TID 0000.0001) 3.110400000000000E+07
1193 (PID.TID 0000.0001) ;
1194 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1195 (PID.TID 0000.0001) 0.000000000000000E+00
1196 (PID.TID 0000.0001) ;
1197 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1198 (PID.TID 0000.0001) 6.220800000000000E+08
1199 (PID.TID 0000.0001) ;
1200 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1201 (PID.TID 0000.0001) 1.800000000000000E+02
1202 (PID.TID 0000.0001) ;
1203 (PID.TID 0000.0001) //
1204 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1205 (PID.TID 0000.0001) //
1206 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True/False ) */
1207 (PID.TID 0000.0001) F
1208 (PID.TID 0000.0001) ;
1209 (PID.TID 0000.0001) usingCylindricalGrid = /* Cylindrical coordinates flag ( True/False ) */
1210 (PID.TID 0000.0001) F
1211 (PID.TID 0000.0001) ;
1212 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True/False ) */
1213 (PID.TID 0000.0001) F
1214 (PID.TID 0000.0001) ;
1215 (PID.TID 0000.0001) usingCurvilinearGrid = /* Curvilinear coordinates flag ( True/False ) */
1216 (PID.TID 0000.0001) T
1217 (PID.TID 0000.0001) ;
1218 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r ) */
1219 (PID.TID 0000.0001) 0.000000000000000E+00
1220 (PID.TID 0000.0001) ;
1221 (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1222 (PID.TID 0000.0001) -1.000000000000000E+00
1223 (PID.TID 0000.0001) ;
1224 (PID.TID 0000.0001) gravitySign = /* gravity orientation relative to vertical coordinate */
1225 (PID.TID 0000.0001) -1.000000000000000E+00
1226 (PID.TID 0000.0001) ;
1227 (PID.TID 0000.0001) horiVertRatio = /* Ratio on units : Horiz - Vertical */
1228 (PID.TID 0000.0001) 1.000000000000000E+00
1229 (PID.TID 0000.0001) ;
1230 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1231 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1232 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1233 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1234 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1235 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1236 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1237 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1238 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1239 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1240 (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1241 (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1242 (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1243 (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1244 (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1245 (PID.TID 0000.0001) 6.650000000000000E+02 /* K = 15 */
1246 (PID.TID 0000.0001) ;
1247 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1248 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1249 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1250 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1251 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1252 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1253 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1254 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1255 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1256 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1257 (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1258 (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1259 (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1260 (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1261 (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1262 (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1263 (PID.TID 0000.0001) ;
1264 (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
1265 (PID.TID 0000.0001) 192 @ 1.234567000000000E+05 /* I = 1:192 */
1266 (PID.TID 0000.0001) ;
1267 (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
1268 (PID.TID 0000.0001) 32 @ 1.234567000000000E+05 /* J = 1: 32 */
1269 (PID.TID 0000.0001) ;
1270 (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
1271 (PID.TID 0000.0001) 0.000000000000000E+00
1272 (PID.TID 0000.0001) ;
1273 (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
1274 (PID.TID 0000.0001) 0.000000000000000E+00
1275 (PID.TID 0000.0001) ;
1276 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1277 (PID.TID 0000.0001) 6.370000000000000E+06
1278 (PID.TID 0000.0001) ;
1279 (PID.TID 0000.0001) deepAtmosphere = /* Deep/Shallow Atmosphere flag (True/False) */
1280 (PID.TID 0000.0001) F
1281 (PID.TID 0000.0001) ;
1282 (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
1283 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1284 (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1285 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1286 (PID.TID 0000.0001) -3.923446288487304E+01, /* I = 4 */
1287 (PID.TID 0000.0001) -3.702585158682200E+01, /* I = 5 */
1288 (PID.TID 0000.0001) -3.461179367094151E+01, /* I = 6 */
1289 (PID.TID 0000.0001) -3.200434569041793E+01, /* I = 7 */
1290 (PID.TID 0000.0001) -2.921355965632675E+01, /* I = 8 */
1291 (PID.TID 0000.0001) -2.624932223028290E+01, /* I = 9 */
1292 (PID.TID 0000.0001) -2.312261250426344E+01, /* I = 10 */
1293 (PID.TID 0000.0001) -1.984640717127058E+01, /* I = 11 */
1294 (PID.TID 0000.0001) -1.643630800555134E+01, /* I = 12 */
1295 (PID.TID 0000.0001) -1.291089806302069E+01, /* I = 13 */
1296 (PID.TID 0000.0001) -9.291807802719402E+00, /* I = 14 */
1297 (PID.TID 0000.0001) -5.603475335822332E+00, /* I = 15 */
1298 (PID.TID 0000.0001) -1.872608513033445E+00, /* I = 16 */
1299 (PID.TID 0000.0001) 1.872608513033445E+00, /* I = 17 */
1300 (PID.TID 0000.0001) 5.603475335822332E+00, /* I = 18 */
1301 (PID.TID 0000.0001) 9.291807802719402E+00, /* I = 19 */
1302 (PID.TID 0000.0001) 1.291089806302069E+01, /* I = 20 */
1303 (PID.TID 0000.0001) 1.643630800555134E+01, /* I = 21 */
1304 (PID.TID 0000.0001) 1.984640717127058E+01, /* I = 22 */
1305 (PID.TID 0000.0001) 2.312261250426344E+01, /* I = 23 */
1306 (PID.TID 0000.0001) 2.624932223028290E+01, /* I = 24 */
1307 (PID.TID 0000.0001) 2.921355965632675E+01, /* I = 25 */
1308 (PID.TID 0000.0001) 3.200434569041793E+01, /* I = 26 */
1309 (PID.TID 0000.0001) 3.461179367094151E+01, /* I = 27 */
1310 (PID.TID 0000.0001) 3.702585158682200E+01, /* I = 28 */
1311 (PID.TID 0000.0001) 3.923446288487304E+01, /* I = 29 */
1312 (PID.TID 0000.0001) 4.122055553388957E+01, /* I = 30 */
1313 (PID.TID 0000.0001) 4.295641272275883E+01, /* I = 31 */
1314 (PID.TID 0000.0001) 4.439521994760536E+01, /* I = 32 */
1315 (PID.TID 0000.0001) 4.560478005239464E+01, /* I = 33 */
1316 (PID.TID 0000.0001) 4.704358727724117E+01, /* I = 34 */
1317 (PID.TID 0000.0001) 4.877944446611043E+01, /* I = 35 */
1318 (PID.TID 0000.0001) 5.076553711512697E+01, /* I = 36 */
1319 (PID.TID 0000.0001) 5.297414841317801E+01, /* I = 37 */
1320 (PID.TID 0000.0001) 5.538820632905850E+01, /* I = 38 */
1321 (PID.TID 0000.0001) 5.799565430958209E+01, /* I = 39 */
1322 (PID.TID 0000.0001) 6.078644034367325E+01, /* I = 40 */
1323 (PID.TID 0000.0001) 6.375067776971711E+01, /* I = 41 */
1324 (PID.TID 0000.0001) 6.687738749573657E+01, /* I = 42 */
1325 (PID.TID 0000.0001) 7.015359282872943E+01, /* I = 43 */
1326 (PID.TID 0000.0001) 7.356369199444866E+01, /* I = 44 */
1327 (PID.TID 0000.0001) 7.708910193697932E+01, /* I = 45 */
1328 (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1329 (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1330 (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1331 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1332 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1333 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1334 (PID.TID 0000.0001) 1.029108980630207E+02, /* I = 52 */
1335 (PID.TID 0000.0001) 1.064363080055513E+02, /* I = 53 */
1336 (PID.TID 0000.0001) 1.098464071712706E+02, /* I = 54 */
1337 (PID.TID 0000.0001) 1.131226125042634E+02, /* I = 55 */
1338 (PID.TID 0000.0001) 1.162493222302829E+02, /* I = 56 */
1339 (PID.TID 0000.0001) 1.192135596563268E+02, /* I = 57 */
1340 (PID.TID 0000.0001) 1.220043456904179E+02, /* I = 58 */
1341 (PID.TID 0000.0001) 1.246117936709415E+02, /* I = 59 */
1342 (PID.TID 0000.0001) 1.270258515868220E+02, /* I = 60 */
1343 (PID.TID 0000.0001) 1.292344628848730E+02, /* I = 61 */
1344 (PID.TID 0000.0001) 1.312205555338896E+02, /* I = 62 */
1345 (PID.TID 0000.0001) 1.329564127227588E+02, /* I = 63 */
1346 (PID.TID 0000.0001) 1.343952199476053E+02, /* I = 64 */
1347 (PID.TID 0000.0001) 4.500000000000000E+01, /* I = 65 */
1348 (PID.TID 0000.0001) 4.620805468796297E+01, /* I = 66 */
1349 (PID.TID 0000.0001) 4.781369642513039E+01, /* I = 67 */
1350 (PID.TID 0000.0001) 4.971767671143929E+01, /* I = 68 */
1351 (PID.TID 0000.0001) 5.187738319787235E+01, /* I = 69 */
1352 (PID.TID 0000.0001) 5.427004371478710E+01, /* I = 70 */
1353 (PID.TID 0000.0001) 5.688128325334060E+01, /* I = 71 */
1354 (PID.TID 0000.0001) 5.970018167786760E+01, /* I = 72 */
1355 (PID.TID 0000.0001) 6.271654991792347E+01, /* I = 73 */
1356 (PID.TID 0000.0001) 6.591914604853015E+01, /* I = 74 */
1357 (PID.TID 0000.0001) 6.929439270484148E+01, /* I = 75 */
1358 (PID.TID 0000.0001) 7.282545807616151E+01, /* I = 76 */
1359 (PID.TID 0000.0001) 7.649168830618933E+01, /* I = 77 */
1360 (PID.TID 0000.0001) 8.026842803787176E+01, /* I = 78 */
1361 (PID.TID 0000.0001) 8.412726743124185E+01, /* I = 79 */
1362 (PID.TID 0000.0001) 8.803672008547504E+01, /* I = 80 */
1363 (PID.TID 0000.0001) 9.196327991452496E+01, /* I = 81 */
1364 (PID.TID 0000.0001) 9.587273256875815E+01, /* I = 82 */
1365 (PID.TID 0000.0001) 9.973157196212824E+01, /* I = 83 */
1366 (PID.TID 0000.0001) 1.035083116938107E+02, /* I = 84 */
1367 (PID.TID 0000.0001) 1.071745419238385E+02, /* I = 85 */
1368 (PID.TID 0000.0001) 1.107056072951585E+02, /* I = 86 */
1369 (PID.TID 0000.0001) 1.140808539514698E+02, /* I = 87 */
1370 (PID.TID 0000.0001) 1.172834500820765E+02, /* I = 88 */
1371 (PID.TID 0000.0001) 1.202998183221324E+02, /* I = 89 */
1372 (PID.TID 0000.0001) 1.231187167466594E+02, /* I = 90 */
1373 (PID.TID 0000.0001) 1.257299562852129E+02, /* I = 91 */
1374 (PID.TID 0000.0001) 1.281226168021277E+02, /* I = 92 */
1375 (PID.TID 0000.0001) 1.302823232885607E+02, /* I = 93 */
1376 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1377 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1378 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1379 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1380 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1381 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1382 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =100 */
1383 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =101 */
1384 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =102 */
1385 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =103 */
1386 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =104 */
1387 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =105 */
1388 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =106 */
1389 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =107 */
1390 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =108 */
1391 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =109 */
1392 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =110 */
1393 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =111 */
1394 (PID.TID 0000.0001) 2 @ 1.363550967500717E+02, /* I =112:113 */
1395 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =114 */
1396 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =115 */
1397 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =116 */
1398 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =117 */
1399 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =118 */
1400 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =119 */
1401 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =120 */
1402 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =121 */
1403 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =122 */
1404 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =123 */
1405 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =124 */
1406 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =125 */
1407 (PID.TID 0000.0001) 1.359720382181193E+02, /* I =126 */
1408 (PID.TID 0000.0001) 1.358367907661329E+02, /* I =127 */
1409 (PID.TID 0000.0001) 1.356047800523947E+02, /* I =128 */
1410 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =129 */
1411 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =130 */
1412 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =131 */
1413 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =132 */
1414 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =133 */
1415 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =134 */
1416 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =135 */
1417 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =136 */
1418 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =137 */
1419 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =138 */
1420 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =139 */
1421 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =140 */
1422 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =141 */
1423 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1424 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1425 (PID.TID 0000.0001) 2 @ -1.336449032499283E+02, /* I =144:145 */
1426 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1427 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1428 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =148 */
1429 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =149 */
1430 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =150 */
1431 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =151 */
1432 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =152 */
1433 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =153 */
1434 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =154 */
1435 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =155 */
1436 (PID.TID 0000.0001) -1.338655466852958E+02, /* I =156 */
1437 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =157 */
1438 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =158 */
1439 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =159 */
1440 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =160 */
1441 (PID.TID 0000.0001) -1.350000000000000E+02, /* I =161 */
1442 (PID.TID 0000.0001) -1.362080546879630E+02, /* I =162 */
1443 (PID.TID 0000.0001) -1.378136964251304E+02, /* I =163 */
1444 (PID.TID 0000.0001) -1.397176767114393E+02, /* I =164 */
1445 (PID.TID 0000.0001) -1.418773831978723E+02, /* I =165 */
1446 (PID.TID 0000.0001) -1.442700437147871E+02, /* I =166 */
1447 (PID.TID 0000.0001) -1.468812832533406E+02, /* I =167 */
1448 (PID.TID 0000.0001) -1.497001816778676E+02, /* I =168 */
1449 (PID.TID 0000.0001) -1.527165499179235E+02, /* I =169 */
1450 (PID.TID 0000.0001) -1.559191460485302E+02, /* I =170 */
1451 (PID.TID 0000.0001) -1.592943927048415E+02, /* I =171 */
1452 (PID.TID 0000.0001) -1.628254580761615E+02, /* I =172 */
1453 (PID.TID 0000.0001) -1.664916883061893E+02, /* I =173 */
1454 (PID.TID 0000.0001) -1.702684280378718E+02, /* I =174 */
1455 (PID.TID 0000.0001) -1.741272674312418E+02, /* I =175 */
1456 (PID.TID 0000.0001) -1.780367200854751E+02, /* I =176 */
1457 (PID.TID 0000.0001) 1.780367200854751E+02, /* I =177 */
1458 (PID.TID 0000.0001) 1.741272674312418E+02, /* I =178 */
1459 (PID.TID 0000.0001) 1.702684280378718E+02, /* I =179 */
1460 (PID.TID 0000.0001) 1.664916883061893E+02, /* I =180 */
1461 (PID.TID 0000.0001) 1.628254580761615E+02, /* I =181 */
1462 (PID.TID 0000.0001) 1.592943927048415E+02, /* I =182 */
1463 (PID.TID 0000.0001) 1.559191460485302E+02, /* I =183 */
1464 (PID.TID 0000.0001) 1.527165499179235E+02, /* I =184 */
1465 (PID.TID 0000.0001) 1.497001816778676E+02, /* I =185 */
1466 (PID.TID 0000.0001) 1.468812832533406E+02, /* I =186 */
1467 (PID.TID 0000.0001) 1.442700437147871E+02, /* I =187 */
1468 (PID.TID 0000.0001) 1.418773831978723E+02, /* I =188 */
1469 (PID.TID 0000.0001) 1.397176767114393E+02, /* I =189 */
1470 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1471 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1472 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1473 (PID.TID 0000.0001) ;
1474 (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
1475 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1476 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1477 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1478 (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1479 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1480 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1481 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1482 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1483 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1484 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1485 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1486 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1487 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1488 (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1489 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1490 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1491 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1492 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1493 (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1494 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1495 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1496 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1497 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1498 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1499 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1500 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1501 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1502 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1503 (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1504 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1505 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1506 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1507 (PID.TID 0000.0001) ;
1508 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1509 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1510 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1511 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1512 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1513 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1514 (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1515 (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1516 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1517 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1518 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1519 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1520 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1521 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1522 (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1523 (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1524 (PID.TID 0000.0001) ;
1525 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1526 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1527 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1528 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1529 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1530 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1531 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1532 (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1533 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1534 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1535 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1536 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1537 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1538 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1539 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1540 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1541 (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1542 (PID.TID 0000.0001) ;
1543 (PID.TID 0000.0001) deepFacC = /* deep-model grid factor @ cell-Center (-) */
1544 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1545 (PID.TID 0000.0001) ;
1546 (PID.TID 0000.0001) deepFacF = /* deep-model grid factor @ W-Interface (-) */
1547 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1548 (PID.TID 0000.0001) ;
1549 (PID.TID 0000.0001) rVel2wUnit = /* convert units: rVel -> wSpeed (=1 if z-coord)*/
1550 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1551 (PID.TID 0000.0001) ;
1552 (PID.TID 0000.0001) wUnit2rVel = /* convert units: wSpeed -> rVel (=1 if z-coord)*/
1553 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1554 (PID.TID 0000.0001) ;
1555 (PID.TID 0000.0001) dBdrRef = /* Vertical gradient of reference boyancy [(m/s/r)^2)] */
1556 (PID.TID 0000.0001) 15 @ 0.000000000000000E+00 /* K = 1: 15 */
1557 (PID.TID 0000.0001) ;
1558 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( units: m ) */
1559 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1560 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1561 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1562 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 4 */
1563 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 5 */
1564 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 6 */
1565 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 7 */
1566 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 8 */
1567 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 9 */
1568 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 10 */
1569 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 11 */
1570 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 12 */
1571 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 13 */
1572 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 14 */
1573 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 15 */
1574 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 16: 17 */
1575 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 18 */
1576 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 19 */
1577 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 20 */
1578 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 21 */
1579 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 22 */
1580 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 23 */
1581 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 24 */
1582 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 25 */
1583 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 26 */
1584 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 27 */
1585 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 28 */
1586 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 29 */
1587 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 30 */
1588 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 31 */
1589 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1590 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 34 */
1591 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 35 */
1592 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 36 */
1593 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 37 */
1594 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 38 */
1595 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 39 */
1596 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 40 */
1597 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 41 */
1598 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 42 */
1599 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 43 */
1600 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 44 */
1601 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 45 */
1602 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1603 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1604 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 48: 49 */
1605 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1606 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1607 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 52 */
1608 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 53 */
1609 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 54 */
1610 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 55 */
1611 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 56 */
1612 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 57 */
1613 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 58 */
1614 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 59 */
1615 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 60 */
1616 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 61 */
1617 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 62 */
1618 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 63 */
1619 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1620 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 66 */
1621 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 67 */
1622 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 68 */
1623 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 69 */
1624 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 70 */
1625 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 71 */
1626 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 72 */
1627 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 73 */
1628 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 74 */
1629 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 75 */
1630 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 76 */
1631 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 77 */
1632 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 78 */
1633 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 79 */
1634 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I = 80: 81 */
1635 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 82 */
1636 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 83 */
1637 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 84 */
1638 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 85 */
1639 (PID.TID 0000.0001) 2.842862532064524E+05, /* I = 86 */
1640 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 87 */
1641 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 88 */
1642 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 89 */
1643 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 90 */
1644 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 91 */
1645 (PID.TID 0000.0001) 2.218350349844185E+05, /* I = 92 */
1646 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 93 */
1647 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1648 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1649 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1650 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1651 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1652 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =100 */
1653 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =101 */
1654 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =102 */
1655 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =103 */
1656 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =104 */
1657 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =105 */
1658 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =106 */
1659 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =107 */
1660 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =108 */
1661 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =109 */
1662 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =110 */
1663 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =111 */
1664 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =112:113 */
1665 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =114 */
1666 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =115 */
1667 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =116 */
1668 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =117 */
1669 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =118 */
1670 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =119 */
1671 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =120 */
1672 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =121 */
1673 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =122 */
1674 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =123 */
1675 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =124 */
1676 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =125 */
1677 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =126 */
1678 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =127 */
1679 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1680 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =130 */
1681 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =131 */
1682 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =132 */
1683 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =133 */
1684 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =134 */
1685 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =135 */
1686 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =136 */
1687 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =137 */
1688 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =138 */
1689 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =139 */
1690 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =140 */
1691 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =141 */
1692 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
1693 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
1694 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =144:145 */
1695 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
1696 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
1697 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =148 */
1698 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =149 */
1699 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =150 */
1700 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =151 */
1701 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =152 */
1702 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =153 */
1703 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =154 */
1704 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =155 */
1705 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =156 */
1706 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =157 */
1707 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =158 */
1708 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =159 */
1709 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1710 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =162 */
1711 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =163 */
1712 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =164 */
1713 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =165 */
1714 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =166 */
1715 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =167 */
1716 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =168 */
1717 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =169 */
1718 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =170 */
1719 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =171 */
1720 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =172 */
1721 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =173 */
1722 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =174 */
1723 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =175 */
1724 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* I =176:177 */
1725 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =178 */
1726 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =179 */
1727 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =180 */
1728 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =181 */
1729 (PID.TID 0000.0001) 2.842862532064524E+05, /* I =182 */
1730 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =183 */
1731 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =184 */
1732 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =185 */
1733 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =186 */
1734 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =187 */
1735 (PID.TID 0000.0001) 2.218350349844185E+05, /* I =188 */
1736 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =189 */
1737 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
1738 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
1739 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1740 (PID.TID 0000.0001) ;
1741 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( units: m ) */
1742 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1743 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
1744 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
1745 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
1746 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
1747 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
1748 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
1749 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
1750 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
1751 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
1752 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
1753 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
1754 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
1755 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
1756 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
1757 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
1758 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
1759 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
1760 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
1761 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
1762 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
1763 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
1764 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
1765 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
1766 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
1767 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
1768 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
1769 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
1770 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
1771 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
1772 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1773 (PID.TID 0000.0001) ;
1774 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( units: m ) */
1775 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1776 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
1777 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
1778 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 4 */
1779 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 5 */
1780 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 6 */
1781 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 7 */
1782 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 8 */
1783 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 9 */
1784 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 10 */
1785 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 11 */
1786 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 12 */
1787 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 13 */
1788 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 14 */
1789 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 15 */
1790 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 16: 17 */
1791 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 18 */
1792 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 19 */
1793 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 20 */
1794 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 21 */
1795 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 22 */
1796 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 23 */
1797 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 24 */
1798 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 25 */
1799 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 26 */
1800 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 27 */
1801 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 28 */
1802 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 29 */
1803 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 30 */
1804 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 31 */
1805 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1806 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 34 */
1807 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 35 */
1808 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 36 */
1809 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 37 */
1810 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 38 */
1811 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 39 */
1812 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 40 */
1813 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 41 */
1814 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 42 */
1815 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 43 */
1816 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 44 */
1817 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 45 */
1818 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
1819 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
1820 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 48: 49 */
1821 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
1822 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
1823 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 52 */
1824 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 53 */
1825 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 54 */
1826 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 55 */
1827 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 56 */
1828 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 57 */
1829 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 58 */
1830 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 59 */
1831 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 60 */
1832 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 61 */
1833 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 62 */
1834 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 63 */
1835 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1836 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 66 */
1837 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 67 */
1838 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 68 */
1839 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 69 */
1840 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 70 */
1841 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 71 */
1842 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 72 */
1843 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 73 */
1844 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 74 */
1845 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 75 */
1846 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 76 */
1847 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 77 */
1848 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 78 */
1849 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 79 */
1850 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 80: 81 */
1851 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 82 */
1852 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 83 */
1853 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 84 */
1854 (PID.TID 0000.0001) 2.900303768613599E+05, /* I = 85 */
1855 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 86 */
1856 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 87 */
1857 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 88 */
1858 (PID.TID 0000.0001) 2.599949918261881E+05, /* I = 89 */
1859 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 90 */
1860 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 91 */
1861 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 92 */
1862 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 93 */
1863 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
1864 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
1865 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1866 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
1867 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
1868 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =100 */
1869 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =101 */
1870 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =102 */
1871 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =103 */
1872 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =104 */
1873 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =105 */
1874 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =106 */
1875 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =107 */
1876 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =108 */
1877 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =109 */
1878 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =110 */
1879 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =111 */
1880 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =112:113 */
1881 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =114 */
1882 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =115 */
1883 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =116 */
1884 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =117 */
1885 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =118 */
1886 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =119 */
1887 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =120 */
1888 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =121 */
1889 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =122 */
1890 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =123 */
1891 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =124 */
1892 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =125 */
1893 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =126 */
1894 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =127 */
1895 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1896 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =130 */
1897 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =131 */
1898 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =132 */
1899 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =133 */
1900 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =134 */
1901 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =135 */
1902 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =136 */
1903 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =137 */
1904 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =138 */
1905 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =139 */
1906 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =140 */
1907 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =141 */
1908 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
1909 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
1910 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =144:145 */
1911 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
1912 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
1913 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =148 */
1914 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =149 */
1915 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =150 */
1916 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =151 */
1917 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =152 */
1918 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =153 */
1919 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =154 */
1920 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =155 */
1921 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =156 */
1922 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =157 */
1923 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =158 */
1924 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =159 */
1925 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1926 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =162 */
1927 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =163 */
1928 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =164 */
1929 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =165 */
1930 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =166 */
1931 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =167 */
1932 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =168 */
1933 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =169 */
1934 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =170 */
1935 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =171 */
1936 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =172 */
1937 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =173 */
1938 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =174 */
1939 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =175 */
1940 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =176:177 */
1941 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =178 */
1942 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =179 */
1943 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =180 */
1944 (PID.TID 0000.0001) 2.900303768613599E+05, /* I =181 */
1945 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =182 */
1946 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =183 */
1947 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =184 */
1948 (PID.TID 0000.0001) 2.599949918261881E+05, /* I =185 */
1949 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =186 */
1950 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =187 */
1951 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =188 */
1952 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =189 */
1953 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
1954 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
1955 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1956 (PID.TID 0000.0001) ;
1957 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( units: m ) */
1958 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1959 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
1960 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
1961 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
1962 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
1963 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
1964 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
1965 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
1966 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
1967 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
1968 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
1969 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
1970 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
1971 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
1972 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
1973 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
1974 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
1975 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
1976 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
1977 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
1978 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
1979 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
1980 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
1981 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
1982 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
1983 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
1984 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
1985 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
1986 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
1987 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
1988 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1989 (PID.TID 0000.0001) ;
1990 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( units: m ) */
1991 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1992 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
1993 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
1994 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 4 */
1995 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 5 */
1996 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 6 */
1997 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 7 */
1998 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 8 */
1999 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 9 */
2000 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 10 */
2001 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 11 */
2002 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 12 */
2003 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 13 */
2004 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 14 */
2005 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 15 */
2006 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 16: 17 */
2007 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 18 */
2008 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 19 */
2009 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 20 */
2010 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 21 */
2011 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 22 */
2012 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 23 */
2013 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 24 */
2014 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 25 */
2015 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 26 */
2016 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 27 */
2017 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 28 */
2018 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 29 */
2019 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 30 */
2020 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 31 */
2021 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 32: 33 */
2022 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 34 */
2023 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 35 */
2024 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 36 */
2025 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 37 */
2026 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 38 */
2027 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 39 */
2028 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 40 */
2029 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 41 */
2030 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 42 */
2031 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 43 */
2032 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 44 */
2033 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 45 */
2034 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
2035 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
2036 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 48: 49 */
2037 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
2038 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
2039 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 52 */
2040 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 53 */
2041 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 54 */
2042 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 55 */
2043 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 56 */
2044 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 57 */
2045 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 58 */
2046 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 59 */
2047 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 60 */
2048 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 61 */
2049 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 62 */
2050 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 63 */
2051 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 64: 65 */
2052 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 66 */
2053 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 67 */
2054 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 68 */
2055 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 69 */
2056 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 70 */
2057 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 71 */
2058 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 72 */
2059 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 73 */
2060 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 74 */
2061 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 75 */
2062 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 76 */
2063 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 77 */
2064 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 78 */
2065 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 79 */
2066 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 80: 81 */
2067 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 82 */
2068 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 83 */
2069 (PID.TID 0000.0001) 2.944035815526416E+05, /* I = 84 */
2070 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 85 */
2071 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 86 */
2072 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 87 */
2073 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 88 */
2074 (PID.TID 0000.0001) 2.597126963772147E+05, /* I = 89 */
2075 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 90 */
2076 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 91 */
2077 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 92 */
2078 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 93 */
2079 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
2080 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
2081 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 96: 97 */
2082 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
2083 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
2084 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =100 */
2085 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =101 */
2086 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =102 */
2087 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =103 */
2088 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =104 */
2089 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =105 */
2090 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =106 */
2091 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =107 */
2092 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =108 */
2093 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =109 */
2094 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =110 */
2095 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =111 */
2096 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =112:113 */
2097 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =114 */
2098 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =115 */
2099 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =116 */
2100 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =117 */
2101 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =118 */
2102 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =119 */
2103 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =120 */
2104 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =121 */
2105 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =122 */
2106 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =123 */
2107 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =124 */
2108 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =125 */
2109 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =126 */
2110 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =127 */
2111 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =128:129 */
2112 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =130 */
2113 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =131 */
2114 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =132 */
2115 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =133 */
2116 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =134 */
2117 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =135 */
2118 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =136 */
2119 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =137 */
2120 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =138 */
2121 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =139 */
2122 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =140 */
2123 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =141 */
2124 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
2125 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
2126 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =144:145 */
2127 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
2128 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
2129 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =148 */
2130 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =149 */
2131 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =150 */
2132 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =151 */
2133 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =152 */
2134 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =153 */
2135 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =154 */
2136 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =155 */
2137 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =156 */
2138 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =157 */
2139 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =158 */
2140 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =159 */
2141 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =160:161 */
2142 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =162 */
2143 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =163 */
2144 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =164 */
2145 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =165 */
2146 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =166 */
2147 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =167 */
2148 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =168 */
2149 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =169 */
2150 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =170 */
2151 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =171 */
2152 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =172 */
2153 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =173 */
2154 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =174 */
2155 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =175 */
2156 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =176:177 */
2157 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =178 */
2158 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =179 */
2159 (PID.TID 0000.0001) 2.944035815526416E+05, /* I =180 */
2160 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =181 */
2161 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =182 */
2162 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =183 */
2163 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =184 */
2164 (PID.TID 0000.0001) 2.597126963772147E+05, /* I =185 */
2165 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =186 */
2166 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =187 */
2167 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =188 */
2168 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =189 */
2169 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
2170 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
2171 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
2172 (PID.TID 0000.0001) ;
2173 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( units: m ) */
2174 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2175 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
2176 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
2177 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
2178 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
2179 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
2180 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
2181 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
2182 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
2183 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
2184 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
2185 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
2186 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
2187 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
2188 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
2189 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
2190 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
2191 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
2192 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
2193 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
2194 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
2195 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
2196 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
2197 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
2198 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
2199 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
2200 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
2201 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
2202 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
2203 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
2204 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
2205 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
2206 (PID.TID 0000.0001) ;
2207 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( units: m ) */
2208 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2209 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
2210 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
2211 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 4 */
2212 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 5 */
2213 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 6 */
2214 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 7 */
2215 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 8 */
2216 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 9 */
2217 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 10 */
2218 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 11 */
2219 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 12 */
2220 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 13 */
2221 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 14 */
2222 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 15 */
2223 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 16 */
2224 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 17 */
2225 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 18 */
2226 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 19 */
2227 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 20 */
2228 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 21 */
2229 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 22 */
2230 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 23 */
2231 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 24 */
2232 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 25 */
2233 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 26 */
2234 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 27 */
2235 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 28 */
2236 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 29 */
2237 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 30 */
2238 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 31 */
2239 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 32 */
2240 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 33 */
2241 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 34 */
2242 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 35 */
2243 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 36 */
2244 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 37 */
2245 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 38 */
2246 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 39 */
2247 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 40 */
2248 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 41 */
2249 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 42 */
2250 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 43 */
2251 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 44 */
2252 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 45 */
2253 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
2254 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
2255 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
2256 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
2257 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
2258 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
2259 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 52 */
2260 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 53 */
2261 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 54 */
2262 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 55 */
2263 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 56 */
2264 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 57 */
2265 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 58 */
2266 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 59 */
2267 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 60 */
2268 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 61 */
2269 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 62 */
2270 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 63 */
2271 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 64 */
2272 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 65 */
2273 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 66 */
2274 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 67 */
2275 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 68 */
2276 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 69 */
2277 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 70 */
2278 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 71 */
2279 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 72 */
2280 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 73 */
2281 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 74 */
2282 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 75 */
2283 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 76 */
2284 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 77 */
2285 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 78 */
2286 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 79 */
2287 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 80 */
2288 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 81 */
2289 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 82 */
2290 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 83 */
2291 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 84 */
2292 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 85 */
2293 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 86 */
2294 (PID.TID 0000.0001) 2.810845823202647E+05, /* I = 87 */
2295 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 88 */
2296 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 89 */
2297 (PID.TID 0000.0001) 2.547526806712889E+05, /* I = 90 */
2298 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 91 */
2299 (PID.TID 0000.0001) 2.295958105911512E+05, /* I = 92 */
2300 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 93 */
2301 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
2302 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
2303 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
2304 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
2305 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
2306 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
2307 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =100 */
2308 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =101 */
2309 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =102 */
2310 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =103 */
2311 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =104 */
2312 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =105 */
2313 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =106 */
2314 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =107 */
2315 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =108 */
2316 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =109 */
2317 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =110 */
2318 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =111 */
2319 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =112 */
2320 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =113 */
2321 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =114 */
2322 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =115 */
2323 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =116 */
2324 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =117 */
2325 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =118 */
2326 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =119 */
2327 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =120 */
2328 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =121 */
2329 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =122 */
2330 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =123 */
2331 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =124 */
2332 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =125 */
2333 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =126 */
2334 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =127 */
2335 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =128 */
2336 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =129 */
2337 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =130 */
2338 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =131 */
2339 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =132 */
2340 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =133 */
2341 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =134 */
2342 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =135 */
2343 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =136 */
2344 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =137 */
2345 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =138 */
2346 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =139 */
2347 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =140 */
2348 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =141 */
2349 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
2350 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
2351 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
2352 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
2353 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
2354 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
2355 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =148 */
2356 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =149 */
2357 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =150 */
2358 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =151 */
2359 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =152 */
2360 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =153 */
2361 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =154 */
2362 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =155 */
2363 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =156 */
2364 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =157 */
2365 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =158 */
2366 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =159 */
2367 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =160 */
2368 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =161 */
2369 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =162 */
2370 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =163 */
2371 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =164 */
2372 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =165 */
2373 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =166 */
2374 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =167 */
2375 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =168 */
2376 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =169 */
2377 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =170 */
2378 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =171 */
2379 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =172 */
2380 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =173 */
2381 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =174 */
2382 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =175 */
2383 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =176 */
2384 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =177 */
2385 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =178 */
2386 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =179 */
2387 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =180 */
2388 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =181 */
2389 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =182 */
2390 (PID.TID 0000.0001) 2.810845823202647E+05, /* I =183 */
2391 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =184 */
2392 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =185 */
2393 (PID.TID 0000.0001) 2.547526806712889E+05, /* I =186 */
2394 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =187 */
2395 (PID.TID 0000.0001) 2.295958105911512E+05, /* I =188 */
2396 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =189 */
2397 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
2398 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
2399 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
2400 (PID.TID 0000.0001) ;
2401 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( units: m ) */
2402 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2403 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
2404 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
2405 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
2406 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
2407 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
2408 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
2409 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
2410 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
2411 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
2412 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
2413 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
2414 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
2415 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
2416 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
2417 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
2418 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
2419 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
2420 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
2421 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
2422 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
2423 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
2424 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
2425 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
2426 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
2427 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
2428 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
2429 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
2430 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
2431 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
2432 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
2433 (PID.TID 0000.0001) ;
2434 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( units: m ) */
2435 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2436 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
2437 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
2438 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 4 */
2439 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 5 */
2440 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 6 */
2441 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 7 */
2442 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 8 */
2443 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 9 */
2444 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 10 */
2445 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 11 */
2446 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 12 */
2447 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 13 */
2448 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 14 */
2449 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 15 */
2450 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 16 */
2451 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 17 */
2452 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 18 */
2453 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 19 */
2454 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 20 */
2455 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 21 */
2456 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 22 */
2457 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 23 */
2458 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 24 */
2459 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 25 */
2460 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 26 */
2461 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 27 */
2462 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 28 */
2463 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 29 */
2464 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 30 */
2465 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 31 */
2466 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 32 */
2467 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 33 */
2468 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 34 */
2469 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 35 */
2470 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 36 */
2471 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 37 */
2472 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 38 */
2473 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 39 */
2474 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 40 */
2475 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 41 */
2476 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 42 */
2477 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 43 */
2478 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 44 */
2479 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 45 */
2480 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
2481 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
2482 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
2483 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
2484 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
2485 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
2486 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 52 */
2487 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 53 */
2488 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 54 */
2489 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 55 */
2490 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 56 */
2491 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 57 */
2492 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 58 */
2493 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 59 */
2494 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 60 */
2495 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 61 */
2496 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 62 */
2497 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 63 */
2498 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 64 */
2499 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 65 */
2500 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 66 */
2501 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 67 */
2502 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 68 */
2503 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 69 */
2504 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 70 */
2505 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 71 */
2506 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 72 */
2507 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 73 */
2508 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 74 */
2509 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 75 */
2510 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 76 */
2511 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 77 */
2512 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 78 */
2513 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 79 */
2514 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 80 */
2515 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 81 */
2516 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 82 */
2517 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 83 */
2518 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 84 */
2519 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 85 */
2520 (PID.TID 0000.0001) 2.872689479506990E+05, /* I = 86 */
2521 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 87 */
2522 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 88 */
2523 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 89 */
2524 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 90 */
2525 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 91 */
2526 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 92 */
2527 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 93 */
2528 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
2529 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
2530 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
2531 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
2532 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
2533 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
2534 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =100 */
2535 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =101 */
2536 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =102 */
2537 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =103 */
2538 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =104 */
2539 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =105 */
2540 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =106 */
2541 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =107 */
2542 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =108 */
2543 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =109 */
2544 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =110 */
2545 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =111 */
2546 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =112 */
2547 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =113 */
2548 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =114 */
2549 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =115 */
2550 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =116 */
2551 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =117 */
2552 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =118 */
2553 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =119 */
2554 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =120 */
2555 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =121 */
2556 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =122 */
2557 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =123 */
2558 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =124 */
2559 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =125 */
2560 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =126 */
2561 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =127 */
2562 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =128 */
2563 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =129 */
2564 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =130 */
2565 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =131 */
2566 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =132 */
2567 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =133 */
2568 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =134 */
2569 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =135 */
2570 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =136 */
2571 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =137 */
2572 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =138 */
2573 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =139 */
2574 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =140 */
2575 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =141 */
2576 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
2577 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
2578 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
2579 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
2580 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
2581 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
2582 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =148 */
2583 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =149 */
2584 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =150 */
2585 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =151 */
2586 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =152 */
2587 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =153 */
2588 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =154 */
2589 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =155 */
2590 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =156 */
2591 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =157 */
2592 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =158 */
2593 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =159 */
2594 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =160 */
2595 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =161 */
2596 (PID.TID 0000.0001) 1.391343389937106E+05, /* I =162 */
2597 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =163 */
2598 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =164 */
2599 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =165 */
2600 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =166 */
2601 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =167 */
2602 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =168 */
2603 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =169 */
2604 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =170 */
2605 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =171 */
2606 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =172 */
2607 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =173 */
2608 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =174 */
2609 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =175 */
2610 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =176 */
2611 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =177 */
2612 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =178 */
2613 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =179 */
2614 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =180 */
2615 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =181 */
2616 (PID.TID 0000.0001) 2.872689479506990E+05, /* I =182 */
2617 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =183 */
2618 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =184 */
2619 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =185 */
2620 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =186 */
2621 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =187 */
2622 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =188 */
2623 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =189 */
2624 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
2625 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
2626 (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
2627 (PID.TID 0000.0001) ;
2628 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( units: m ) */
2629 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2630 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
2631 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
2632 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
2633 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
2634 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
2635 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
2636 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
2637 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
2638 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
2639 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
2640 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
2641 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
2642 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
2643 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
2644 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
2645 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
2646 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
2647 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
2648 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
2649 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
2650 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
2651 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
2652 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
2653 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
2654 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
2655 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
2656 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
2657 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
2658 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
2659 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
2660 (PID.TID 0000.0001) ;
2661 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( units: m ) */
2662 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2663 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
2664 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
2665 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 4 */
2666 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 5 */
2667 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 6 */
2668 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 7 */
2669 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 8 */
2670 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 9 */
2671 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 10 */
2672 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 11 */
2673 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 12 */
2674 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 13 */
2675 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 14 */
2676 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 15 */
2677 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 16: 17 */
2678 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 18 */
2679 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 19 */
2680 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 20 */
2681 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 21 */
2682 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 22 */
2683 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 23 */
2684 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 24 */
2685 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 25 */
2686 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 26 */
2687 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 27 */
2688 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 28 */
2689 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 29 */
2690 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 30 */
2691 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 31 */
2692 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 32: 33 */
2693 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 34 */
2694 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 35 */
2695 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 36 */
2696 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 37 */
2697 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 38 */
2698 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 39 */
2699 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 40 */
2700 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 41 */
2701 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 42 */
2702 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 43 */
2703 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 44 */
2704 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 45 */
2705 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
2706 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
2707 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 48: 49 */
2708 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
2709 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
2710 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 52 */
2711 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 53 */
2712 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 54 */
2713 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 55 */
2714 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 56 */
2715 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 57 */
2716 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 58 */
2717 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 59 */
2718 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 60 */
2719 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 61 */
2720 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 62 */
2721 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 63 */
2722 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 64: 65 */
2723 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 66 */
2724 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 67 */
2725 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 68 */
2726 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 69 */
2727 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 70 */
2728 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 71 */
2729 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 72 */
2730 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 73 */
2731 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 74 */
2732 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 75 */
2733 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 76 */
2734 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 77 */
2735 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 78 */
2736 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 79 */
2737 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 80: 81 */
2738 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 82 */
2739 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 83 */
2740 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 84 */
2741 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 85 */
2742 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 86 */
2743 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 87 */
2744 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 88 */
2745 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 89 */
2746 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 90 */
2747 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 91 */
2748 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 92 */
2749 (PID.TID 0000.0001) 2.042717761866506E+05, /* I = 93 */
2750 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
2751 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
2752 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 96: 97 */
2753 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
2754 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
2755 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =100 */
2756 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =101 */
2757 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =102 */
2758 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =103 */
2759 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =104 */
2760 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =105 */
2761 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =106 */
2762 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =107 */
2763 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =108 */
2764 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =109 */
2765 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =110 */
2766 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =111 */
2767 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =112:113 */
2768 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =114 */
2769 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =115 */
2770 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =116 */
2771 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =117 */
2772 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =118 */
2773 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =119 */
2774 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =120 */
2775 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =121 */
2776 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =122 */
2777 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =123 */
2778 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =124 */
2779 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =125 */
2780 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =126 */
2781 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =127 */
2782 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =128:129 */
2783 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =130 */
2784 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =131 */
2785 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =132 */
2786 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =133 */
2787 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =134 */
2788 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =135 */
2789 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =136 */
2790 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =137 */
2791 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =138 */
2792 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =139 */
2793 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =140 */
2794 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =141 */
2795 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
2796 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
2797 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =144:145 */
2798 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
2799 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
2800 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =148 */
2801 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =149 */
2802 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =150 */
2803 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =151 */
2804 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =152 */
2805 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =153 */
2806 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =154 */
2807 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =155 */
2808 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =156 */
2809 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =157 */
2810 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =158 */
2811 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =159 */
2812 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =160:161 */
2813 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =162 */
2814 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =163 */
2815 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =164 */
2816 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =165 */
2817 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =166 */
2818 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =167 */
2819 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =168 */
2820 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =169 */
2821 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =170 */
2822 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =171 */
2823 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =172 */
2824 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =173 */
2825 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =174 */
2826 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =175 */
2827 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =176:177 */
2828 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =178 */
2829 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =179 */
2830 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =180 */
2831 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =181 */
2832 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =182 */
2833 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =183 */
2834 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =184 */
2835 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =185 */
2836 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =186 */
2837 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =187 */
2838 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =188 */
2839 (PID.TID 0000.0001) 2.042717761866506E+05, /* I =189 */
2840 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
2841 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
2842 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
2843 (PID.TID 0000.0001) ;
2844 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( units: m ) */
2845 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2846 (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
2847 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
2848 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
2849 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
2850 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
2851 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
2852 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
2853 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
2854 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
2855 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
2856 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
2857 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
2858 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
2859 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
2860 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
2861 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
2862 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
2863 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
2864 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
2865 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
2866 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
2867 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
2868 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
2869 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
2870 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
2871 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
2872 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
2873 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
2874 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
2875 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
2876 (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
2877 (PID.TID 0000.0001) ;
2878 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( units: m ) */
2879 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
2880 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
2881 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
2882 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 4 */
2883 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 5 */
2884 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 6 */
2885 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 7 */
2886 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 8 */
2887 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 9 */
2888 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 10 */
2889 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 11 */
2890 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 12 */
2891 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 13 */
2892 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 14 */
2893 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 15 */
2894 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 16 */
2895 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 17 */
2896 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 18 */
2897 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 19 */
2898 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 20 */
2899 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 21 */
2900 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 22 */
2901 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 23 */
2902 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 24 */
2903 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 25 */
2904 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 26 */
2905 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 27 */
2906 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 28 */
2907 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 29 */
2908 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 30 */
2909 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 31 */
2910 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 32 */
2911 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
2912 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 34 */
2913 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 35 */
2914 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 36 */
2915 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 37 */
2916 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 38 */
2917 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 39 */
2918 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 40 */
2919 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 41 */
2920 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 42 */
2921 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 43 */
2922 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 44 */
2923 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 45 */
2924 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
2925 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
2926 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
2927 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
2928 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
2929 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
2930 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 52 */
2931 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 53 */
2932 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 54 */
2933 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 55 */
2934 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 56 */
2935 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 57 */
2936 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 58 */
2937 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 59 */
2938 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 60 */
2939 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 61 */
2940 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 62 */
2941 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 63 */
2942 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 64 */
2943 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
2944 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 66 */
2945 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 67 */
2946 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 68 */
2947 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 69 */
2948 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 70 */
2949 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 71 */
2950 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 72 */
2951 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 73 */
2952 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 74 */
2953 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 75 */
2954 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 76 */
2955 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 77 */
2956 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 78 */
2957 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 79 */
2958 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 80 */
2959 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 81 */
2960 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 82 */
2961 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 83 */
2962 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 84 */
2963 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 85 */
2964 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 86 */
2965 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 87 */
2966 (PID.TID 0000.0001) 2.734046499619031E+05, /* I = 88 */
2967 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 89 */
2968 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 90 */
2969 (PID.TID 0000.0001) 2.426774358027003E+05, /* I = 91 */
2970 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 92 */
2971 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 93 */
2972 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
2973 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
2974 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
2975 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
2976 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
2977 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
2978 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =100 */
2979 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =101 */
2980 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =102 */
2981 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =103 */
2982 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =104 */
2983 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =105 */
2984 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =106 */
2985 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =107 */
2986 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =108 */
2987 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =109 */
2988 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =110 */
2989 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =111 */
2990 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =112 */
2991 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =113 */
2992 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =114 */
2993 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =115 */
2994 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =116 */
2995 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =117 */
2996 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =118 */
2997 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =119 */
2998 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =120 */
2999 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =121 */
3000 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =122 */
3001 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =123 */
3002 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =124 */
3003 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =125 */
3004 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =126 */
3005 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =127 */
3006 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =128 */
3007 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3008 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =130 */
3009 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =131 */
3010 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =132 */
3011 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =133 */
3012 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =134 */
3013 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =135 */
3014 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =136 */
3015 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =137 */
3016 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =138 */
3017 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =139 */
3018 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =140 */
3019 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =141 */
3020 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
3021 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
3022 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
3023 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
3024 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
3025 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
3026 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =148 */
3027 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =149 */
3028 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =150 */
3029 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =151 */
3030 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =152 */
3031 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =153 */
3032 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =154 */
3033 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =155 */
3034 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =156 */
3035 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =157 */
3036 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =158 */
3037 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =159 */
3038 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =160 */
3039 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3040 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =162 */
3041 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =163 */
3042 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =164 */
3043 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =165 */
3044 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =166 */
3045 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =167 */
3046 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =168 */
3047 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =169 */
3048 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =170 */
3049 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =171 */
3050 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =172 */
3051 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =173 */
3052 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =174 */
3053 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =175 */
3054 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =176 */
3055 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =177 */
3056 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =178 */
3057 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =179 */
3058 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =180 */
3059 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =181 */
3060 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =182 */
3061 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =183 */
3062 (PID.TID 0000.0001) 2.734046499619031E+05, /* I =184 */
3063 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =185 */
3064 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =186 */
3065 (PID.TID 0000.0001) 2.426774358027003E+05, /* I =187 */
3066 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =188 */
3067 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =189 */
3068 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
3069 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
3070 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
3071 (PID.TID 0000.0001) ;
3072 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( units: m ) */
3073 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3074 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
3075 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
3076 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
3077 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
3078 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
3079 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
3080 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
3081 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
3082 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
3083 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
3084 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
3085 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
3086 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
3087 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
3088 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
3089 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
3090 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
3091 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
3092 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
3093 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
3094 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
3095 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
3096 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
3097 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
3098 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
3099 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
3100 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
3101 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
3102 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
3103 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
3104 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
3105 (PID.TID 0000.0001) ;
3106 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( units: m ) */
3107 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
3108 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
3109 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
3110 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 4 */
3111 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 5 */
3112 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 6 */
3113 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 7 */
3114 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 8 */
3115 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 9 */
3116 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 10 */
3117 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 11 */
3118 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 12 */
3119 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 13 */
3120 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 14 */
3121 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 15 */
3122 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 16 */
3123 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 17 */
3124 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 18 */
3125 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 19 */
3126 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 20 */
3127 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 21 */
3128 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 22 */
3129 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 23 */
3130 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 24 */
3131 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 25 */
3132 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 26 */
3133 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 27 */
3134 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 28 */
3135 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 29 */
3136 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 30 */
3137 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 31 */
3138 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 32 */
3139 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
3140 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 34 */
3141 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 35 */
3142 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 36 */
3143 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 37 */
3144 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 38 */
3145 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 39 */
3146 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 40 */
3147 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 41 */
3148 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 42 */
3149 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 43 */
3150 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 44 */
3151 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 45 */
3152 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
3153 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
3154 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
3155 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
3156 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
3157 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
3158 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 52 */
3159 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 53 */
3160 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 54 */
3161 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 55 */
3162 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 56 */
3163 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 57 */
3164 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 58 */
3165 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 59 */
3166 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 60 */
3167 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 61 */
3168 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 62 */
3169 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 63 */
3170 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 64 */
3171 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3172 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 66 */
3173 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 67 */
3174 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 68 */
3175 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 69 */
3176 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 70 */
3177 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 71 */
3178 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 72 */
3179 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 73 */
3180 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 74 */
3181 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 75 */
3182 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 76 */
3183 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 77 */
3184 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 78 */
3185 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 79 */
3186 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 80 */
3187 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 81 */
3188 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 82 */
3189 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 83 */
3190 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 84 */
3191 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 85 */
3192 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 86 */
3193 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 87 */
3194 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 88 */
3195 (PID.TID 0000.0001) 2.647274964828301E+05, /* I = 89 */
3196 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 90 */
3197 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 91 */
3198 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 92 */
3199 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 93 */
3200 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
3201 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
3202 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
3203 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3204 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
3205 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
3206 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =100 */
3207 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =101 */
3208 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =102 */
3209 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =103 */
3210 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =104 */
3211 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =105 */
3212 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =106 */
3213 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =107 */
3214 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =108 */
3215 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =109 */
3216 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =110 */
3217 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =111 */
3218 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =112 */
3219 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =113 */
3220 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =114 */
3221 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =115 */
3222 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =116 */
3223 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =117 */
3224 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =118 */
3225 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =119 */
3226 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =120 */
3227 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =121 */
3228 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =122 */
3229 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =123 */
3230 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =124 */
3231 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =125 */
3232 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =126 */
3233 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =127 */
3234 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =128 */
3235 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3236 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =130 */
3237 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =131 */
3238 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =132 */
3239 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =133 */
3240 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =134 */
3241 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =135 */
3242 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =136 */
3243 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =137 */
3244 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =138 */
3245 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =139 */
3246 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =140 */
3247 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =141 */
3248 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
3249 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
3250 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
3251 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
3252 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
3253 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
3254 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =148 */
3255 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =149 */
3256 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =150 */
3257 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =151 */
3258 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =152 */
3259 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =153 */
3260 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =154 */
3261 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =155 */
3262 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =156 */
3263 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =157 */
3264 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =158 */
3265 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =159 */
3266 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =160 */
3267 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3268 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =162 */
3269 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =163 */
3270 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =164 */
3271 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =165 */
3272 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =166 */
3273 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =167 */
3274 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =168 */
3275 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =169 */
3276 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =170 */
3277 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =171 */
3278 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =172 */
3279 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =173 */
3280 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =174 */
3281 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =175 */
3282 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =176 */
3283 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =177 */
3284 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =178 */
3285 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =179 */
3286 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =180 */
3287 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =181 */
3288 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =182 */
3289 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =183 */
3290 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =184 */
3291 (PID.TID 0000.0001) 2.647274964828301E+05, /* I =185 */
3292 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =186 */
3293 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =187 */
3294 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =188 */
3295 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =189 */
3296 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
3297 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
3298 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
3299 (PID.TID 0000.0001) ;
3300 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( units: m ) */
3301 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3302 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
3303 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
3304 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 4 */
3305 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
3306 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
3307 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 7 */
3308 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
3309 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
3310 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 10 */
3311 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
3312 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
3313 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
3314 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
3315 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
3316 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
3317 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
3318 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
3319 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
3320 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
3321 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
3322 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
3323 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
3324 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 24 */
3325 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
3326 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
3327 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 27 */
3328 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
3329 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
3330 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 30 */
3331 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
3332 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
3333 (PID.TID 0000.0001) ;
3334 (PID.TID 0000.0001) rA = /* rA (:,1,:,1) ( units: m^2 ) */
3335 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
3336 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
3337 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
3338 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 4 */
3339 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 5 */
3340 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 6 */
3341 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 7 */
3342 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 8 */
3343 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 9 */
3344 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 10 */
3345 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 11 */
3346 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 12 */
3347 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 13 */
3348 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 14 */
3349 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 15 */
3350 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 16 */
3351 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 17 */
3352 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 18 */
3353 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 19 */
3354 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 20 */
3355 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 21 */
3356 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 22 */
3357 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 23 */
3358 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 24 */
3359 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 25 */
3360 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 26 */
3361 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 27 */
3362 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 28 */
3363 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 29 */
3364 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 30 */
3365 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 31 */
3366 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 32 */
3367 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 33 */
3368 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 34 */
3369 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 35 */
3370 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 36 */
3371 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 37 */
3372 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 38 */
3373 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 39 */
3374 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 40 */
3375 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 41 */
3376 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 42 */
3377 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 43 */
3378 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 44 */
3379 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 45 */
3380 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 46 */
3381 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 47 */
3382 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 48 */
3383 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 49 */
3384 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
3385 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 51 */
3386 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 52 */
3387 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 53 */
3388 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 54 */
3389 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 55 */
3390 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 56 */
3391 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 57 */
3392 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 58 */
3393 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 59 */
3394 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 60 */
3395 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 61 */
3396 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 62 */
3397 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 63 */
3398 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 64 */
3399 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 65 */
3400 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 66 */
3401 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 67 */
3402 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 68 */
3403 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 69 */
3404 (PID.TID 0000.0001) 5.594154126607553E+10, /* I = 70 */
3405 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 71 */
3406 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 72 */
3407 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 73 */
3408 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 74 */
3409 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 75 */
3410 (PID.TID 0000.0001) 8.410423102796223E+10, /* I = 76 */
3411 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 77 */
3412 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 78 */
3413 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 79 */
3414 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 80 */
3415 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 81 */
3416 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 82 */
3417 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 83 */
3418 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 84 */
3419 (PID.TID 0000.0001) 8.410423102799828E+10, /* I = 85 */
3420 (PID.TID 0000.0001) 8.084683449728902E+10, /* I = 86 */
3421 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 87 */
3422 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 88 */
3423 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 89 */
3424 (PID.TID 0000.0001) 6.203683527772523E+10, /* I = 90 */
3425 (PID.TID 0000.0001) 5.594154126611156E+10, /* I = 91 */
3426 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 92 */
3427 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 93 */
3428 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
3429 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
3430 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
3431 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
3432 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
3433 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
3434 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =100 */
3435 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =101 */
3436 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =102 */
3437 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =103 */
3438 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =104 */
3439 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =105 */
3440 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =106 */
3441 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =107 */
3442 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =108 */
3443 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =109 */
3444 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =110 */
3445 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =111 */
3446 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =112 */
3447 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =113 */
3448 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =114 */
3449 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =115 */
3450 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =116 */
3451 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =117 */
3452 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =118 */
3453 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =119 */
3454 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =120 */
3455 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =121 */
3456 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =122 */
3457 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =123 */
3458 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =124 */
3459 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =125 */
3460 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =126 */
3461 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =127 */
3462 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =128 */
3463 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =129 */
3464 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =130 */
3465 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =131 */
3466 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =132 */
3467 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =133 */
3468 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =134 */
3469 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =135 */
3470 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =136 */
3471 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =137 */
3472 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =138 */
3473 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =139 */
3474 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =140 */
3475 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =141 */
3476 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =142 */
3477 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =143 */
3478 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =144 */
3479 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =145 */
3480 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
3481 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =147 */
3482 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =148 */
3483 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =149 */
3484 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =150 */
3485 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =151 */
3486 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =152 */
3487 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =153 */
3488 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =154 */
3489 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =155 */
3490 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =156 */
3491 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =157 */
3492 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =158 */
3493 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =159 */
3494 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =160 */
3495 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =161 */
3496 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =162 */
3497 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =163 */
3498 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =164 */
3499 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =165 */
3500 (PID.TID 0000.0001) 5.594154126607553E+10, /* I =166 */
3501 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =167 */
3502 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =168 */
3503 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =169 */
3504 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =170 */
3505 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =171 */
3506 (PID.TID 0000.0001) 8.410423102796223E+10, /* I =172 */
3507 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =173 */
3508 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =174 */
3509 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =175 */
3510 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =176 */
3511 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =177 */
3512 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =178 */
3513 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =179 */
3514 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =180 */
3515 (PID.TID 0000.0001) 8.410423102799828E+10, /* I =181 */
3516 (PID.TID 0000.0001) 8.084683449728902E+10, /* I =182 */
3517 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =183 */
3518 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =184 */
3519 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =185 */
3520 (PID.TID 0000.0001) 6.203683527772523E+10, /* I =186 */
3521 (PID.TID 0000.0001) 5.594154126611156E+10, /* I =187 */
3522 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =188 */
3523 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =189 */
3524 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
3525 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
3526 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
3527 (PID.TID 0000.0001) ;
3528 (PID.TID 0000.0001) rA = /* rA (1,:,1,:) ( units: m^2 ) */
3529 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
3530 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
3531 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
3532 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
3533 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
3534 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 6 */
3535 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
3536 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
3537 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
3538 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
3539 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 11 */
3540 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 12 */
3541 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
3542 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 14 */
3543 (PID.TID 0000.0001) 9.008620045350865E+10, /* J = 15 */
3544 (PID.TID 0000.0001) 9.076111290418457E+10, /* J = 16 */
3545 (PID.TID 0000.0001) 9.076111290422060E+10, /* J = 17 */
3546 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
3547 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 19 */
3548 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
3549 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 21 */
3550 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 22 */
3551 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
3552 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
3553 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
3554 (PID.TID 0000.0001) 6.203683527772523E+10, /* J = 26 */
3555 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 27 */
3556 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
3557 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
3558 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
3559 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
3560 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
3561 (PID.TID 0000.0001) ;
3562 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( units: m^2 ) */
3563 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3564 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
3565 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
3566 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 4 */
3567 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 5 */
3568 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 6 */
3569 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 7 */
3570 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 8 */
3571 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 9 */
3572 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 10 */
3573 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 11 */
3574 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 12 */
3575 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 13 */
3576 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 14 */
3577 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 15 */
3578 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 16 */
3579 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 17 */
3580 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 18 */
3581 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 19 */
3582 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 20 */
3583 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 21 */
3584 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 22 */
3585 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 23 */
3586 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 24 */
3587 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 25 */
3588 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 26 */
3589 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 27 */
3590 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 28 */
3591 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 29 */
3592 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 30 */
3593 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 31 */
3594 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 32 */
3595 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 33 */
3596 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 34 */
3597 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 35 */
3598 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 36 */
3599 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 37 */
3600 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 38 */
3601 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 39 */
3602 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 40 */
3603 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 41 */
3604 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 42 */
3605 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 43 */
3606 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 44 */
3607 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 45 */
3608 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
3609 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 47 */
3610 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
3611 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
3612 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 50 */
3613 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
3614 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 52 */
3615 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 53 */
3616 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 54 */
3617 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 55 */
3618 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 56 */
3619 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 57 */
3620 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 58 */
3621 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 59 */
3622 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 60 */
3623 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 61 */
3624 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 62 */
3625 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 63 */
3626 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 64 */
3627 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 65 */
3628 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 66 */
3629 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 67 */
3630 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 68 */
3631 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 69 */
3632 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 70 */
3633 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 71 */
3634 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 72 */
3635 (PID.TID 0000.0001) 7.014205907741882E+10, /* I = 73 */
3636 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 74 */
3637 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 75 */
3638 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 76 */
3639 (PID.TID 0000.0001) 8.549360686473492E+10, /* I = 77 */
3640 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 78 */
3641 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 79 */
3642 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 80 */
3643 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 81 */
3644 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 82 */
3645 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 83 */
3646 (PID.TID 0000.0001) 8.781353403174185E+10, /* I = 84 */
3647 (PID.TID 0000.0001) 8.549360686467184E+10, /* I = 85 */
3648 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 86 */
3649 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 87 */
3650 (PID.TID 0000.0001) 7.484854821844795E+10, /* I = 88 */
3651 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 89 */
3652 (PID.TID 0000.0001) 6.488320895111514E+10, /* I = 90 */
3653 (PID.TID 0000.0001) 5.907428494299063E+10, /* I = 91 */
3654 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 92 */
3655 (PID.TID 0000.0001) 4.571243814190767E+10, /* I = 93 */
3656 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
3657 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
3658 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
3659 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
3660 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
3661 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
3662 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =100 */
3663 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =101 */
3664 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =102 */
3665 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =103 */
3666 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =104 */
3667 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =105 */
3668 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =106 */
3669 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =107 */
3670 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =108 */
3671 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =109 */
3672 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =110 */
3673 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =111 */
3674 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =112 */
3675 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =113 */
3676 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =114 */
3677 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =115 */
3678 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =116 */
3679 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =117 */
3680 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =118 */
3681 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =119 */
3682 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =120 */
3683 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =121 */
3684 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =122 */
3685 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =123 */
3686 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =124 */
3687 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =125 */
3688 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =126 */
3689 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =127 */
3690 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =128 */
3691 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =129 */
3692 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =130 */
3693 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =131 */
3694 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =132 */
3695 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =133 */
3696 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =134 */
3697 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =135 */
3698 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =136 */
3699 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =137 */
3700 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =138 */
3701 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =139 */
3702 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =140 */
3703 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =141 */
3704 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
3705 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =143 */
3706 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
3707 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
3708 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =146 */
3709 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
3710 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =148 */
3711 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =149 */
3712 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =150 */
3713 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =151 */
3714 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =152 */
3715 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =153 */
3716 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =154 */
3717 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =155 */
3718 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =156 */
3719 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =157 */
3720 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =158 */
3721 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =159 */
3722 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =160 */
3723 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =161 */
3724 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =162 */
3725 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =163 */
3726 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =164 */
3727 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =165 */
3728 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =166 */
3729 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =167 */
3730 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =168 */
3731 (PID.TID 0000.0001) 7.014205907741882E+10, /* I =169 */
3732 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =170 */
3733 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =171 */
3734 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =172 */
3735 (PID.TID 0000.0001) 8.549360686473492E+10, /* I =173 */
3736 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =174 */
3737 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =175 */
3738 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =176 */
3739 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =177 */
3740 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =178 */
3741 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =179 */
3742 (PID.TID 0000.0001) 8.781353403174185E+10, /* I =180 */
3743 (PID.TID 0000.0001) 8.549360686467184E+10, /* I =181 */
3744 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =182 */
3745 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =183 */
3746 (PID.TID 0000.0001) 7.484854821844795E+10, /* I =184 */
3747 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =185 */
3748 (PID.TID 0000.0001) 6.488320895111514E+10, /* I =186 */
3749 (PID.TID 0000.0001) 5.907428494299063E+10, /* I =187 */
3750 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =188 */
3751 (PID.TID 0000.0001) 4.571243814190767E+10, /* I =189 */
3752 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
3753 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
3754 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
3755 (PID.TID 0000.0001) ;
3756 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( units: m^2 ) */
3757 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3758 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
3759 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
3760 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
3761 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 5 */
3762 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 6 */
3763 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 7 */
3764 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
3765 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 9 */
3766 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
3767 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 11 */
3768 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
3769 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 13 */
3770 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 14 */
3771 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
3772 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* J = 16: 17 */
3773 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
3774 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 19 */
3775 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 20 */
3776 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
3777 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 22 */
3778 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
3779 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 24 */
3780 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
3781 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 26 */
3782 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 27 */
3783 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 28 */
3784 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
3785 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
3786 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
3787 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
3788 (PID.TID 0000.0001) ;
3789 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( units: m^2 ) */
3790 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3791 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
3792 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
3793 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 4 */
3794 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 5 */
3795 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 6 */
3796 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 7 */
3797 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 8 */
3798 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 9 */
3799 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 10 */
3800 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 11 */
3801 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 12 */
3802 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 13 */
3803 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 14 */
3804 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 15 */
3805 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 16: 17 */
3806 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 18 */
3807 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 19 */
3808 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 20 */
3809 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 21 */
3810 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 22 */
3811 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 23 */
3812 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 24 */
3813 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 25 */
3814 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 26 */
3815 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 27 */
3816 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 28 */
3817 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 29 */
3818 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 30 */
3819 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 31 */
3820 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 32: 33 */
3821 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 34 */
3822 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 35 */
3823 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 36 */
3824 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 37 */
3825 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 38 */
3826 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 39 */
3827 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 40 */
3828 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 41 */
3829 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 42 */
3830 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 43 */
3831 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 44 */
3832 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 45 */
3833 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 46 */
3834 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
3835 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 48: 49 */
3836 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
3837 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 51 */
3838 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 52 */
3839 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 53 */
3840 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 54 */
3841 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 55 */
3842 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 56 */
3843 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 57 */
3844 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 58 */
3845 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 59 */
3846 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 60 */
3847 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 61 */
3848 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 62 */
3849 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 63 */
3850 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 64: 65 */
3851 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 66 */
3852 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 67 */
3853 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 68 */
3854 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 69 */
3855 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 70 */
3856 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 71 */
3857 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 72 */
3858 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 73 */
3859 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 74 */
3860 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 75 */
3861 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 76 */
3862 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 77 */
3863 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 78 */
3864 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 79 */
3865 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I = 80: 81 */
3866 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 82 */
3867 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 83 */
3868 (PID.TID 0000.0001) 8.669186205742538E+10, /* I = 84 */
3869 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 85 */
3870 (PID.TID 0000.0001) 8.078743937057304E+10, /* I = 86 */
3871 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 87 */
3872 (PID.TID 0000.0001) 7.248875782324815E+10, /* I = 88 */
3873 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 89 */
3874 (PID.TID 0000.0001) 6.193257577506788E+10, /* I = 90 */
3875 (PID.TID 0000.0001) 5.581203765722643E+10, /* I = 91 */
3876 (PID.TID 0000.0001) 4.909074590409593E+10, /* I = 92 */
3877 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 93 */
3878 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
3879 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
3880 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 96: 97 */
3881 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
3882 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
3883 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =100 */
3884 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =101 */
3885 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =102 */
3886 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =103 */
3887 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =104 */
3888 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =105 */
3889 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =106 */
3890 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =107 */
3891 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =108 */
3892 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =109 */
3893 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =110 */
3894 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =111 */
3895 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =112:113 */
3896 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =114 */
3897 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =115 */
3898 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =116 */
3899 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =117 */
3900 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =118 */
3901 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =119 */
3902 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =120 */
3903 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =121 */
3904 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =122 */
3905 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =123 */
3906 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =124 */
3907 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =125 */
3908 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =126 */
3909 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =127 */
3910 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =128:129 */
3911 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =130 */
3912 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =131 */
3913 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =132 */
3914 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =133 */
3915 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =134 */
3916 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =135 */
3917 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =136 */
3918 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =137 */
3919 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =138 */
3920 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =139 */
3921 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =140 */
3922 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =141 */
3923 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =142 */
3924 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
3925 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =144:145 */
3926 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
3927 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =147 */
3928 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =148 */
3929 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =149 */
3930 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =150 */
3931 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =151 */
3932 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =152 */
3933 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =153 */
3934 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =154 */
3935 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =155 */
3936 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =156 */
3937 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =157 */
3938 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =158 */
3939 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =159 */
3940 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =160:161 */
3941 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =162 */
3942 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =163 */
3943 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =164 */
3944 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =165 */
3945 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =166 */
3946 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =167 */
3947 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =168 */
3948 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =169 */
3949 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =170 */
3950 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =171 */
3951 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =172 */
3952 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =173 */
3953 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =174 */
3954 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =175 */
3955 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* I =176:177 */
3956 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =178 */
3957 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =179 */
3958 (PID.TID 0000.0001) 8.669186205742538E+10, /* I =180 */
3959 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =181 */
3960 (PID.TID 0000.0001) 8.078743937057304E+10, /* I =182 */
3961 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =183 */
3962 (PID.TID 0000.0001) 7.248875782324815E+10, /* I =184 */
3963 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =185 */
3964 (PID.TID 0000.0001) 6.193257577506788E+10, /* I =186 */
3965 (PID.TID 0000.0001) 5.581203765722643E+10, /* I =187 */
3966 (PID.TID 0000.0001) 4.909074590409593E+10, /* I =188 */
3967 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =189 */
3968 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
3969 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
3970 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
3971 (PID.TID 0000.0001) ;
3972 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( units: m^2 ) */
3973 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3974 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
3975 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
3976 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
3977 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
3978 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
3979 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 7 */
3980 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 8 */
3981 (PID.TID 0000.0001) 7.014205907741882E+10, /* J = 9 */
3982 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
3983 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
3984 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
3985 (PID.TID 0000.0001) 8.549360686473492E+10, /* J = 13 */
3986 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
3987 (PID.TID 0000.0001) 8.948571540392021E+10, /* J = 15 */
3988 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
3989 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
3990 (PID.TID 0000.0001) 9.049530583087070E+10, /* J = 18 */
3991 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
3992 (PID.TID 0000.0001) 8.781353403174185E+10, /* J = 20 */
3993 (PID.TID 0000.0001) 8.549360686467184E+10, /* J = 21 */
3994 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
3995 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
3996 (PID.TID 0000.0001) 7.484854821844795E+10, /* J = 24 */
3997 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
3998 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 26 */
3999 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 27 */
4000 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
4001 (PID.TID 0000.0001) 4.571243814190767E+10, /* J = 29 */
4002 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
4003 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
4004 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
4005 (PID.TID 0000.0001) ;
4006 (PID.TID 0000.0001) globalArea = /* Integrated horizontal Area (m^2) */
4007 (PID.TID 0000.0001) 3.638867375081598E+14
4008 (PID.TID 0000.0001) ;
4009 (PID.TID 0000.0001) // =======================================================
4010 (PID.TID 0000.0001) // End of Model config. summary
4011 (PID.TID 0000.0001) // =======================================================
4012 (PID.TID 0000.0001)
4013 (PID.TID 0000.0001) // =======================================================
4014 (PID.TID 0000.0001) // Field Atmosphere orography on ocean grid at iteration 1
4015 (PID.TID 0000.0001) // CMIN = 4.905667583685931E+04
4016 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+05
4017 (PID.TID 0000.0001) // CINT = 1.886789783820026E+03
4018 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
4019 (PID.TID 0000.0001) // 0.0: .
4020 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
4021 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
4022 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
4023 (PID.TID 0000.0001) // =======================================================
4024 (PID.TID 0000.0001) K = 1
4025 (PID.TID 0000.0001) I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
4026 (PID.TID 0000.0001) |--J--|101234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
4027 (PID.TID 0000.0001) 34 ........................................................................................................................................................................................................................
4028 (PID.TID 0000.0001) 33 ........................................................................................................................................................................................................................
4029 (PID.TID 0000.0001) 32 ..++++++++++++++++wy+y+ww+xsrtwxyx....vonrywwzywommlmpppqtttsuy++yy++y....++++++++++yxxyyxxxxvqmnpqw++++++....++++++++++++++++++++++++++++++++....+++++++++++++++++zyxwwwww+++++++....++++++++++++++++++++++++++++++++..
4030 (PID.TID 0000.0001) 31 ..++++++++++++++wv++++++y+yxywxxyy....wqnotsswwphglqttrnnqssswz+++++++....+++++++++zxxxyyxxyxwuport+++++++....++++++++++++++++++++++++++++++++....+++++++++++++++++zyyxwwwww++++++....++++++++++++++++++++++++++++++++..
4031 (PID.TID 0000.0001) 30 ..++++++++++++++w+++++++++++++wwxz....yumnstsspmfdhmlhgfekosuxz+++++++....++++++++++xxxyzyyyxwwsptx+++++++....++++++++++++++++++++++++++++++++....++++++++++++++zzzzyyxxwxxwwy++++....++++++++++++++++++++++++++++++++..
4032 (PID.TID 0000.0001) 29 ..++++++++++++++++wwx+++++++++wwxy....zxrnosspllkeabbaabdhmsvyzz++++++....++++++++zxwwx++zyyxxwtps++++++++....++++++++++++++++++++++++++++++++....++++++++++++++yyzzyxxxxxxxxxz+++....++++++++++++++++++++++++++++++++..
4033 (PID.TID 0000.0001) 28 ..+++++++++++++xsvwxxxy+zzzzywwwwx....yzypnorqnrwnc--aaabelsvxyx++++++....++++++++zxxxx+++zyxxwvpr++++++++....++++++++++++++++++++++++++++++++....++++++++++++++yyzzyyxxyyyyyyzz++....++++++++++++++++++++++++++++++++..
4034 (PID.TID 0000.0001) 27 ..+++++++++++++vvwxxxxxxzzzyxwwvvw....xyz+++trrwzwkdabccbenvwxxw++++++....++++++++++xxyz++zyxxxwst++++++++....++++++++++++++++++++++++++++++++....+++++++++++++ywyz+zyxxyzz++zzz++....++++++++++++++++++++++++++++++++..
4035 (PID.TID 0000.0001) 26 ..++++++++++++yxxyxwwwwxyyxxyxyyvw....wxz++++yyyyyxvnmmmhhnuwxxy++++++....++++++++++++++++zyxxxwss++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywwx++zyyyxxxz++++z+....++++++++++++++++++++++++++++++++..
4036 (PID.TID 0000.0001) 25 ..+++++++++++yyyyyxvuvwwwxwxyxy+vv....wxzzx++++zxxxyxywwqorwxyy+++++++....++++++++++++x++yyyxxxwss++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywvwz+zzzwmkmrwyyzz+....++++++++++++++++++++++++++++++++..
4037 (PID.TID 0000.0001) 24 ..+++++++++++yyyyyxwwwwstwwxyxy+ws....wxyzz+++++xxxxy++xutvx++++++++++....++++++++++++xx+yyzyxxvst++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywxz++zzukgfghkqvxzz....++++++++++++++++++++++++++++++++..
4038 (PID.TID 0000.0001) 23 ..+++++++++++zyyyyxxwwxxwwwxxxw++p....vwxz++++++yxxy+++ywwwx++++++++++....+++++++++oq+++xxzzyyxvsr++++++++....++++++++++++++++++++++++++++++++....++++++++++++trwy+++wher+yumhkrwx....y+++++++++++++++ww++++++++++++++..
4039 (PID.TID 0000.0001) 22 ..+++++++++++zyyyyxyxxyyxwwwxxvr++....wy++++++++yxy+++++yxxw++++++++++....+++++++++vlr+++x++zzywusw+++++++....++++++++++++++++++++++++++++++++....++++++++++++wpqvy+xrht++++++xuuv....ww+++++++++++++lhhknw+++++++++++..
4040 (PID.TID 0000.0001) 21 ..+++++++++++yxxyyyyxxyyxwwwxxrnv+....+++++++++++yy++++++zyxy+++++++++....+++++++++vkkn++++++++xuutw++++++....++++++++++++++++++++++++++++++++....x++++++++++++ywqsuop++++++++++++....wuwy++++++++++pkhghkklw+++++++++..
4041 (PID.TID 0000.0001) 20 ..+++++++++++yxxyyyxxwxxxwwxxxpmqv....wx+++++++++y++++++++++++++++++++....++++++++++khknwt++++++wwwx++++++....++++++++++++++++++++++++++++++++....xxxz++++++++++++wuw+++++++++++++....++++++++x+++++okhhhhklr+++++++++..
4042 (PID.TID 0000.0001) 19 ..++++++++++++yyyyyyxwwwxwwxxwrnqw....xy+++++++++++++++++y++++++++++++....+++++++x++qlkmxx++++++xyy+++++++....++++++++++++++++++++++++++++++++....xxwxz+++++++y+++++++++++++++++++....+++++++++ws++xqkhgghlow+++++++++..
4043 (PID.TID 0000.0001) 18 ..+++++++++++++++++++wwxxxxwwwutwx....z+++++++++++++++++yy++++yy++++++....+++z++++++++rs++++++++++++++++++....++++++++++++++++++++++++++++++++....yyxxz++++++y++++++++++++++++++++....++++++++++xv+xqlhgfghkr+++++++++..
4044 (PID.TID 0000.0001) 17 ..+++++++++++++++++++yxxyyxwturuy+....+++++++++++++++++++yy++ywy++++++....++zy++++++++++++++++++++y+++++++....++++++++++++++++++++++++++++++++....yzzyz++++zw+++++++++++++++++++++....++++++++++xuwupkhgffghkq++++++++..
4045 (PID.TID 0000.0001) 16 ..+++++++++++++++++++zxxxxxvrtqtz+....++++++++++++++++++++y++yy++++++z....wzz++++++++++++++++++++xxy++++++....++++++++++++++++++++++++++++++++....yyyzz++++yw+++++++++++++++++++++....++++++++++xsonnkhhggghho++++++++..
4046 (PID.TID 0000.0001) 15 ..zy++++++++++++++++++yxxxxvsusv++....+++++++++++++++++++++z++++++++++....txy++xw++++++++++++++++wwx++++++....++++++++++++++++++++++++++++++y+....xxxyz++++y++++++++++++++++++++++....+++++++++++uoqsvkkhhhhkp++++++++..
4047 (PID.TID 0000.0001) 14 ..yxxy++++++++++++++++ywwwwvtttw++....++++++++++++++++++++++++++++++++....twxzzxwwwx++++++++++++zxwx++++++....+++++++++++++++++++++++++++++++y....wwxxxyz++v++++++++++++++++++++++....+++++++++++woux+xmkhhklv++++++++..
4048 (PID.TID 0000.0001) 13 ..xxx++++++++++++++++++vvvvutsux++....++++++++++++++++++++++++++++++++....vwxz++zzyy+++++++++++zyxwxx+++++....++++++++++++++++++++++++++++++++....uttvwwvqot++++++++++++++++++++++....++++++++++++vwy++plkkko+++++++++..
4049 (PID.TID 0000.0001) 12 ..wwy+++++++++++++++++xsuvuuuuwx++....++++++++++++++++++++++++++++++++....wwxzzzzzyy+++++++z+++xwwv++x++++....++++++++++++++++++++++++++++++++....nmlossqoq+++++++++++++++++++++++....+++++++++++++++++qlkklw+++++++++..
4050 (PID.TID 0000.0001) 11 ..ww++++++++++++++++++wtvvvvvvwy++....+y++++++++++++++++++++++++++zzzz....wwxyzzzzzz+++++zzyzywvtrv+++++++....++++++++++++++++++++++++++++++++....mllnqpqw++++++++++++++++++++++++....+++++++++++++++++qmmmq++++++++++..
4051 (PID.TID 0000.0001) 10 ..wx++++++++++++++++++xuvwwvuwy+++....xw+++++++++++++++++++++++++zyyyy....wwxyzzzzzzzzy++zxxxywvtsx+++++++....++++++++++++++++++++++++++++++++....nnoquw++++++++++++++++++++++++++....++++++++++++++++++ww++++++++++++..
4052 (PID.TID 0000.0001) 9 ..wy+++++++++++++++++++tuvwvvw++++....w+++++++++++++++++++++++++zzyxyy....+yzzzzzzzzyxxzzywwxxyxxwx+++++++....++++++++++++++++++++++++++++++++....onrwy+++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4053 (PID.TID 0000.0001) 8 ..y++++++++++++++++++++tuvvvwy++++....x+++++++++++++++++++++++yxxyxxxx....+++zzzzzzyxyz+zzwwxxyxxwwxy+++++....++++++++++++++++++++++++++++++++....posx++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4054 (PID.TID 0000.0001) 7 ..+++++++++++++++++++++wvvusuz++++....y+++++++++++++++++++++++yxxxxxxx....y++zzzzzzyyzzzzzxxxxwwwvvvxx++++....+++++++++++++++++++++++++yxxxyy+....xyy+++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4055 (PID.TID 0000.0001) 6 ..+++++++++++++++++++++ywusqw+++++....++++++++++++++++++++++++yxxxxxxx....w++wzzzzyxyzzzzzxxxwuuwwxwxx++++....++++++++++++++++++++++++zyyyyxxy....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4056 (PID.TID 0000.0001) 5 ..++++++++++++++++++++++vtrv++++++....++++++++++++++++++++++++yxxyyyyy....q++py++zyxzzzzzyxxxwsuwwxxxx++++....+++++++++++++++++++++++yyxyzzzyy....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4057 (PID.TID 0000.0001) 4 ..++++++++++++++++++++++yyy+++++++....++++++++++++++++++++++++yyyzzzzz....snnny++zyyyyzzywvtuvtvwwxxwx+++y....++++++++++++++++++w+++xxyyzzzzzz....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4058 (PID.TID 0000.0001) 3 ..++++++++++++++++++++++++++++++++....+++++++++++++++++++++++++++++++z....tmnvz+zzzyxxxxwqpnotsuvwyxwy++++....y++++++++++++++++wv+++zyzzzzzyz+....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4059 (PID.TID 0000.0001) 2 ..++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++....unny+zzzzzxxwwrnmmmqsuvvxxw+++++....y++++++++++++++++w++++zyyz+zyyy+....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
4060 (PID.TID 0000.0001) 1 ..++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++....uooy+yyzzyxwwqoomlmqtvutwyy+++++....y++++++++++++++++y++++zyyyzzzzz+....++++++++++++++++++++++++++++++++....++++++++++++++++++y+++++++++++++..
4061 (PID.TID 0000.0001) 0 ........................................................................................................................................................................................................................
4062 (PID.TID 0000.0001) -1 ........................................................................................................................................................................................................................
4063 (PID.TID 0000.0001) // =======================================================
4064 (PID.TID 0000.0001) // END OF FIELD =
4065 (PID.TID 0000.0001) // =======================================================
4066 (PID.TID 0000.0001)
4067 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_T_cs_15k.bin
4068 (PID.TID 0000.0001) // =======================================================
4069 (PID.TID 0000.0001) // Field Initial Temperature at iteration 1
4070 (PID.TID 0000.0001) // CMIN = -1.820018601798449E+00
4071 (PID.TID 0000.0001) // CMAX = 2.938267637698524E+01
4072 (PID.TID 0000.0001) // CINT = 1.155655369584581E+00
4073 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
4074 (PID.TID 0000.0001) // 0.0: .
4075 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 192: 1)
4076 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 32: 1: -1)
4077 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
4078 (PID.TID 0000.0001) // =======================================================
4079 (PID.TID 0000.0001) K = 1
4080 (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60 I=70 I=80 I=90 I=100 I=110 I=120 I=130 I=140 I=150 I=160 I=170 I=180 I=190
4081 (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|12
4082 (PID.TID 0000.0001) 32 ttsssrqqpppoonnn..o.o..p.................................kk..pp.tttsrrpmig................lnooppqqrrsttuvwxxyyyxxyyyyyyxxwvtsrqqttuuvvwxxxxyyyyy.........tuuttsrrqqponmlkjiihgggggghijklmnopqqqr
4083 (PID.TID 0000.0001) 31 tttsssrrqqqppo..pppqqq.q.................................lllrq.usssrolkhf................llmnoppqqrsstuuvwxxyyyxxyyzzyyyxwutsrqpttuuvwwxxxxyyyyy..........uuttsrqqpomlkjihggfeeeeeeefggijklnopqq
4084 (PID.TID 0000.0001) 30 uutttsssrrrqqq.pqqqqqrrrrrss.............................lmnrtvussrpkhfeed...............klmnnoppqrsttuvvwxxyyyxxyyzzzyxxvutsrqpttuuvwwxxxyyyy..............tssrqpomlkjhgfeedcccccccddfgghikmopq
4085 (PID.TID 0000.0001) 29 uuuutttsssrrrrpp...rrrrrsstt..............................opsvvvsrrojed......bb.........kkllmnnopqrstuuvvwxxyzyyyyzzzzyxwvutsrqpttuuvwxxxyyyyy...............qqqqpnlkjhgeddccbbbbbbbbcdeefghjmop
4086 (PID.TID 0000.0001) 28 vvuuuutttsssr........s....................................rsuvvvrqqojfdc.....bba........jkkklmnopqrstuvvvwxxyzyyyyzzzzyxwvutrqpotttuvwxxyyyyyy................nooonlkigedcbbbbaaaaabbbcddefghjmo
4087 (PID.TID 0000.0001) 27 vvvvvuutttssr......................wxx....................tvwwwvqqpokhgecc....bb........jjjjklmnoqrstuvvwwxxyzyyyzzzzzyxwvusrqpottuuvwxxyyyyy.................llmmmljgedcbaaaaaaaaaabbcccdeffhko
4088 (PID.TID 0000.0001) 26 wwvvvvuuutss.......................xxww...................uwwwwwqponljhgeedbbbbb........ijiijklmopqstuvvwwxxyzzyyzzzzzyxwutsrpontuuuvwxxyyyy...................kjkkjhfdccbaaaaaaaaaaabbbccdefhkn
4089 (PID.TID 0000.0001) 25 wwwwvvvuutr..................z.......wxxx................wxxxxxxponmkihffedc.ba.........iiiiijklnoqstuvwwwxxyzyyyzzzzzyxwutsrponruuuvwxxyyyy...................nkiiigfdcbaa-aaaaaaaaaaabbcdefhkn
4090 (PID.TID 0000.0001) 24 xwwwwvvvus...................z.......xxyyy.....zz.....vwwxyyyyyyponljigfedcb............hhhhhijkmoprtuvwwxxxyzyyyzzzzzyxwutsqpomotuuuvxxyyyy....................ljhhgfdbaa------aaaaaaabbccdegjm
4091 (PID.TID 0000.0001) 23 xxwwwwvvut...................++.....wxyyyy....zzz.....xxxyyzzzzzonmljihgf..baa..........hhghhhiklnprsuvwxxxyyzzyyz++zzyxwutrqpnmkquuuvwxy.yy...........r.........kiigfdba-------..-a-aaaabcdefhk
4092 (PID.TID 0000.0001) 22 xxxxwwwvvu....................zz..wxxyyyzz...zzzzz....xyyzzzzzzzonmlkjihf...baa.-a.......hggghijlnpqsuvwxxxyyzzyzz++zzyxvutrqpnminsuvvwxyyyy..........rrqpoo......hhgeca-------......-aaabcddefj
4093 (PID.TID 0000.0001) 21 xxxxxxwwwv.....................yyxxxyyyzzzz..zzzzzz....yzzzzzzzzonmlkjihf....aaa-aaa-.....gggghjkmoqsuvwxxxyyzzzzz++zzywvutrqpnm.kpvwwxx.zyyy.......qqrrrqpponmm....gfca.-----.........aaabcddfi
4094 (PID.TID 0000.0001) 20 yyyyyxxxxww.......................xyyyzzzzz.zzzzzzzzz.yzzzzzzzzznmmlkjjieb......-aa--a....degghikmoqstvwxxyyyzzzzz++zzyxvutrqonm....wxxy.zzyy.ww...ssssrrrqppomlkjihgfca.a----.........-aabccdfi
4095 (PID.TID 0000.0001) 19 yyyyyyyyyxxx......................yyyzzzzzzzzzzzzzz.zyzzzzzz.zz+nmllkjj.db......-----a...cdefgghjmoqstvwxxyyyzzzzz++zzywvusrqoom.......xzzzy.xxvtrsttsssrrrqponlkjihgecaa..--..........aaaabcdfi
4096 (PID.TID 0000.0001) 18 yyyyyyyyyyyyyywxxyx..............yyyzzzzzzzzzzzzzz..zzzz..zzzzz+nlk.kjhfdbaa..-------aabbbdeffghjmoqstvwxyyyyzzzz+++zzywvusrqpom.....vwxyyy.uxxvttuuttsssrrqpomljihgfecaa-.............aaaabcegi
4097 (PID.TID 0000.0001) 17 yyyyyyyyyyyxxxxxxxx.............yyyyzzzzzzzzzzzz+++..zz...zzzz++nl..ijhgfdbaa---------aa.cdeffghjloqstvwxyyyzzzzz+++zzxwvusrqpom.....vwxw..xvvxvtuvuutttssrqpomljihgfecba-..............-aabcegi
4098 (PID.TID 0000.0001) 16 yyyyyyyxxxxxwwwwwwv............yyyyzzzzzzzzzzzzzz+zz.zz..zzzzzz....jiiiihfddca---------...eeffghjloqstvwxyyyzzzzz+++zzxwvusrqqom......wxx..xvvxvsuvvuttttssrpomkjihgfecba-..............-abbcegi
4099 (PID.TID 0000.0001) 15 ..yyyyyyxxxxxwwwvvut..........yyyyyyzzzzzzzzzzzzzzzzz.zzzzzzzzzz...ji..ihgfc.----------...defffgimoqsuvxxyyyzzzzz+++zzywvusrq..l......wxx.xxwxxvtvvvuuutttsrpomkjihgfecbaaa.............-aabcefh
4100 (PID.TID 0000.0001) 14 ....yyyyyxxxxwwwvvut..........yyyyyyyyyyzzzzzzzzzzzzzzz.zzzzzzzz..........fca------aa-....defffgimoqsuvxxyyyzzzzz+++zyxwvusrqpo........xx.zyxxxvuvwvvuuuttsrpomkjihgfedbaa-.............-abbcefi
4101 (PID.TID 0000.0001) 13 ...yyyyyxxxwwwvvvvutt.........yyyyyyyyyyyyyyyyyyzzzzzzzzyyyzzzzz..........fdba-----aa......deffgimprsuvxyyyzzzzz++++zyxwvutrqpon..........zzyyxvuvwwvvuuuttrqomljihhgedcba--...........-aabcdegi
4102 (PID.TID 0000.0001) 12 ...yyyxxxwwwvvuuuutt..........yyyyxyyyyyyyyyyyyyyyyyyyyzzzzzzzz...........dcba--a.aaa....cc.eefgjmprtuwxyyyzzz++++++zyxwvutsrpon.........yzzyyxvuvwwvvvuuutrqonlkjhhgedcba-------......aabcddfhj
4103 (PID.TID 0000.0001) 11 ..yyyxxwwwvvvuutttsr..........yyy.xxxxxxxxxxxxxxxxxxxyyyyyzz..............cca--..........bcddefhjnqrtuwxyyzzzz++++++zyxwvuttrqpn........wxyzyyxvvwwwwvvvvutsqpnmkjihgfdcbaa-----a.....aabcddegij
4104 (PID.TID 0000.0001) 10 ..xxxxxwwvvvuuuttssq.........xyy..xxxxxxxwwwxwwwwwwwwxxxyyy..............................bcdddehknqstuwxyyzzzz++++++zyxwvuutsrpo......uvvxyyzyxvvwwwwwvvvutsrpnmkjihgfedbaaa------..-aabccdefhjk
4105 (PID.TID 0000.0001) 9 ..xxxxwwwvvvuutttsrqo.......xxxx.xxxxwwwwwwvwvvvvvvvvvwwxy......l........................bbcddehlorstvwxyzzzz+++++++zyxwvvuutrqo.....srtvwyyyyxwvwxxwwwvvutsrpomlkihhgfdcbaaaaaaa---aabcddefhijk
4106 (PID.TID 0000.0001) 8 .wwwwwwwvvvuuuttssrqo.......xxxx.xwwwwwwvvvvuuuuuuuuuuvv........kk.........................dcdeimprtuvwxyzzzz++++++zzyxxwwvutsqp....pqrtvwyyyyxwvwxxxwwwvvutrqonlkjihhfedbaaaaabbaaaabbcdefhijkl
4107 (PID.TID 0000.0001) 7 uvwwvvvvvuuutttssrrqp.......wwww.wwwwvvvvuuuttttttttttuu.........kj.........................deginqstuvwxyzzzz++++++zyyxxw......o...opqrsuwxyyyxwvwxxxxxwwvutsqpnmljjihhfecbbbbbccccbbbcdefgijkkl
4108 (PID.TID 0000.0001) 6 uvvvuuuutttttsssrrrqp......wwvvvvvvvvuuutttssssrrrrrsstu.........jj.........................h.ikorttuvwyyzzzz+++++zzyyxx........mmnopqrtuwxyyyxwwwxxxxxwwvutsrpomlkjjiihgeddddddeeeddddefgijkklm
4109 (PID.TID 0000.0001) 5 uuuutttssssrrrrrrqqqqo....vvvvvuuuuutttsssrrrrqqqqqqqrst.........kk.........................gi.lortuuvwyyzzzz+++++zyyyx.........nnopqrstuvxxyyxwwxxxxxxxwvutsrponmlkkjiihggfffffgggfffgghijkklmn
4110 (PID.TID 0000.0001) 4 ttttssrrrqqqqppppppqqq...uuuuuuttttsssrrrqqpppooooooppqs....................................eil.pstuuvwyyzzzz+++++.yyy..........oopqrrstuvwxyyxwwxxyyyxxwwutsrqoonmlkjjjiiihhhhhhhhhhhiijjkllmmn
4111 (PID.TID 0000.0001) 3 sssrrrqqppooonnnmnnpqrrssttttstssssrrrqqppoonnnnmnnnnopqqqqqqqq.............................gjmo.ttuuvwyyzzzz++++..zy..........oppqqrsttuvxxyyxwwxyyyyyxxwvtsrqponnmlkkjjjjjjjjiiiiijjjkkllmmnno
4112 (PID.TID 0000.0001) 2 rrrqqqpoonmmmllkkklnpqqqrssssrssrrrrqqppoonnmmmlllllmmnoopppppqq...........................hjlop.tuuvvwyyzzzz++++.yzyy.........ppqqrrstuvwxxyyyxxxyyyyyxxwvtsrqppoonmllkkkkkkkkjiijkkkllmmmnnnoo
4113 (PID.TID 0000.0001) 1 rrqqpponmlkkkjijiiiklnnopqrrrrrrrrqqqpponnmllkkkjjkkkklmmnoooppq...........................jmopp.tuuvvwxyzzzz++++.yzyy.........pqqrrsstuvwxxyyyxxxyyyyyxxwvtsrqqppoonnmmlllllllkkj.mlmmnnnnnooop
4114 (PID.TID 0000.0001) // =======================================================
4115 (PID.TID 0000.0001) // END OF FIELD =
4116 (PID.TID 0000.0001) // =======================================================
4117 (PID.TID 0000.0001)
4118 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_S_cs_15k.bin
4119 (PID.TID 0000.0001) // =======================================================
4120 (PID.TID 0000.0001) // Field Initial Salinity at iteration 1
4121 (PID.TID 0000.0001) // CMIN = 1.814484149562675E+01
4122 (PID.TID 0000.0001) // CMAX = 3.993039913177491E+01
4123 (PID.TID 0000.0001) // CINT = 8.068725050425242E-01
4124 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
4125 (PID.TID 0000.0001) // 0.0: .
4126 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 192: 1)
4127 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 32: 1: -1)
4128 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
4129 (PID.TID 0000.0001) // =======================================================
4130 (PID.TID 0000.0001) K = 1
4131 (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60 I=70 I=80 I=90 I=100 I=110 I=120 I=130 I=140 I=150 I=160 I=170 I=180 I=190
4132 (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|12
4133 (PID.TID 0000.0001) 32 wwwwvvvvvvvvvvvu..y.y..y.................................pq..tt.wwwvvvutrq................rrrsssstttuuuuttttttuuuuuvvvwvvvvuuuuuwwwwwxxxwwwvvvvv.........vvwwvvvvvuuuuuutttttttttttttttuuuuuuvvv
4134 (PID.TID 0000.0001) 31 wwwwwvvvvvvvvv..yxyyyy.y.................................pqrtt.twwvvutsrp................rrrrssssttuuuuuutttttuuuuuvvvvvvvvuuuuuwwwwwxxxwwvvvvvv..........vvvvvvvvuuutttttttttttttsttttttttuuuvv
4135 (PID.TID 0000.0001) 30 wwwwwwwwwwvvvv.xxxxxyyyzzzzy.............................qqrttttwvvvtsrqpp...............rrrrssssttuuuuuutttttuuuuuvvvvvvvuuuuuuwwwwwwwwwwvvvv..............uuvvvuuuttttttttssssttttttttttttuuuv
4136 (PID.TID 0000.0001) 29 wwwwwwwwwwwwwwww...xxyyzzzzz..............................rsttttvvvutrq......km.........qrrrrrsssttuuuuuutttttuuuuuvvvvvvvvuuuuuwwwwwwwwwvvuuv...............tuuvuutttttttttsssttttttttttttttuuu
4137 (PID.TID 0000.0001) 28 wwwwwwwwwwwww........y....................................ssttttvvvutssr.....npq........qrrrrrsssttuuuuuutttttuuuuvvvvvvvvvuuuutwwwwwwwwvvuuuv................suuuuttttttttsssttttttttttttssttuu
4138 (PID.TID 0000.0001) 27 xxxxxxwwwwwww......................+yw....................ttttuuvvvuuttsss....oq........qrrrrrsssttuuuuuutttttuuuuvvvvvvvvvuuuutwwwwwwwwvvuuv.................sttuuttttttttssttttttttttttttssttu
4139 (PID.TID 0000.0001) 26 xxxxxxxxwwww.......................+www...................tttuuuvvvuutttttsrqqpq........qrrrrrrssttuuuuuutttttuuuuvvvvvvvvuuuuutvwwwwwwwvvuv...................sttttttttttttttttttttsssttttssttu
4140 (PID.TID 0000.0001) 25 xxxxxxxwwww..................z.......wwww................ttttuuuvvvuuututtts.rr.........qrrrrrrssstuuuuuutttttuuuuvvvvvvvuuuuuttvvwwwwwwvvuv...................sstttttttttttttttttttsssttttssttu
4141 (PID.TID 0000.0001) 24 xxxwwwwwww...................z.......vwwwv.....qq.....sttttttttuvvvuuuuuttss............rrrrrrrsssttuuuuutttttuuuuvvvvvvvvuuuutttvwwwwwwvuvv....................sstttttttttttttttttttttttttssttu
4142 (PID.TID 0000.0001) 23 wwwwwwwwvv...................yy.....vvwwwv....srr.....sttsstttttvvvuuuuuu..srr..........qrrrrrrsstttuuuuuuttttuuuuvvvvvvvvuuuuttsuvwwwwww.vv...........u.........ssstttttttttttt..ttttttssttsstt
4143 (PID.TID 0000.0001) 22 wwwwwwvvvv....................xw..vvvvvwwv...sssrr....ssssstttttvvvuuuuuu...sss.qq.......qrrrrrsstttuuuuuuttttuuuuuuvvvvvvvuuuttrtvvwwwwwvvv..........uuuttt......ssstttttttttt......tttsssssstt
4144 (PID.TID 0000.0001) 21 vvvvvvvvvv.....................vvvvvvvvvvvu..sssrrq....sssstttttvvvuuuuut....ssrqqqpp.....qrrrrsstttuuuuuuttttuuuuuuuuuuuvvuuuut.stvwwww.vvvv.......uuuuuttttsss....tttt.ttttt.........tsssstttt
4145 (PID.TID 0000.0001) 20 vvvvvvvvvvu.......................vvvvvvvvu.sssssrrqq.ssssstttttvvuuuuuuts......qqpooo....qqrrrsstttuuuuuuttttuuuuuuuuuuuvvvuuuu....vvvv.vvvv.ss...uuuuuutttttssssssstts.ttttt.........tsssstttt
4146 (PID.TID 0000.0001) 19 vvvvvvvvvvuu......................vvvvvvvuuuttttssr.rssssstt.tttvuuuuuu.tt......qpooop...qpqrrrsstttuuuuuuttttuuuuuuuuuuuvvvuuuu.......vvvvv.rsstuuuuuuuuutttttssssstttss..tt..........tsssttttt
4147 (PID.TID 0000.0001) 18 vvvvvvvvvuuuuuuuuut..............uuuuuuuuuuuuttttt..ssss..ttttttvuu.uuuuuttr..pqpoooopqqrqqrrrrsstttuuuuuuttttuuuuuuuuuuuvvvuuuu.....vvvvvv.tssttuuuuvuuuuuttttttttttttsss.............tsstttttt
4148 (PID.TID 0000.0001) 17 vvvvvvvvvvvuuuuuuut.............uuuuuuuuuuuuuutttts..rs...ttttttuu..uuuuuuttrrpppppoopqr.rrrsrrsstttuuuuuuutttuuuuuuuuuuvvvvvuuu.....vvvw..sttstuuuuvvvvuuuttttttttttttsss..............sttttttt
4149 (PID.TID 0000.0001) 16 vvvvvvvvvvvvvvuuuuu............uuuuuuuuuuuuuuuutttsr.rr..sttttt....tuuuuuuuutssrqqpooop...rssrrsstttuuuuuuuttttuuuuuuuuuuvvvvvuu......vww..tttstuuuuvvvvuuuutttttttttttsss..............tttttttt
4150 (PID.TID 0000.0001) 15 ..vvvvvvvvvvvvvvvvvv..........uuuuuuuuuuuuuuuuuttttss.rrsssttttt...tt..ttuut.ssssrqpnno...rssrrrstttuuuuuuuttttuuuuuuuuuvvvvv..t......vww.ttttstuuuuvvvvvuuutttttttttttssst.............tttttttt
4151 (PID.TID 0000.0001) 14 ....vvvvvvvvvvvvvvvv..........uuuuuuuuuuuuutttttttttsss.sssstttt..........utttttsrqomm....rrrrrrstttuuuuuuutttuuuuuuuuuuvvvvuuu........ww.ttttttuuuuvvvvvuuuttttttttttttsst.............tttttttt
4152 (PID.TID 0000.0001) 13 ...wwwwwwwwwwwwvvvvvv.........uuuuuuuuuuuutttttttttttttttttttttt..........uutttssrpol......rrrrsstttuuuuuuutttuuuuuuuuuuvvvvvuuu..........tttsttuuuuvvvvvuuuttttttttttttssst...........ttttttttt
4153 (PID.TID 0000.0001) 12 ...wwwwwwwwwwwwwvvvv..........uuuuuuuuuuuuttttttttttttttttttttt...........tttsssr.pom....rr.rrrsstttuuuuuuuttttuuuutuuuuvvvvvuuu.........ttsssttuuuuvvvvvvuutttttttttttttsssstttt......ttttttttt
4154 (PID.TID 0000.0001) 11 ..wwwwwwwwwwwwwwvvvv..........uuu.uuuuuuuutttttttttttttttttt..............stsrq..........rrrrrrsstttuuuuuuutttttuuttuuuuvvvvvvuu........tttsssttuuuuvvvvvvuutttttttttttttsssstttt.....tttttttttt
4155 (PID.TID 0000.0001) 10 ..xxxxxwwwwwwwwvvvvv.........uuu..uuuuuuuuuuuuuuuuuuuuuuuuu..............................rrrrrrsstttuuuuuuutttttuuutuuuuvvvvvvuu......uutttsssttuuuuvvvvvvvuuttttttttttttttttttttt..tttttttttttt
4156 (PID.TID 0000.0001) 9 ..wwwwwwwwwwwwvvvvvuu.......uuuu.uuuuuuuuuuuuuuuuuuuuuuuuu......-........................rrrrrrsttttuuuuuuutttttttuuuuuuvvvvvvuu.....utttttsssttuuuuvvvvvvvuuttttttttttttttttttttttttttssttttttu
4157 (PID.TID 0000.0001) 8 .wwwwwwwwwwwwvvvvvvuu.......uuuu.uuuuuuuuuuuvvvvvuvuuuuu........--.........................rrrrsttttuuuuuuutttttttuuuuuuuuvvvvvu....sssttttssttuuuuuvvwwvvvuuttttttttttttttttttttttttttssttttttu
4158 (PID.TID 0000.0001) 7 wwwwwwwwwwvvvvvvvvvuu.......uuuu.uuuuuuuvvvvvvvvvvvvvvvu.........--.........................srssttttuuuuuutttttttuuuuuuuu......u...ssstttttssttuuuuuvvwwwvvuuuttttttttttttttttttttttttssttttttuu
4159 (PID.TID 0000.0001) 6 wwwwwvvvvvvvvvvvvvvvu......uuuuuuuuuuuuvvvvvvvvvvvvvvvvv.........--.........................t.sstttuuuuuuuttttttttuuuuuu........rsssssttttttsttuuuuuvvwwwvvvuuttttttttttttttttttttttttttttttttuu
4160 (PID.TID 0000.0001) 5 wwvvvvvvvvvvvvvvvvvvuu....uuuuuuuuuuuvvvvvvvvvvvvvvvvvvv.........--.........................tt.stttuuuuuuuuttttttttuuuu.........rrsssttttttttttuuuuuvvwwwvvvuuttttttttttttttttttttttttttttttuuuu
4161 (PID.TID 0000.0001) 4 wvvvvvvvvvuuuuuuuuuuuu...uuvuuuuvvvvvvvvvvvuuuuuuuuvvvvv....................................ttt.tttuuuuuuutttttttt.uuu..........rssssttttttttttuuuuvvvwwwvvvuuuttttttttttttttttttttttttttttuuuuu
4162 (PID.TID 0000.0001) 3 vvvvvvvvuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvuuuuuuuuuuuuuuuvvvvvvvvvv.............................tttt.tttuuuuuuttttttt..ut..........vsssstttttttttttuuuuvvvwwwvvvuuuttttttttttttttttttttttttuuuuuuuuu
4163 (PID.TID 0000.0001) 2 vvvvvvuuuuuuuutttttuuuuuuvvvvvvvvvvvvuuuuuuuuuuuuuuuuuuuuuvvvvvv...........................stttt.tttuuuuutttttttt.tttt.........vssttttuutttttttuuuuvvvwwvvvuuuuutttttttttttttttttttuttuuuuuuuuuu
4164 (PID.TID 0000.0001) 1 vvvvuuuuuuutttttttttuuuuuuuvvvvvvvvvuuuuuuuutttttttuuuuuuuuuuuvv...........................stttt.ttttuuuutttttttt.tttt.........vsstttuuuttttttuuuuuvvvwvvvvuuuuuutttttttttttuuuttt.uuuuuuuuuuvvv
4165 (PID.TID 0000.0001) // =======================================================
4166 (PID.TID 0000.0001) // END OF FIELD =
4167 (PID.TID 0000.0001) // =======================================================
4168 (PID.TID 0000.0001)
4169 (PID.TID 0000.0001) Start initial hydrostatic pressure computation
4170 (PID.TID 0000.0001) Pressure is predetermined for buoyancyRelation OCEANIC
4171 (PID.TID 0000.0001)
4172 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
4173 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
4174 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
4175 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
4176 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
4177 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
4178 (PID.TID 0000.0001) // =======================================================
4179 (PID.TID 0000.0001) // Model current state
4180 (PID.TID 0000.0001) // =======================================================
4181 (PID.TID 0000.0001)
4182 (PID.TID 0000.0001) // =======================================================
4183 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4184 (PID.TID 0000.0001) // =======================================================
4185 (PID.TID 0000.0001) %MON time_tsnumber = 0
4186 (PID.TID 0000.0001) %MON time_secondsf = 0.0000000000000E+00
4187 (PID.TID 0000.0001) %MON dynstat_eta_max = 0.0000000000000E+00
4188 (PID.TID 0000.0001) %MON dynstat_eta_min = 0.0000000000000E+00
4189 (PID.TID 0000.0001) %MON dynstat_eta_mean = 0.0000000000000E+00
4190 (PID.TID 0000.0001) %MON dynstat_eta_sd = 0.0000000000000E+00
4191 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 0.0000000000000E+00
4192 (PID.TID 0000.0001) %MON dynstat_uvel_max = 0.0000000000000E+00
4193 (PID.TID 0000.0001) %MON dynstat_uvel_min = 0.0000000000000E+00
4194 (PID.TID 0000.0001) %MON dynstat_uvel_mean = 0.0000000000000E+00
4195 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 0.0000000000000E+00
4196 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 0.0000000000000E+00
4197 (PID.TID 0000.0001) %MON dynstat_vvel_max = 0.0000000000000E+00
4198 (PID.TID 0000.0001) %MON dynstat_vvel_min = 0.0000000000000E+00
4199 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 0.0000000000000E+00
4200 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 0.0000000000000E+00
4201 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 0.0000000000000E+00
4202 (PID.TID 0000.0001) %MON dynstat_wvel_max = 0.0000000000000E+00
4203 (PID.TID 0000.0001) %MON dynstat_wvel_min = 0.0000000000000E+00
4204 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 0.0000000000000E+00
4205 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 0.0000000000000E+00
4206 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 0.0000000000000E+00
4207 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382676376985E+01
4208 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8552983134796E+00
4209 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030349459887E+00
4210 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406771433446E+00
4211 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4668080606120E-02
4212 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715748807407E+01
4213 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144841495627E+01
4214 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721451128586E+01
4215 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858744433685E-01
4216 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1848960662010E-02
4217 (PID.TID 0000.0001) %MON extforcing_qnet_max = 4.6211611868841E+02
4218 (PID.TID 0000.0001) %MON extforcing_qnet_min = -2.0410376912710E+02
4219 (PID.TID 0000.0001) %MON extforcing_qnet_mean = -1.2329247921290E+01
4220 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 1.1327998988989E+02
4221 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 5.3775063971043E+00
4222 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4223 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4224 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4225 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4226 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4227 (PID.TID 0000.0001) %MON extforcing_empmr_max = 7.6494447208479E-08
4228 (PID.TID 0000.0001) %MON extforcing_empmr_min = -1.5362614137596E-07
4229 (PID.TID 0000.0001) %MON extforcing_empmr_mean = -2.0474999028391E-24
4230 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 2.4051723601802E-08
4231 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 1.2835223797615E-09
4232 (PID.TID 0000.0001) %MON extforcing_fu_max = 2.4892781143428E-01
4233 (PID.TID 0000.0001) %MON extforcing_fu_min = -2.1535754027523E-01
4234 (PID.TID 0000.0001) %MON extforcing_fu_mean = -1.5037205431943E-03
4235 (PID.TID 0000.0001) %MON extforcing_fu_sd = 6.2251380425684E-02
4236 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 3.5863906188079E-03
4237 (PID.TID 0000.0001) %MON extforcing_fv_max = 2.9305960402537E-01
4238 (PID.TID 0000.0001) %MON extforcing_fv_min = -3.3950131228473E-01
4239 (PID.TID 0000.0001) %MON extforcing_fv_mean = -5.6792591955702E-03
4240 (PID.TID 0000.0001) %MON extforcing_fv_sd = 7.0478671072554E-02
4241 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 3.5172812437129E-03
4242 (PID.TID 0000.0001) %MON advcfl_uvel_max = 0.0000000000000E+00
4243 (PID.TID 0000.0001) %MON advcfl_vvel_max = 0.0000000000000E+00
4244 (PID.TID 0000.0001) %MON advcfl_wvel_max = 0.0000000000000E+00
4245 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 0.0000000000000E+00
4246 (PID.TID 0000.0001) %MON pe_b_mean = 0.0000000000000E+00
4247 (PID.TID 0000.0001) %MON ke_max = 0.0000000000000E+00
4248 (PID.TID 0000.0001) %MON ke_mean = 0.0000000000000E+00
4249 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4250 (PID.TID 0000.0001) %MON vort_r_min = 0.0000000000000E+00
4251 (PID.TID 0000.0001) %MON vort_r_max = 0.0000000000000E+00
4252 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
4253 (PID.TID 0000.0001) %MON vort_a_sd = 7.5259258474424E-05
4254 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783522345033E-05
4255 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810783121880E-04
4256 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 0.0000000000000E+00
4257 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 0.0000000000000E+00
4258 (PID.TID 0000.0001) // =======================================================
4259 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4260 (PID.TID 0000.0001) // =======================================================
4261 S/R EXTERNAL_FIELDS_LOAD: Reading new data: 12 1 0 0.000000000000E+00
4262 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
4263 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
4264 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
4265 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
4266 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
4267 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
4268 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
4269 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
4270 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
4271 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
4272 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
4273 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
4274 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 0.0000E+00 1.9749E+01 3.6365E+01 1.0765E-01 4.4783E-02 1.8522E+02 7.7658E-09 12 1 5.0000E-01 5.0000E-01
4275 time,fu0,fu1,fu = 0.0000E+00 1.3167E-01 8.3633E-02 1.0765E-01 5.000000000000000E-01 5.000000000000000E-01
4276 cg2d: Sum(rhs),rhsMax = -2.30926389122033E-14 6.10578609137189E+00
4277 (PID.TID 0000.0001) cg2d_init_res = 5.53904960585195E+00
4278 (PID.TID 0000.0001) cg2d_iters = 49
4279 (PID.TID 0000.0001) cg2d_res = 7.50693820073779E-10
4280 (PID.TID 0000.0001) // =======================================================
4281 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4282 (PID.TID 0000.0001) // =======================================================
4283 (PID.TID 0000.0001) %MON time_tsnumber = 1
4284 (PID.TID 0000.0001) %MON time_secondsf = 3.6000000000000E+03
4285 (PID.TID 0000.0001) %MON dynstat_eta_max = 4.7883499216017E-01
4286 (PID.TID 0000.0001) %MON dynstat_eta_min = -3.4030863985822E-01
4287 (PID.TID 0000.0001) %MON dynstat_eta_mean = 6.8702696259820E-18
4288 (PID.TID 0000.0001) %MON dynstat_eta_sd = 8.3879658809608E-02
4289 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0919382592027E-02
4290 (PID.TID 0000.0001) %MON dynstat_uvel_max = 4.9942617082279E-02
4291 (PID.TID 0000.0001) %MON dynstat_uvel_min = -7.3755561882739E-02
4292 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.1083483540148E-04
4293 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 6.0448690470875E-03
4294 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 6.8597449039579E-04
4295 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.0818638846528E-01
4296 (PID.TID 0000.0001) %MON dynstat_vvel_min = -7.3090007143658E-02
4297 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 1.1283735080746E-04
4298 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 5.9247513959043E-03
4299 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 6.6602903764155E-04
4300 (PID.TID 0000.0001) %MON dynstat_wvel_max = 4.5007128250868E-04
4301 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.7660682820929E-04
4302 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.4769036829205E-07
4303 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 1.7448214030023E-05
4304 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 4.4415542204135E-06
4305 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382560242271E+01
4306 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8553134165897E+00
4307 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030167263574E+00
4308 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406497621170E+00
4309 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4632151899063E-02
4310 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715747176514E+01
4311 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144946330873E+01
4312 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721450527859E+01
4313 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858318091113E-01
4314 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1845574942192E-02
4315 (PID.TID 0000.0001) %MON extforcing_qnet_max = 0.0000000000000E+00
4316 (PID.TID 0000.0001) %MON extforcing_qnet_min = 0.0000000000000E+00
4317 (PID.TID 0000.0001) %MON extforcing_qnet_mean = 0.0000000000000E+00
4318 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 0.0000000000000E+00
4319 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 0.0000000000000E+00
4320 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4321 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4322 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4323 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4324 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4325 (PID.TID 0000.0001) %MON extforcing_empmr_max = 0.0000000000000E+00
4326 (PID.TID 0000.0001) %MON extforcing_empmr_min = 0.0000000000000E+00
4327 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 0.0000000000000E+00
4328 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 0.0000000000000E+00
4329 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 0.0000000000000E+00
4330 (PID.TID 0000.0001) %MON extforcing_fu_max = 0.0000000000000E+00
4331 (PID.TID 0000.0001) %MON extforcing_fu_min = 0.0000000000000E+00
4332 (PID.TID 0000.0001) %MON extforcing_fu_mean = 0.0000000000000E+00
4333 (PID.TID 0000.0001) %MON extforcing_fu_sd = 0.0000000000000E+00
4334 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 0.0000000000000E+00
4335 (PID.TID 0000.0001) %MON extforcing_fv_max = 0.0000000000000E+00
4336 (PID.TID 0000.0001) %MON extforcing_fv_min = 0.0000000000000E+00
4337 (PID.TID 0000.0001) %MON extforcing_fv_mean = 0.0000000000000E+00
4338 (PID.TID 0000.0001) %MON extforcing_fv_sd = 0.0000000000000E+00
4339 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 0.0000000000000E+00
4340 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.8067110054872E-04
4341 (PID.TID 0000.0001) %MON advcfl_vvel_max = 1.2743531301164E-03
4342 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.4347868463013E-03
4343 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 6.8938825412823E-03
4344 (PID.TID 0000.0001) %MON pe_b_mean = 9.3729820076168E-06
4345 (PID.TID 0000.0001) %MON ke_max = 2.9553400625943E-03
4346 (PID.TID 0000.0001) %MON ke_mean = 3.3082111858406E-05
4347 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4348 (PID.TID 0000.0001) %MON vort_r_min = -3.9597249380080E-07
4349 (PID.TID 0000.0001) %MON vort_r_max = 3.5145614217471E-07
4350 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
4351 (PID.TID 0000.0001) %MON vort_a_sd = 7.5259122244102E-05
4352 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783522345033E-05
4353 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810870562703E-04
4354 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 1.8634237353357E-05
4355 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 6.0726603853642E-07
4356 (PID.TID 0000.0001) // =======================================================
4357 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4358 (PID.TID 0000.0001) // =======================================================
4359 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 3.6000E+03 1.9747E+01 3.6365E+01 1.0758E-01 4.4834E-02 1.8518E+02 7.7658E-09 12 1 5.0139E-01 4.9861E-01
4360 time,fu0,fu1,fu = 3.6000E+03 1.3167E-01 8.3633E-02 1.0758E-01 5.013888888888889E-01 4.986111111111111E-01
4361 cg2d: Sum(rhs),rhsMax = 2.83758459984195E-01 7.39321251911014E+00
4362 (PID.TID 0000.0001) cg2d_init_res = 1.84797885657300E+00
4363 (PID.TID 0000.0001) cg2d_iters = 48
4364 (PID.TID 0000.0001) cg2d_res = 7.82592166265170E-10
4365 (PID.TID 0000.0001) // =======================================================
4366 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4367 (PID.TID 0000.0001) // =======================================================
4368 (PID.TID 0000.0001) %MON time_tsnumber = 2
4369 (PID.TID 0000.0001) %MON time_secondsf = 7.2000000000000E+03
4370 (PID.TID 0000.0001) %MON dynstat_eta_max = 6.9525330368957E-01
4371 (PID.TID 0000.0001) %MON dynstat_eta_min = -6.2457069917824E-01
4372 (PID.TID 0000.0001) %MON dynstat_eta_mean = -3.9003462654922E-04
4373 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.7543128720152E-01
4374 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3995036634224E-02
4375 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.0400023064373E-01
4376 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.3148852856985E-01
4377 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.4312979629337E-04
4378 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.0603054897577E-02
4379 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.3042555912891E-03
4380 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.8758155487040E-01
4381 (PID.TID 0000.0001) %MON dynstat_vvel_min = -1.5545567023260E-01
4382 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -2.5009170150996E-04
4383 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.0967738569425E-02
4384 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.2734516067214E-03
4385 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.6834832558563E-04
4386 (PID.TID 0000.0001) %MON dynstat_wvel_min = -5.3117919195944E-04
4387 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.7606160998080E-07
4388 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.1579976027660E-05
4389 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 7.8805046050787E-06
4390 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9372776525416E+01
4391 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8554552702312E+00
4392 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6029375703596E+00
4393 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4403094023939E+00
4394 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4551906119548E-02
4395 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746931265E+01
4396 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145180935236E+01
4397 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721453408501E+01
4398 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858278960022E-01
4399 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1841498034175E-02
4400 (PID.TID 0000.0001) %MON extforcing_qnet_max = 6.7900181122401E+02
4401 (PID.TID 0000.0001) %MON extforcing_qnet_min = -1.8270316622943E+03
4402 (PID.TID 0000.0001) %MON extforcing_qnet_mean = 2.5845047290899E+02
4403 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 2.8487474022819E+02
4404 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 7.3794195097283E+00
4405 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4406 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4407 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4408 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4409 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4410 (PID.TID 0000.0001) %MON extforcing_empmr_max = 6.0200002610279E-06
4411 (PID.TID 0000.0001) %MON extforcing_empmr_min = 5.2456490727337E-09
4412 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 1.1159324037381E-07
4413 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 2.0328445137847E-07
4414 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 9.9879337966753E-09
4415 (PID.TID 0000.0001) %MON extforcing_fu_max = 2.7615547033771E-02
4416 (PID.TID 0000.0001) %MON extforcing_fu_min = -6.3877862449486E-03
4417 (PID.TID 0000.0001) %MON extforcing_fu_mean = 1.6000546340992E-04
4418 (PID.TID 0000.0001) %MON extforcing_fu_sd = 1.2754044003280E-03
4419 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 1.4106264138583E-04
4420 (PID.TID 0000.0001) %MON extforcing_fv_max = 3.5583858311786E-02
4421 (PID.TID 0000.0001) %MON extforcing_fv_min = -1.4894198834755E-02
4422 (PID.TID 0000.0001) %MON extforcing_fv_mean = 6.2942546478101E-05
4423 (PID.TID 0000.0001) %MON extforcing_fv_sd = 1.6757671803764E-03
4424 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 1.5911884213344E-04
4425 (PID.TID 0000.0001) %MON advcfl_uvel_max = 1.5591674049749E-03
4426 (PID.TID 0000.0001) %MON advcfl_vvel_max = 2.2095676266882E-03
4427 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.0464139357580E-02
4428 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3258665529140E-02
4429 (PID.TID 0000.0001) %MON pe_b_mean = 4.1005390471532E-05
4430 (PID.TID 0000.0001) %MON ke_max = 1.2599884923648E-02
4431 (PID.TID 0000.0001) %MON ke_mean = 1.0761553277162E-04
4432 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4433 (PID.TID 0000.0001) %MON vort_r_min = -6.8428322652921E-07
4434 (PID.TID 0000.0001) %MON vort_r_max = 6.0938063053138E-07
4435 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
4436 (PID.TID 0000.0001) %MON vort_a_sd = 7.5258593052697E-05
4437 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783519155748E-05
4438 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810802998040E-04
4439 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.1507147758130E-05
4440 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.1019885492145E-06
4441 (PID.TID 0000.0001) // =======================================================
4442 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4443 (PID.TID 0000.0001) // =======================================================
4444 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 7.2000E+03 1.9745E+01 3.6365E+01 1.0752E-01 4.4885E-02 1.8514E+02 7.7658E-09 12 1 5.0278E-01 4.9722E-01
4445 time,fu0,fu1,fu = 7.2000E+03 1.3167E-01 8.3633E-02 1.0752E-01 5.027777777777778E-01 4.972222222222222E-01
4446 cg2d: Sum(rhs),rhsMax = 5.75784924929373E-01 7.19620648890585E+00
4447 (PID.TID 0000.0001) cg2d_init_res = 1.39858825756087E+00
4448 (PID.TID 0000.0001) cg2d_iters = 48
4449 (PID.TID 0000.0001) cg2d_res = 8.54690274156377E-10
4450 (PID.TID 0000.0001) // =======================================================
4451 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4452 (PID.TID 0000.0001) // =======================================================
4453 (PID.TID 0000.0001) %MON time_tsnumber = 3
4454 (PID.TID 0000.0001) %MON time_secondsf = 1.0800000000000E+04
4455 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1440618209100E-01
4456 (PID.TID 0000.0001) %MON dynstat_eta_min = -8.1944926847391E-01
4457 (PID.TID 0000.0001) %MON dynstat_eta_mean = -7.7034463540307E-04
4458 (PID.TID 0000.0001) %MON dynstat_eta_sd = 2.5272794264937E-01
4459 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3936625840693E-02
4460 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.5259145693264E-01
4461 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.8823399084357E-01
4462 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.2029707346446E-03
4463 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.3651297867345E-02
4464 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.8442558541070E-03
4465 (PID.TID 0000.0001) %MON dynstat_vvel_max = 2.6296604712235E-01
4466 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.3199059297963E-01
4467 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -8.1253209551069E-04
4468 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.4624778881064E-02
4469 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.8033386180076E-03
4470 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.2503822316830E-03
4471 (PID.TID 0000.0001) %MON dynstat_wvel_min = -7.6794200987736E-04
4472 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.1950946140250E-07
4473 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.1390880273002E-05
4474 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.0520812989263E-05
4475 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9363891827602E+01
4476 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556103768461E+00
4477 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028842940355E+00
4478 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4400199441507E+00
4479 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4450892542970E-02
4480 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746905149E+01
4481 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145482716327E+01
4482 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721456643213E+01
4483 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858332479287E-01
4484 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1835930288343E-02
4485 (PID.TID 0000.0001) %MON extforcing_qnet_max = 6.2177384837990E+02
4486 (PID.TID 0000.0001) %MON extforcing_qnet_min = -1.8650271258907E+03
4487 (PID.TID 0000.0001) %MON extforcing_qnet_mean = 2.1724294059660E+02
4488 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 2.7028949194798E+02
4489 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 7.2041916607572E+00
4490 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4491 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4492 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4493 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4494 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4495 (PID.TID 0000.0001) %MON extforcing_empmr_max = 5.9730586359924E-06
4496 (PID.TID 0000.0001) %MON extforcing_empmr_min = 5.2239793285695E-09
4497 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 1.0881091919987E-07
4498 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 2.0123199290352E-07
4499 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 9.8727073194452E-09
4500 (PID.TID 0000.0001) %MON extforcing_fu_max = 5.3345734315223E-02
4501 (PID.TID 0000.0001) %MON extforcing_fu_min = -1.7067926368962E-02
4502 (PID.TID 0000.0001) %MON extforcing_fu_mean = 3.3671925090563E-04
4503 (PID.TID 0000.0001) %MON extforcing_fu_sd = 2.2489067161895E-03
4504 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 2.2186083447314E-04
4505 (PID.TID 0000.0001) %MON extforcing_fv_max = 5.9708099460676E-02
4506 (PID.TID 0000.0001) %MON extforcing_fv_min = -1.3725375941107E-02
4507 (PID.TID 0000.0001) %MON extforcing_fv_mean = 2.3276855059912E-04
4508 (PID.TID 0000.0001) %MON extforcing_fv_sd = 3.7096388214878E-03
4509 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 2.5927873132295E-04
4510 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.2320449260768E-03
4511 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.0975394411308E-03
4512 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.5028747056717E-02
4513 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.8993741551553E-02
4514 (PID.TID 0000.0001) %MON pe_b_mean = 8.5097204117972E-05
4515 (PID.TID 0000.0001) %MON ke_max = 2.6306502309829E-02
4516 (PID.TID 0000.0001) %MON ke_mean = 1.8580640863082E-04
4517 (PID.TID 0000.0001) %MON ke_vol = 1.3398023034343E+18
4518 (PID.TID 0000.0001) %MON vort_r_min = -9.5463965040653E-07
4519 (PID.TID 0000.0001) %MON vort_r_max = 8.5427597459929E-07
4520 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
4521 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257995700711E-05
4522 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783516359113E-05
4523 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810708856833E-04
4524 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.2757875257758E-05
4525 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.3022920333923E-06
4526 (PID.TID 0000.0001) // =======================================================
4527 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4528 (PID.TID 0000.0001) // =======================================================
4529 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 1.0800E+04 1.9743E+01 3.6365E+01 1.0745E-01 4.4936E-02 1.8510E+02 7.7658E-09 12 1 5.0417E-01 4.9583E-01
4530 time,fu0,fu1,fu = 1.0800E+04 1.3167E-01 8.3633E-02 1.0745E-01 5.041666666666667E-01 4.958333333333333E-01
4531 cg2d: Sum(rhs),rhsMax = 8.63549989986012E-01 6.97143505122534E+00
4532 (PID.TID 0000.0001) cg2d_init_res = 1.13007508680503E+00
4533 (PID.TID 0000.0001) cg2d_iters = 48
4534 (PID.TID 0000.0001) cg2d_res = 7.09284970855499E-10
4535 (PID.TID 0000.0001) // =======================================================
4536 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4537 (PID.TID 0000.0001) // =======================================================
4538 (PID.TID 0000.0001) %MON time_tsnumber = 4
4539 (PID.TID 0000.0001) %MON time_secondsf = 1.4400000000000E+04
4540 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0448010660392E+00
4541 (PID.TID 0000.0001) %MON dynstat_eta_min = -9.3830074403222E-01
4542 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.1192595921646E-03
4543 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.0824127093880E-01
4544 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3412646117909E-02
4545 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.9675836795109E-01
4546 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.4218888170137E-01
4547 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.8823455984739E-03
4548 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.5907921336472E-02
4549 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 2.3193104663148E-03
4550 (PID.TID 0000.0001) %MON dynstat_vvel_max = 3.3469635093610E-01
4551 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.0237558317302E-01
4552 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.3984005091141E-03
4553 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.7151520465856E-02
4554 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 2.2657581128376E-03
4555 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.6041759979924E-03
4556 (PID.TID 0000.0001) %MON dynstat_wvel_min = -9.8917834491300E-04
4557 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -2.0027800345035E-07
4558 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.7890518498723E-05
4559 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.2553609563016E-05
4560 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9355311521602E+01
4561 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556828393219E+00
4562 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028430406541E+00
4563 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4397482255833E+00
4564 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4334837108920E-02
4565 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746809096E+01
4566 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145845660490E+01
4567 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721460038099E+01
4568 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858551838327E-01
4569 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1829655766437E-02
4570 (PID.TID 0000.0001) %MON extforcing_qnet_max = 5.9998458801755E+02
4571 (PID.TID 0000.0001) %MON extforcing_qnet_min = -2.3689635244619E+02
4572 (PID.TID 0000.0001) %MON extforcing_qnet_mean = 2.0527597306845E+02
4573 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 2.5967497752707E+02
4574 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 4.7583317247375E+00
4575 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4576 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4577 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4578 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4579 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4580 (PID.TID 0000.0001) %MON extforcing_empmr_max = 6.6616445661475E-07
4581 (PID.TID 0000.0001) %MON extforcing_empmr_min = 5.1976571641228E-09
4582 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 9.9828445962315E-08
4583 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 7.4058454913877E-08
4584 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 2.6180883233351E-09
4585 (PID.TID 0000.0001) %MON extforcing_fu_max = 3.0172431934137E-02
4586 (PID.TID 0000.0001) %MON extforcing_fu_min = -5.0299712260105E-02
4587 (PID.TID 0000.0001) %MON extforcing_fu_mean = 1.4569838195398E-04
4588 (PID.TID 0000.0001) %MON extforcing_fu_sd = 3.3351027614573E-03
4589 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 3.3267650750604E-04
4590 (PID.TID 0000.0001) %MON extforcing_fv_max = 3.3264070379462E-02
4591 (PID.TID 0000.0001) %MON extforcing_fv_min = -1.3194802198306E-02
4592 (PID.TID 0000.0001) %MON extforcing_fv_mean = 3.2553601509114E-04
4593 (PID.TID 0000.0001) %MON extforcing_fv_sd = 3.4287512898736E-03
4594 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 3.2815628279372E-04
4595 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.8718323514854E-03
4596 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.9424677032346E-03
4597 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.9246794319786E-02
4598 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.4276211796620E-02
4599 (PID.TID 0000.0001) %MON pe_b_mean = 1.2658430388162E-04
4600 (PID.TID 0000.0001) %MON ke_max = 4.2178007399275E-02
4601 (PID.TID 0000.0001) %MON ke_mean = 2.5526389432245E-04
4602 (PID.TID 0000.0001) %MON ke_vol = 1.3398021650446E+18
4603 (PID.TID 0000.0001) %MON vort_r_min = -1.2138681740938E-06
4604 (PID.TID 0000.0001) %MON vort_r_max = 1.0873002599371E-06
4605 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
4606 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257527710702E-05
4607 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783512811909E-05
4608 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810633081015E-04
4609 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.8146026718146E-05
4610 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.2423070809614E-06
4611 (PID.TID 0000.0001) // =======================================================
4612 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4613 (PID.TID 0000.0001) // =======================================================
4614 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 1.4400E+04 1.9741E+01 3.6365E+01 1.0738E-01 4.4986E-02 1.8506E+02 7.7658E-09 12 1 5.0556E-01 4.9444E-01
4615 time,fu0,fu1,fu = 1.4400E+04 1.3167E-01 8.3633E-02 1.0738E-01 5.055555555555555E-01 4.944444444444445E-01
4616 cg2d: Sum(rhs),rhsMax = 1.14066129855975E+00 6.87396504344684E+00
4617 (PID.TID 0000.0001) cg2d_init_res = 9.39444559100724E-01
4618 (PID.TID 0000.0001) cg2d_iters = 47
4619 (PID.TID 0000.0001) cg2d_res = 9.74793509536074E-10
4620 (PID.TID 0000.0001) // =======================================================
4621 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4622 (PID.TID 0000.0001) // =======================================================
4623 (PID.TID 0000.0001) %MON time_tsnumber = 5
4624 (PID.TID 0000.0001) %MON time_secondsf = 1.8000000000000E+04
4625 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0999010826655E+00
4626 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.0583608439229E+00
4627 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.4577571552706E-03
4628 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.4219510742357E-01
4629 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3272222829212E-02
4630 (PID.TID 0000.0001) %MON dynstat_uvel_max = 2.3755745639100E-01
4631 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.9216118394514E-01
4632 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -2.3677620807222E-03
4633 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.7688242304349E-02
4634 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 2.7458652984236E-03
4635 (PID.TID 0000.0001) %MON dynstat_vvel_max = 4.0197842637109E-01
4636 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.6776200122398E-01
4637 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.9013948868810E-03
4638 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.8879920444947E-02
4639 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 2.6731104798124E-03
4640 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.9358812195278E-03
4641 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.1954539974346E-03
4642 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -4.8313893446629E-08
4643 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 5.1976232750571E-05
4644 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.4111392976530E-05
4645 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9347054761730E+01
4646 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556371379556E+00
4647 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028077986837E+00
4648 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4394908615471E+00
4649 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4206532230092E-02
4650 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746705954E+01
4651 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8146261213062E+01
4652 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721463672910E+01
4653 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858780360013E-01
4654 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1822841410529E-02
4655 (PID.TID 0000.0001) %MON extforcing_qnet_max = 5.7824479464126E+02
4656 (PID.TID 0000.0001) %MON extforcing_qnet_min = -2.4448612662258E+02
4657 (PID.TID 0000.0001) %MON extforcing_qnet_mean = 1.9389949970235E+02
4658 (PID.TID 0000.0001) %MON extforcing_qnet_sd = 2.5588214388930E+02
4659 (PID.TID 0000.0001) %MON extforcing_qnet_del2 = 4.4402224917761E+00
4660 (PID.TID 0000.0001) %MON extforcing_qsw_max = 0.0000000000000E+00
4661 (PID.TID 0000.0001) %MON extforcing_qsw_min = 0.0000000000000E+00
4662 (PID.TID 0000.0001) %MON extforcing_qsw_mean = 0.0000000000000E+00
4663 (PID.TID 0000.0001) %MON extforcing_qsw_sd = 0.0000000000000E+00
4664 (PID.TID 0000.0001) %MON extforcing_qsw_del2 = 0.0000000000000E+00
4665 (PID.TID 0000.0001) %MON extforcing_empmr_max = 9.1902377569023E-07
4666 (PID.TID 0000.0001) %MON extforcing_empmr_min = 5.1749459170943E-09
4667 (PID.TID 0000.0001) %MON extforcing_empmr_mean = 9.6847913888620E-08
4668 (PID.TID 0000.0001) %MON extforcing_empmr_sd = 6.9304448667340E-08
4669 (PID.TID 0000.0001) %MON extforcing_empmr_del2 = 1.9096720962486E-09
4670 (PID.TID 0000.0001) %MON extforcing_fu_max = 2.0326025608244E-02
4671 (PID.TID 0000.0001) %MON extforcing_fu_min = -3.5503462934682E-02
4672 (PID.TID 0000.0001) %MON extforcing_fu_mean = -5.9122434827985E-05
4673 (PID.TID 0000.0001) %MON extforcing_fu_sd = 3.8776358623709E-03
4674 (PID.TID 0000.0001) %MON extforcing_fu_del2 = 4.8469204661317E-04
4675 (PID.TID 0000.0001) %MON extforcing_fv_max = 2.8978209676964E-02
4676 (PID.TID 0000.0001) %MON extforcing_fv_min = -2.7562968897658E-02
4677 (PID.TID 0000.0001) %MON extforcing_fv_mean = 2.4975440862400E-04
4678 (PID.TID 0000.0001) %MON extforcing_fv_sd = 3.8084111836790E-03
4679 (PID.TID 0000.0001) %MON extforcing_fv_del2 = 4.5606539078919E-04
4680 (PID.TID 0000.0001) %MON advcfl_uvel_max = 3.4643949549117E-03
4681 (PID.TID 0000.0001) %MON advcfl_vvel_max = 4.7349992282039E-03
4682 (PID.TID 0000.0001) %MON advcfl_wvel_max = 2.3205999509170E-02
4683 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.9235031912899E-02
4684 (PID.TID 0000.0001) %MON pe_b_mean = 1.5600896542006E-04
4685 (PID.TID 0000.0001) %MON ke_max = 5.9578471215927E-02
4686 (PID.TID 0000.0001) %MON ke_mean = 3.1335272133236E-04
4687 (PID.TID 0000.0001) %MON ke_vol = 1.3398020380790E+18
4688 (PID.TID 0000.0001) %MON vort_r_min = -1.4599028434069E-06
4689 (PID.TID 0000.0001) %MON vort_r_max = 1.3058739548847E-06
4690 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
4691 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257267494359E-05
4692 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783510593682E-05
4693 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810582598720E-04
4694 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.1397609794992E-05
4695 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 9.5437859326701E-07
4696 (PID.TID 0000.0001) // =======================================================
4697 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4698 (PID.TID 0000.0001) // =======================================================
4699 (PID.TID 0000.0001) %CHECKPOINT 5 ckptA
4700 (PID.TID 0000.0001) Seconds in section "ALL [THE_MODEL_MAIN]":
4701 (PID.TID 0000.0001) User time: 7.32000017166138
4702 (PID.TID 0000.0001) System time: 0.540000012144446
4703 (PID.TID 0000.0001) Wall clock time: 28.3474400043488
4704 (PID.TID 0000.0001) No. starts: 1
4705 (PID.TID 0000.0001) No. stops: 1
4706 (PID.TID 0000.0001) Seconds in section "INITIALISE_FIXED [THE_MODEL_MAIN]":
4707 (PID.TID 0000.0001) User time: 0.270000010728836
4708 (PID.TID 0000.0001) System time: 0.130000000819564
4709 (PID.TID 0000.0001) Wall clock time: 1.96254301071167
4710 (PID.TID 0000.0001) No. starts: 1
4711 (PID.TID 0000.0001) No. stops: 1
4712 (PID.TID 0000.0001) Seconds in section "THE_MAIN_LOOP [THE_MODEL_MAIN]":
4713 (PID.TID 0000.0001) User time: 6.94000002741814
4714 (PID.TID 0000.0001) System time: 0.290000006556511
4715 (PID.TID 0000.0001) Wall clock time: 24.8941640853882
4716 (PID.TID 0000.0001) No. starts: 1
4717 (PID.TID 0000.0001) No. stops: 1
4718 (PID.TID 0000.0001) Seconds in section "INITIALISE_VARIA [THE_MAIN_LOOP]":
4719 (PID.TID 0000.0001) User time: 0.569999963045120
4720 (PID.TID 0000.0001) System time: 0.149999991059303
4721 (PID.TID 0000.0001) Wall clock time: 0.976671934127808
4722 (PID.TID 0000.0001) No. starts: 1
4723 (PID.TID 0000.0001) No. stops: 1
4724 (PID.TID 0000.0001) Seconds in section "MAIN LOOP [THE_MAIN_LOOP]":
4725 (PID.TID 0000.0001) User time: 6.37000006437302
4726 (PID.TID 0000.0001) System time: 0.140000015497208
4727 (PID.TID 0000.0001) Wall clock time: 23.9174368381500
4728 (PID.TID 0000.0001) No. starts: 1
4729 (PID.TID 0000.0001) No. stops: 1
4730 (PID.TID 0000.0001) Seconds in section "FORWARD_STEP [THE_MAIN_LOOP]":
4731 (PID.TID 0000.0001) User time: 6.37000006437302
4732 (PID.TID 0000.0001) System time: 0.140000015497208
4733 (PID.TID 0000.0001) Wall clock time: 23.9173309803009
4734 (PID.TID 0000.0001) No. starts: 5
4735 (PID.TID 0000.0001) No. stops: 5
4736 (PID.TID 0000.0001) Seconds in section "LOAD_FIELDS_DRIVER [FORWARD_STEP]":
4737 (PID.TID 0000.0001) User time: 2.000004053115845E-002
4738 (PID.TID 0000.0001) System time: 1.000002026557922E-002
4739 (PID.TID 0000.0001) Wall clock time: 4.099631309509277E-002
4740 (PID.TID 0000.0001) No. starts: 5
4741 (PID.TID 0000.0001) No. stops: 5
4742 (PID.TID 0000.0001) Seconds in section "EXTERNAL_FLDS_LOAD [LOAD_FLDS_DRIVER]":
4743 (PID.TID 0000.0001) User time: 2.000004053115845E-002
4744 (PID.TID 0000.0001) System time: 1.000002026557922E-002
4745 (PID.TID 0000.0001) Wall clock time: 4.081392288208008E-002
4746 (PID.TID 0000.0001) No. starts: 5
4747 (PID.TID 0000.0001) No. stops: 5
4748 (PID.TID 0000.0001) Seconds in section "CPL_EXPORT-IMPORT [FORWARD_STEP]":
4749 (PID.TID 0000.0001) User time: 3.999996185302734E-002
4750 (PID.TID 0000.0001) System time: 9.999990463256836E-003
4751 (PID.TID 0000.0001) Wall clock time: 16.2217087745667