/[MITgcm]/MITgcm/verification/cpl_aim+ocn/results/ocnSTDOUT.0000
ViewVC logotype

Contents of /MITgcm/verification/cpl_aim+ocn/results/ocnSTDOUT.0000

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph


Revision 1.2 - (show annotations) (download)
Mon Nov 15 01:12:18 2004 UTC (17 years ago) by jmc
Branch: MAIN
CVS Tags: checkpoint57b_post, checkpoint57c_pre, checkpoint56b_post, checkpoint56c_post, checkpoint57a_post, checkpoint57a_pre, checkpoint57, checkpoint56, checkpoint57c_post, checkpoint56a_post
Changes since 1.1: +353 -335 lines
output generated with "-ieee" option (on myrinet cluster, with ifc)

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint55j_post
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: myrinet-4-28
11 (PID.TID 0000.0001) // Build date: Sun Nov 14 19:41:48 EST 2004
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx - No. threads per process in X
19 (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20 (PID.TID 0000.0001) > &EEPARMS
21 (PID.TID 0000.0001) > useCoupler=.TRUE.,
22 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
23 (PID.TID 0000.0001) > nTx=1,nTy=1
24 (PID.TID 0000.0001) > &
25 (PID.TID 0000.0001) ># Note: Some systems use & as the
26 (PID.TID 0000.0001) ># namelist terminator. Other systems
27 (PID.TID 0000.0001) ># use a / character (as shown here).
28 (PID.TID 0000.0001)
29 (PID.TID 0000.0001) // =======================================================
30 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
31 (PID.TID 0000.0001) // ( and "eedata" )
32 (PID.TID 0000.0001) // =======================================================
33 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
34 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
35 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
36 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
37 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
38 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
39 (PID.TID 0000.0001) OLx = 2 ; /* Tile overlap distance in X */
40 (PID.TID 0000.0001) OLy = 2 ; /* Tile overlap distance in Y */
41 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
42 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
43 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
44 (PID.TID 0000.0001) nX = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
45 (PID.TID 0000.0001) nY = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
46 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
47 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
48 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
49 (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
50 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
51 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
52 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
53 (PID.TID 0000.0001) useCoupler= T ; /* Flag used to control communications with */
54 (PID.TID 0000.0001) /* other model components, through a coupler */
55 (PID.TID 0000.0001)
56 (PID.TID 0000.0001) ======= Starting MPI parallel Run =========
57 (PID.TID 0000.0001) My Processor Name = myrinet-3-22
58 (PID.TID 0000.0001) Located at ( 0, 0) on processor grid (0: 0,0: 0)
59 (PID.TID 0000.0001) Origin at ( 1, 1) on global grid (1: 192,1: 32)
60 (PID.TID 0000.0001) North neighbor = processor 0000
61 (PID.TID 0000.0001) South neighbor = processor 0000
62 (PID.TID 0000.0001) East neighbor = processor 0000
63 (PID.TID 0000.0001) West neighbor = processor 0000
64 (PID.TID 0000.0001) // ======================================================
65 (PID.TID 0000.0001) // Mapping of tiles to threads
66 (PID.TID 0000.0001) // ======================================================
67 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
68 (PID.TID 0000.0001)
69 (PID.TID 0000.0001) // ======================================================
70 (PID.TID 0000.0001) // Tile <-> Tile connectvity table
71 (PID.TID 0000.0001) // ======================================================
72 (PID.TID 0000.0001) // Tile number: 000001 (process no. = 000000)
73 (PID.TID 0000.0001) // WEST: Tile = 000006, Process = 000000, Comm = put
74 (PID.TID 0000.0001) // bi = 000006, bj = 000001
75 (PID.TID 0000.0001) // EAST: Tile = 000002, Process = 000000, Comm = put
76 (PID.TID 0000.0001) // bi = 000002, bj = 000001
77 (PID.TID 0000.0001) // SOUTH: Tile = 000001, Process = 000000, Comm = put
78 (PID.TID 0000.0001) // bi = 000001, bj = 000001
79 (PID.TID 0000.0001) // NORTH: Tile = 000001, Process = 000000, Comm = put
80 (PID.TID 0000.0001) // bi = 000001, bj = 000001
81 (PID.TID 0000.0001) // Tile number: 000002 (process no. = 000000)
82 (PID.TID 0000.0001) // WEST: Tile = 000001, Process = 000000, Comm = put
83 (PID.TID 0000.0001) // bi = 000001, bj = 000001
84 (PID.TID 0000.0001) // EAST: Tile = 000003, Process = 000000, Comm = put
85 (PID.TID 0000.0001) // bi = 000003, bj = 000001
86 (PID.TID 0000.0001) // SOUTH: Tile = 000002, Process = 000000, Comm = put
87 (PID.TID 0000.0001) // bi = 000002, bj = 000001
88 (PID.TID 0000.0001) // NORTH: Tile = 000002, Process = 000000, Comm = put
89 (PID.TID 0000.0001) // bi = 000002, bj = 000001
90 (PID.TID 0000.0001) // Tile number: 000003 (process no. = 000000)
91 (PID.TID 0000.0001) // WEST: Tile = 000002, Process = 000000, Comm = put
92 (PID.TID 0000.0001) // bi = 000002, bj = 000001
93 (PID.TID 0000.0001) // EAST: Tile = 000004, Process = 000000, Comm = put
94 (PID.TID 0000.0001) // bi = 000004, bj = 000001
95 (PID.TID 0000.0001) // SOUTH: Tile = 000003, Process = 000000, Comm = put
96 (PID.TID 0000.0001) // bi = 000003, bj = 000001
97 (PID.TID 0000.0001) // NORTH: Tile = 000003, Process = 000000, Comm = put
98 (PID.TID 0000.0001) // bi = 000003, bj = 000001
99 (PID.TID 0000.0001) // Tile number: 000004 (process no. = 000000)
100 (PID.TID 0000.0001) // WEST: Tile = 000003, Process = 000000, Comm = put
101 (PID.TID 0000.0001) // bi = 000003, bj = 000001
102 (PID.TID 0000.0001) // EAST: Tile = 000005, Process = 000000, Comm = put
103 (PID.TID 0000.0001) // bi = 000005, bj = 000001
104 (PID.TID 0000.0001) // SOUTH: Tile = 000004, Process = 000000, Comm = put
105 (PID.TID 0000.0001) // bi = 000004, bj = 000001
106 (PID.TID 0000.0001) // NORTH: Tile = 000004, Process = 000000, Comm = put
107 (PID.TID 0000.0001) // bi = 000004, bj = 000001
108 (PID.TID 0000.0001) // Tile number: 000005 (process no. = 000000)
109 (PID.TID 0000.0001) // WEST: Tile = 000004, Process = 000000, Comm = put
110 (PID.TID 0000.0001) // bi = 000004, bj = 000001
111 (PID.TID 0000.0001) // EAST: Tile = 000006, Process = 000000, Comm = put
112 (PID.TID 0000.0001) // bi = 000006, bj = 000001
113 (PID.TID 0000.0001) // SOUTH: Tile = 000005, Process = 000000, Comm = put
114 (PID.TID 0000.0001) // bi = 000005, bj = 000001
115 (PID.TID 0000.0001) // NORTH: Tile = 000005, Process = 000000, Comm = put
116 (PID.TID 0000.0001) // bi = 000005, bj = 000001
117 (PID.TID 0000.0001) // Tile number: 000006 (process no. = 000000)
118 (PID.TID 0000.0001) // WEST: Tile = 000005, Process = 000000, Comm = put
119 (PID.TID 0000.0001) // bi = 000005, bj = 000001
120 (PID.TID 0000.0001) // EAST: Tile = 000001, Process = 000000, Comm = put
121 (PID.TID 0000.0001) // bi = 000001, bj = 000001
122 (PID.TID 0000.0001) // SOUTH: Tile = 000006, Process = 000000, Comm = put
123 (PID.TID 0000.0001) // bi = 000006, bj = 000001
124 (PID.TID 0000.0001) // NORTH: Tile = 000006, Process = 000000, Comm = put
125 (PID.TID 0000.0001) // bi = 000006, bj = 000001
126 (PID.TID 0000.0001)
127 (PID.TID 0000.0001) ===== W2 TILE TOPLOGY =====
128 (PID.TID 0000.0001) TILE: 1
129 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
130 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
131 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
132 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
133 (PID.TID 0000.0001) TILE: 2
134 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 3 Comm = PUT ( PROC = 1)
135 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 6 Comm = PUT ( PROC = 1)
136 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
137 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
138 (PID.TID 0000.0001) TILE: 3
139 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
140 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
141 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 4 Comm = PUT ( PROC = 1)
142 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 1 Comm = PUT ( PROC = 1)
143 (PID.TID 0000.0001) TILE: 4
144 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 5 Comm = PUT ( PROC = 1)
145 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 2 Comm = PUT ( PROC = 1)
146 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
147 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
148 (PID.TID 0000.0001) TILE: 5
149 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
150 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
151 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 6 Comm = PUT ( PROC = 1)
152 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 3 Comm = PUT ( PROC = 1)
153 (PID.TID 0000.0001) TILE: 6
154 (PID.TID 0000.0001) NEIGHBOUR 1 = TILE 1 Comm = PUT ( PROC = 1)
155 (PID.TID 0000.0001) NEIGHBOUR 2 = TILE 4 Comm = PUT ( PROC = 1)
156 (PID.TID 0000.0001) NEIGHBOUR 3 = TILE 2 Comm = PUT ( PROC = 1)
157 (PID.TID 0000.0001) NEIGHBOUR 4 = TILE 5 Comm = PUT ( PROC = 1)
158 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 34: -1, j= 31: 32
159 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 3(proc = 1)
160 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= -1: 34, j= 1: 2
161 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 6(proc = 1)
162 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 31: 32, j= -1: 34
163 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 2(proc = 1)
164 (PID.TID 0000.0001) Tile 1(proc = 1) sends points i= 1: 2, j= 34: -1
165 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 5(proc = 1)
166 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= -1: 34, j= 31: 32
167 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 3(proc = 1)
168 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 34: -1, j= 1: 2
169 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 6(proc = 1)
170 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 31: 32, j= 34: -1
171 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 4(proc = 1)
172 (PID.TID 0000.0001) Tile 2(proc = 1) sends points i= 1: 2, j= -1: 34
173 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 1(proc = 1)
174 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 34: -1, j= 31: 32
175 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 5(proc = 1)
176 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= -1: 34, j= 1: 2
177 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 2(proc = 1)
178 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 31: 32, j= -1: 34
179 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 4(proc = 1)
180 (PID.TID 0000.0001) Tile 3(proc = 1) sends points i= 1: 2, j= 34: -1
181 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 1(proc = 1)
182 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= -1: 34, j= 31: 32
183 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 5(proc = 1)
184 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 34: -1, j= 1: 2
185 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 2(proc = 1)
186 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 31: 32, j= 34: -1
187 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 6(proc = 1)
188 (PID.TID 0000.0001) Tile 4(proc = 1) sends points i= 1: 2, j= -1: 34
189 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 3(proc = 1)
190 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 34: -1, j= 31: 32
191 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 1(proc = 1)
192 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= -1: 34, j= 1: 2
193 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 4(proc = 1)
194 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 31: 32, j= -1: 34
195 (PID.TID 0000.0001) to points i= -1: 0, j= -1: 34 in tile 6(proc = 1)
196 (PID.TID 0000.0001) Tile 5(proc = 1) sends points i= 1: 2, j= 34: -1
197 (PID.TID 0000.0001) to points i= -1: 34, j= 33: 34 in tile 3(proc = 1)
198 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= -1: 34, j= 31: 32
199 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 1(proc = 1)
200 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 34: -1, j= 1: 2
201 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 4(proc = 1)
202 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 31: 32, j= 34: -1
203 (PID.TID 0000.0001) to points i= -1: 34, j= -1: 0 in tile 2(proc = 1)
204 (PID.TID 0000.0001) Tile 6(proc = 1) sends points i= 1: 2, j= -1: 34
205 (PID.TID 0000.0001) to points i= 33: 34, j= -1: 34 in tile 5(proc = 1)
206 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 3(proc = 1)
207 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 6(proc = 1)
208 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 2(proc = 1)
209 (PID.TID 0000.0001) Tile 1(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 5(proc = 1)
210 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 3(proc = 1)
211 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 6(proc = 1)
212 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 4(proc = 1)
213 (PID.TID 0000.0001) Tile 2(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 1(proc = 1)
214 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 5(proc = 1)
215 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 2(proc = 1)
216 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 4(proc = 1)
217 (PID.TID 0000.0001) Tile 3(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 1(proc = 1)
218 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 5(proc = 1)
219 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 2(proc = 1)
220 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 6(proc = 1)
221 (PID.TID 0000.0001) Tile 4(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 3(proc = 1)
222 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 1(proc = 1)
223 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 4(proc = 1)
224 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 6(proc = 1)
225 (PID.TID 0000.0001) Tile 5(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 3(proc = 1)
226 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -1: 34, j= 33: 34from tile 1(proc = 1)
227 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -1: 34, j= -1: 0from tile 4(proc = 1)
228 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= 33: 34, j= -1: 34from tile 2(proc = 1)
229 (PID.TID 0000.0001) Tile 6(proc = 1)recv to points i= -1: 0, j= -1: 34from tile 5(proc = 1)
230 (PID.TID 0000.0001) // =======================================================
231 (PID.TID 0000.0001) // Model parameter file "data"
232 (PID.TID 0000.0001) // =======================================================
233 (PID.TID 0000.0001) ># ====================
234 (PID.TID 0000.0001) ># | Model parameters |
235 (PID.TID 0000.0001) ># ====================
236 (PID.TID 0000.0001) >#
237 (PID.TID 0000.0001) ># Continuous equation parameters
238 (PID.TID 0000.0001) > &PARM01
239 (PID.TID 0000.0001) > tRef=15*20.,
240 (PID.TID 0000.0001) > sRef=15*35.,
241 (PID.TID 0000.0001) > viscAh =3.E5,
242 (PID.TID 0000.0001) > viscAr =1.E-3,
243 (PID.TID 0000.0001) > diffKhT=0.,
244 (PID.TID 0000.0001) > diffK4T=0.,
245 (PID.TID 0000.0001) > diffKrT=3.E-5,
246 (PID.TID 0000.0001) > diffKhS=0.,
247 (PID.TID 0000.0001) > diffK4S=0.,
248 (PID.TID 0000.0001) > diffKrS=3.E-5,
249 (PID.TID 0000.0001) > gravity=9.81,
250 (PID.TID 0000.0001) > rhonil=1035.,
251 (PID.TID 0000.0001) > eosType='JMD95Z',
252 (PID.TID 0000.0001) >#allowFreezing=.TRUE.,
253 (PID.TID 0000.0001) > ivdc_kappa=10.,
254 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
255 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
256 (PID.TID 0000.0001) > exactConserv=.TRUE.,
257 (PID.TID 0000.0001) > select_rStar=2,
258 (PID.TID 0000.0001) > nonlinFreeSurf=4,
259 (PID.TID 0000.0001) > hFacInf=0.2,
260 (PID.TID 0000.0001) > hFacSup=2.0,
261 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
262 (PID.TID 0000.0001) > temp_EvPrRn=0.,
263 (PID.TID 0000.0001) > hFacMin=.1,
264 (PID.TID 0000.0001) > hFacMinDr=20.,
265 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
266 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
267 (PID.TID 0000.0001) > readBinaryPrec=64,
268 (PID.TID 0000.0001) > writeBinaryPrec=64,
269 (PID.TID 0000.0001) >#debugLevel=0,
270 (PID.TID 0000.0001) > &
271 (PID.TID 0000.0001) >
272 (PID.TID 0000.0001) ># Elliptic solver parameters
273 (PID.TID 0000.0001) > &PARM02
274 (PID.TID 0000.0001) > cg2dMaxIters=200,
275 (PID.TID 0000.0001) > cg2dTargetResidual=1.E-9,
276 (PID.TID 0000.0001) >#cg2dTargetResWunit=1.E-14,
277 (PID.TID 0000.0001) > &
278 (PID.TID 0000.0001) >
279 (PID.TID 0000.0001) ># Time stepping parameters
280 (PID.TID 0000.0001) > &PARM03
281 (PID.TID 0000.0001) > nIter0=0,
282 (PID.TID 0000.0001) > nTimeSteps=5,
283 (PID.TID 0000.0001) > deltaTmom =3600.,
284 (PID.TID 0000.0001) > deltaTtracer=3600.,
285 (PID.TID 0000.0001) > deltaTClock =3600.,
286 (PID.TID 0000.0001) > abEps = 0.1,
287 (PID.TID 0000.0001) > pChkptFreq =2592000.,
288 (PID.TID 0000.0001) > taveFreq =2592000.,
289 (PID.TID 0000.0001) > dumpFreq =864000.
290 (PID.TID 0000.0001) > monitorFreq =86400.,
291 (PID.TID 0000.0001) > monitorFreq =1.,
292 (PID.TID 0000.0001) > forcing_In_AB=.FALSE.,
293 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
294 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
295 (PID.TID 0000.0001) > externForcingCycle=31104000.,
296 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
297 (PID.TID 0000.0001) >#tauThetaClimRelax= 5184000.,
298 (PID.TID 0000.0001) ># restoring timescale for salinity: 2yrs, 20 yrs
299 (PID.TID 0000.0001) >#tauSaltClimRelax = 62208000.,
300 (PID.TID 0000.0001) > tauSaltClimRelax = 622080000.,
301 (PID.TID 0000.0001) > &
302 (PID.TID 0000.0001) >
303 (PID.TID 0000.0001) ># Gridding parameters
304 (PID.TID 0000.0001) > &PARM04
305 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
306 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
307 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
308 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
309 (PID.TID 0000.0001) > &
310 (PID.TID 0000.0001) >
311 (PID.TID 0000.0001) ># Input datasets
312 (PID.TID 0000.0001) > &PARM05
313 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
314 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
315 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
316 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
317 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
318 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
319 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
320 (PID.TID 0000.0001) > surfQFile ='shiQnet_cs32.bin',
321 (PID.TID 0000.0001) > EmPmRFile ='shiEmPR_cs32.bin',
322 (PID.TID 0000.0001) > &
323 (PID.TID 0000.0001)
324 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM01
325 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM01 : OK
326 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM02
327 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM02 : OK
328 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM03
329 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM03 : OK
330 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM04
331 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM04 : OK
332 (PID.TID 0000.0001) S/R INI_PARMS ; starts to read PARM05
333 (PID.TID 0000.0001) S/R INI_PARMS ; read PARM05 : OK
334 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
335 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
336 (PID.TID 0000.0001) // =======================================================
337 (PID.TID 0000.0001) // Parameter file "data.pkg"
338 (PID.TID 0000.0001) // =======================================================
339 (PID.TID 0000.0001) ># Packages
340 (PID.TID 0000.0001) > &PACKAGES
341 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
342 (PID.TID 0000.0001) > useMNC=.TRUE.,
343 (PID.TID 0000.0001) > &
344 (PID.TID 0000.0001)
345 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
346 (PID.TID 0000.0001) MNC_READPARMS: opening file 'data.mnc'
347 (PID.TID 0000.0001) // =======================================================
348 (PID.TID 0000.0001) // Parameter file "data.mnc"
349 (PID.TID 0000.0001) // =======================================================
350 (PID.TID 0000.0001) ># Example "data.mnc" file
351 (PID.TID 0000.0001) ># Lines beginning "#" are comments
352 (PID.TID 0000.0001) > &MNC_01
353 (PID.TID 0000.0001) ># mnc_echo_gvtypes=.FALSE.,
354 (PID.TID 0000.0001) ># mnc_use_indir=.FALSE.,
355 (PID.TID 0000.0001) > mnc_use_outdir=.TRUE.,
356 (PID.TID 0000.0001) > mnc_outdir_str='mnc_test_',
357 (PID.TID 0000.0001) ># mnc_outdir_date=.TRUE.,
358 (PID.TID 0000.0001) ># monitor_mnc=.FALSE.,
359 (PID.TID 0000.0001) > snapshot_mnc=.TRUE.,
360 (PID.TID 0000.0001) > timeave_mnc=.TRUE.,
361 (PID.TID 0000.0001) ># pickup_write_mnc=.TRUE.,
362 (PID.TID 0000.0001) > &
363 (PID.TID 0000.0001) ># Note: Some systems use & as the
364 (PID.TID 0000.0001) ># namelist terminator. Other systems
365 (PID.TID 0000.0001) ># use a / character (as shown here).
366 (PID.TID 0000.0001)
367 (PID.TID 0000.0001) MNC_READPARMS: finished reading data.mnc
368 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
369 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
370 (PID.TID 0000.0001) // =======================================================
371 (PID.TID 0000.0001) // Parameter file "data.gmredi"
372 (PID.TID 0000.0001) // =======================================================
373 (PID.TID 0000.0001) ># GM+Redi package parameters:
374 (PID.TID 0000.0001) >
375 (PID.TID 0000.0001) >#-from MOM :
376 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
377 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
378 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
379 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
380 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
381 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
382 (PID.TID 0000.0001) >
383 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
384 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
385 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
386 (PID.TID 0000.0001) >
387 (PID.TID 0000.0001) > &GM_PARM01
388 (PID.TID 0000.0001) > GM_background_K = 800.,
389 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
390 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
391 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
392 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
393 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
394 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
395 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
396 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
397 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
398 (PID.TID 0000.0001) > &end
399 (PID.TID 0000.0001) >
400 (PID.TID 0000.0001) >
401 (PID.TID 0000.0001)
402 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
403 (PID.TID 0000.0001) CPL_READPARMS: opening data.cpl
404 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.cpl
405 (PID.TID 0000.0001) // =======================================================
406 (PID.TID 0000.0001) // Parameter file "data.cpl"
407 (PID.TID 0000.0001) // =======================================================
408 (PID.TID 0000.0001) ># Coupling package parameters, OCN component:
409 (PID.TID 0000.0001) ># cpl_earlyExpImpCall :: call coupler early in the time stepping call sequence
410 (PID.TID 0000.0001) ># useImportHFlx :: True => use the Imported HeatFlux from couler
411 (PID.TID 0000.0001) ># useImportFW :: True => use the Imported Fresh Water flux fr cpl
412 (PID.TID 0000.0001) ># useImportTau :: True => use the Imported Wind-Stress from couler
413 (PID.TID 0000.0001) ># useImportSLP :: True => use the Imported Sea-level Atmos. Pressure
414 (PID.TID 0000.0001) ># useImportSIce :: True => use the Imported Sea-Ice loading
415 (PID.TID 0000.0001) ># cpl_taveFreq :: Frequency^-1 for time-Aver. output (s)
416 (PID.TID 0000.0001) > &CPL_OCN_PARAM
417 (PID.TID 0000.0001) ># cpl_earlyExpImpCall=.FALSE.,
418 (PID.TID 0000.0001) ># useImportHFlx=.FALSE.,
419 (PID.TID 0000.0001) ># useImportFW =.FALSE.,
420 (PID.TID 0000.0001) ># useImportTau =.FALSE.,
421 (PID.TID 0000.0001) > useImportSLP =.FALSE.,
422 (PID.TID 0000.0001) ># useImportSIce=.FALSE.,
423 (PID.TID 0000.0001) ># cpl_taveFreq=2592000.,
424 (PID.TID 0000.0001) > cpl_taveFreq=18000.,
425 (PID.TID 0000.0001) > &
426 (PID.TID 0000.0001) >
427 (PID.TID 0000.0001)
428 (PID.TID 0000.0001) CPL_READPARMS: finished reading data.cpl
429 (PID.TID 0000.0001)
430 (PID.TID 0000.0001) // ===================================
431 (PID.TID 0000.0001) // Coupling package parameters :
432 (PID.TID 0000.0001) // ===================================
433 (PID.TID 0000.0001) cpl_earlyExpImpCall= /* call coupler early in the time-stepping */
434 (PID.TID 0000.0001) T
435 (PID.TID 0000.0001) ;
436 (PID.TID 0000.0001) useImportHFlx= /* use Imported Heat-Flx fr Coupler on/off flag */
437 (PID.TID 0000.0001) T
438 (PID.TID 0000.0001) ;
439 (PID.TID 0000.0001) useImportFW = /* use Imported Fresh-Water fr Cpl. on/off flag */
440 (PID.TID 0000.0001) T
441 (PID.TID 0000.0001) ;
442 (PID.TID 0000.0001) useImportTau = /* use Imported Wind-Stress fr Cpl. on/off flag */
443 (PID.TID 0000.0001) T
444 (PID.TID 0000.0001) ;
445 (PID.TID 0000.0001) useImportSLP = /* use Imported Sea-level Atm Press on/off flag */
446 (PID.TID 0000.0001) F
447 (PID.TID 0000.0001) ;
448 (PID.TID 0000.0001) useImportSIce= /* use Imported Sea-Ice loading on/off flag */
449 (PID.TID 0000.0001) T
450 (PID.TID 0000.0001) ;
451 (PID.TID 0000.0001) cpl_taveFreq = /* Frequency^-1 for time-Aver. output (s) */
452 (PID.TID 0000.0001) 1.800000000000000E+04
453 (PID.TID 0000.0001) ;
454 (PID.TID 0000.0001) tile: 1 ; Read from file tile001.mitgrid
455 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
456 (PID.TID 0000.0001) tile: 2 ; Read from file tile002.mitgrid
457 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
458 (PID.TID 0000.0001) tile: 3 ; Read from file tile003.mitgrid
459 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
460 (PID.TID 0000.0001) tile: 4 ; Read from file tile004.mitgrid
461 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
462 (PID.TID 0000.0001) tile: 5 ; Read from file tile005.mitgrid
463 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
464 (PID.TID 0000.0001) tile: 6 ; Read from file tile006.mitgrid
465 (PID.TID 0000.0001) => XC YC DXF DYF RA XG YG DXV DYU RAZ DXC DYC RAW RAS DXG DYG
466 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
467 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
468 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
469 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
470 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
471 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
472 (PID.TID 0000.0001) %MON XG_mean = 1.8796250616675E+00
473 (PID.TID 0000.0001) %MON XG_sd = 1.0410625309932E+02
474 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
475 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
476 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
477 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
478 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
479 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
480 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
481 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
482 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
483 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
484 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
485 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
486 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
487 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
488 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
489 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
490 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
491 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
492 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
493 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
494 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
495 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
496 (PID.TID 0000.0001) %MON YG_mean = -1.2094344438470E-15
497 (PID.TID 0000.0001) %MON YG_sd = 3.9086186579984E+01
498 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
499 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
500 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
501 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
502 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
503 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
504 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
505 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
506 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
507 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
508 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
509 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
510 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
511 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
512 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
513 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
514 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
515 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
516 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
517 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
518 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
519 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
520 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
521 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
522 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
523 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
524 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
525 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
526 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
527 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
528 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
529 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
530 (PID.TID 0000.0001) MDSREADFIELD: opening global file: bathy_Hmin50.bin
531 (PID.TID 0000.0001) // =======================================================
532 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc) at iteration 1
533 (PID.TID 0000.0001) // CMIN = -5.200000000000001E+03
534 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
535 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
536 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
537 (PID.TID 0000.0001) // 0.0: .
538 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
539 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
540 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
541 (PID.TID 0000.0001) // =======================================================
542 (PID.TID 0000.0001) K = 1
543 (PID.TID 0000.0001) // I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
544 (PID.TID 0000.0001) // |--J--|*01234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
545 (PID.TID 0000.0001) // 34 ..a-abcehjnldcclz+........spps...................................vkqn+....cbba--aabfu+..............hcbaaa....aaccdccbaaabbddddccdffffghfeeeee....efilhfcaaaacgceei.......zomggfca....ecbbccddefilihecbaacbaajfega-aes..
546 (PID.TID 0000.0001) // 33 ..bbccceiomkfdbbc+.......+s......................................xsrxz....db-----adu+...............hcbaa-....-accddba--bbbddddccdfffhhgfeeddc....dfgikhfffdfgccffw........zohhgeb....baaaaaccdfhlhfefdcccaabjefbaaafo..
547 (PID.TID 0000.0001) // 32 bddefhhkqqlgfaakqz..v.+..+.....................................++..u+...fdba----adu+................kdcaaa-aaa-accdcb---bbbcdddddefffggfeeedccccbbdcdfgghhiihcbeiw.........+ynjgebaaebaaaa-aacccfikkhecccbbbaaabaadfklnq
548 (PID.TID 0000.0001) // 31 bcffijnpnqneaaat..umrr+s.z.....................................+++++.ztsfeb--dfdfu+................+lkdca--aa--abcccb---bbbbddddeffflhfeeeecbbbb-abbacbcdceffbbfw+..........++ujfbaafbaaa----aacffiljgfffcca--adfikkiihh
549 (PID.TID 0000.0001) // 30 adgillkkkifcadcx.ymmqzqikvnnps.................................+++++wmegifcacdlqx+++...............mligea---a---abbbb---abaaddddeedkmeddefdbbbaa---b--aaaaabaabm..............+viba-iba-------acdefinmlgiieb-chnnnmlmlgf
550 (PID.TID 0000.0001) // 29 cfiljigfjd--efdozy...+ximpnnuz..................................+++yqddhjhcbbchz+......++.........+mmhffc---c----aaba------acdddcbcineddgdbaaa--d--a------aa-bfz...............+qe--qe---aa---aedeegknmlgiigcdfhpokkimlf
551 (PID.TID 0000.0001) // 28 bgkhfcccea-bdei........t........................................++zwgfcfnhccbbhwwy.....+++........+njfeed---d-----aa-------abddcabcnfddegcaaa---f------------dk+................+ja-+ja------bffdddehfd--bedaacfhpnligii
552 (PID.TID 0000.0001) // 27 cghfbaaaa-achmy..........................+++....................++vnbbbcpkeeecflmqxy....++........+lhfeecc--cc------------aaadcbabcfhddccba-----d-----------irw.................++e-++e-----mhmijddda--------ahhfiokhede
553 (PID.TID 0000.0001) // 26 dhfca-----bfiv...........................++sy...................+tq-fdbbnqiheddefhiksz++++........zkhfdccb--cb------------aabdcaaaacfddbca------fa-abb-----vvv...................+wa.+wa---mlmkijhc----------cjjffiheb-a
554 (PID.TID 0000.0001) // 25 chfa------ch+..................w...........njo+................+x-----bcqqojfefiiiijmy.++.........zkhfdbaa--aa-------daa---acccaaaacccca--------udaabbb----tei...................++q.++qdeqnghiljcaaaaidaa----beedeeca--
555 (PID.TID 0000.0001) // 24 eifa--acbcei...................w...........likn+.....++.....++znpa----bbnlmnjhinlksssw............qhfeca------------addc--aeffaaaaaaccb-a----a--+udbbaba---ven....................++..++xywnfgllcbbabegkecba----ddddcaac
556 (PID.TID 0000.0001) // 23 fida-aabchjk...................zz...z.....nhhijz....tqq.....+ujgzgd---abegklkkknols..xuu..........zgfdba------------bcd---affaaadffabbb-----aa-b.+ufb-----l.gx...........s.........+...++zzkfilfccccoz..ulkcd---bccnfddd
557 (PID.TID 0000.0001) // 22 fhfaa---bfgi....................zz..zz..rnjffggm...nlmn+....+sffzya--aabaffdfhimrmp...yuu.++.......zudba------------adc---dda-adffe-aa--------aa..+ufc-baaqvhh..........dcfeeh..........++zggqvifefhz......zobbaccfwuffe
558 (PID.TID 0000.0001) // 21 bcgca----abe.....................yss.ysstlgeeeeoz..ijklt+....lfjzzf---adaadcehllotq....yy+++zzs.....+zcba---a-------cdd--aaa----df------------aa...+upjdcy.vohq.......+idcdfeeefwz..wz....+hhn.vklox.........gdccfjwrigf
559 (PID.TID 0000.0001) // 20 bbcgfcaa-aae+...........................lcgfdddhq.+hiilnz++.+oquxyz--adgaabcfmtooyxz......+yuiiy....++gb------------ddcca-a-----acbaa------bbaaa......ywxy.lulo.lv...kcdgddffefffilyfilyx+fffk.+xyyy.........mgeimvskjkl
560 (PID.TID 0000.0001) // 19 feccdghfeegcbt..........................aafifccgnrzgghjry.+++sr+lq.--edftkblwnnsp.vv......skhggt...+++t-------------bdaf---------edd-------adlaa.........vnhzy.tllqiedccdhggfggffiigfiiggfcbdgy..yz..........xigqophijkk
561 (PID.TID 0000.0001) // 18 wifedfkhfegbbcivlqfoz..............j...jaacfihggokeeffgt..++++..hhlfdedd.qcz+.zwxtsttz..ysrkhot++++++zig------------b--f---------egqqqaa----frb-.......+kkrhw.vqmlnieddcdehgggffgigegigedbaaceiy.............zilrddefikk
562 (PID.TID 0000.0001) // 17 +wfeefikhgcbbccaaacgn.............ic..icaaccfihfoedddeedy..++...nnqwgfee.z++..+zsjjllllljllpjos+++.+zhhi---------e-----ea--------foqqoqqo--hlwge.......+nk+..xiioonhfefddegihhghigfdigfdbaaabdgx..............nheddefikl
563 (PID.TID 0000.0001) // 16 ..wiheddeccdfhfbabdfl............jdb.jdbaddddgifkccccdccd+.++..++ynvz.tku....++zyslllllkhggkmpy++...ihhi---------ea---feb-----a-acnoohfghknvmwnu........qhu..hhhkojgffgeefghihhiieedieedbaaabcdy..............ygddeghilj
564 (PID.TID 0000.0001) // 15 ....ylea--acfihebcbbes..........sfcbsfcbbngfffigcaaabdbcac+.+++++zgmpx..m....++..zslwz.yhhhhnz+++...rhgc--------ab----ige----acaaalllkddfiy..ysw........thk.xgghiligfghfefhhhhiiheedheedcdbbabdmz.............zfdeghikki
565 (PID.TID 0000.0001) // 14 ......c---acgkhdcc--di..........ofddofddchohffikaaaaabaaa-aw+.+ysnggox++rv..........yzzzzrjil+++....qhgd---------a-----i---cccdeabkklldinqssy..x.........+y.uhghikihgfghefgihhhgeeeeeeeeeddbaadhw.............nedeghjjhf
566 (PID.TID 0000.0001) // 13 .....+b----cfkhec---afz.........nhfdnhfdffholghkaaaaaba-a---flkkuswyy+++r...........zzzzz++ry++......yd------------------aeecdeidfkkqnqlmqquukqq............iihiijjhfefgefhjihiffgggfgggffecaabelx...........zjecehijhfe
567 (PID.TID 0000.0001) // 12 .....ec----chjhec---ag..........skiqskiqddeiiiifaaabae--a---dd--iu+++.++++..........+z+++++.+++....++.s----------------a-ceccdejhlllkqlkklssiccd...........wjkkkjjjigeefffgjiiighiiihiiihhhdaabdffghtxx......mfccehjiffd
568 (PID.TID 0000.0001) // 11 ....pdca--achlheba--ai..........nkn.nkn.fdemijidaaaabi-------a--q+....++s...........+++++..........+yyza--------b-----a--ccccddkhieekkossssfbbbb..........njjijhhihijhgggggjjjjijkkkjkkkkjjhcaacddeegpy.....xfdccdhjgfdd
569 (PID.TID 0000.0001) // 10 ....wfdb--achlhea---an.........uos..os..dcemikkfdcaabi-------equ+..................................zyvuq--------cc----a---dcfhkopqjeissrnpfbbccc........zslihhigghgijjihhhhkllkkkkkkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddc
570 (PID.TID 0000.0001) // 9 ....vgec---bfikca--cjl+.......+nnv.+nv.+ccffhkkiddaadha-----as++........z++........................zxuuk----------a---a----djmqrrnlllsoiddcccccd.......+zjijhfgfggffhjkkkiillljihhghhhghgihighdeeffgghimnnjgecbbcdgfeccb
571 (PID.TID 0000.0001) // 8 ...zleca---afjfca--hdfz.......vkky.jky.jceddefijffdddhb--a-afv............ss.........................+yku---u--------------ejnpqqnninnritqdccchk......wihgghgeffffeefhijkjkljiigeeffeeffefffhjhhikkklljklmhffeeeggfdcbaa
572 (PID.TID 0000.0001) // 7 .+zohec--abcfkhecbchbdx.......qiht.fht.faaaabdgijgfededcdcb-f+.............pz.........................+zu---u--------------edefqgqddsz+......+yu+....tiggfggfeeeefeeefiiiijkiihhedddeddddddddjjllliijhfkmmkkjjhijgdcba--
573 (PID.TID 0000.0001) // 6 +yomfddcaabefkifdchaadt......uqdeisceisc----dfefgifffkklldc--v.............pp.........................v.x---x---------a----fbbpqgzenx+........zdlkhhfffffffgfeeeeeeeefhhhhijihhffddcfddcbbbbdhhiihedddb-cfhhhjjjieca----
574 (PID.TID 0000.0001) // 5 +nhgffkghccfhkhffgdaackz....uoibcimlcimlaaacfbddfjjhijeehf-a-c.............su.........................qk.yi-.yi-------gha-fjddqs+xkrz.........q-kdccdeeeeeeedddedddddgghhhhjhhgffcbbfcbbaaaaddfegecca----dfeefhfgdb-----
575 (PID.TID 0000.0001) // 4 ujhgfllfhdffhkfffca-aady...llnabdopfdopfcbdgdbcdehlihgfddc--ms........................................okn.zdn.zd---eciiiicfkeeqy.ysz..........n-dcbbdeddedcdcccdddcddffggghiggfffdbafdbaa---acdcccba--abvfedeffdcca----b
576 (PID.TID 0000.0001) // 3 jggfcceeffffjlkjgaa---bfvheeln-aesphesphfdhgabddeflihhgfecbaaayq+++++.................................kqnz.vnz.vtpkllgdccfkkkkk..++..........+g-caaadcdddcbbbbcdddcccdffffghgffffdcafdcaa----abcaaaa-acxxmecdjmdbba----r
577 (PID.TID 0000.0001) // 2 feecbbccddefilihecbaacbaajfega-aesqhesqhffiea-cdeflkkljifeddcba---bry+...............................vkqn+.sn+.sghfcbcbbbdgfdek.++++.........+l-aaaaccdccbaaabbddddccdffffghfeeeeecbeecba------baaaa-euwxqdbcdkud-----sy
578 (PID.TID 0000.0001) // 1 bbbaaaaaccdfhlhfefdcccaabjefbaaafonhfonhglid--adfgkkkklkhffddca-----s+++.............................xsrxz.txz.tedcbbbbaaadddet.++++.........+l--a-accddba--bbbddddccdfffhhgfeeddccbdccba-------aaaabgns.qcbcchyzqngll++
579 (PID.TID 0000.0001) // 0 ..aaaa-aacccfikkhecccbbbaaabaadfkl....lilmgebaadfijjiiikjhffdcba-----l.............................++..u+......zmdfbd---a-aeef.xx+..........++....-accdcb---bbbcdddddefffggfeeedcc....cbba----aa--alrwwy.kcbccc+...+++..
580 (PID.TID 0000.0001) // -1 ..aaa----aacffiljgfffcca--adfikkii....kimiiheccfurkiffhijjigfecb-----l.............................+++++.z....+.wqgbf-------dgzpoy+........+ys....-abcccb---bbbbddddeffflhfeeeecbb....cbbaa----a--bdflm.yuibbcc.........
581 (PID.TID 0000.0001) // =======================================================
582 (PID.TID 0000.0001) // END OF FIELD =
583 (PID.TID 0000.0001) // =======================================================
584 (PID.TID 0000.0001)
585 (PID.TID 0000.0001) // =======================================================
586 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc) at iteration 1
587 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
588 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
589 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
590 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
591 (PID.TID 0000.0001) // 0.0: .
592 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
593 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
594 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
595 (PID.TID 0000.0001) // =======================================================
596 (PID.TID 0000.0001) // =======================================================
597 (PID.TID 0000.0001) // END OF FIELD =
598 (PID.TID 0000.0001) // =======================================================
599 (PID.TID 0000.0001)
600 (PID.TID 0000.0001) // =======================================================
601 (PID.TID 0000.0001) // Field hFacC at iteration 1
602 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
603 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
604 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
605 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
606 (PID.TID 0000.0001) // 0.0: .
607 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
608 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
609 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
610 (PID.TID 0000.0001) // =======================================================
611 (PID.TID 0000.0001) // =======================================================
612 (PID.TID 0000.0001) // END OF FIELD =
613 (PID.TID 0000.0001) // =======================================================
614 (PID.TID 0000.0001)
615 (PID.TID 0000.0001) // =======================================================
616 (PID.TID 0000.0001) // Field hFacW at iteration 1
617 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
618 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
619 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
620 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
621 (PID.TID 0000.0001) // 0.0: .
622 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
623 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
624 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
625 (PID.TID 0000.0001) // =======================================================
626 (PID.TID 0000.0001) // =======================================================
627 (PID.TID 0000.0001) // END OF FIELD =
628 (PID.TID 0000.0001) // =======================================================
629 (PID.TID 0000.0001)
630 (PID.TID 0000.0001) // =======================================================
631 (PID.TID 0000.0001) // Field hFacS at iteration 1
632 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
633 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
634 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
635 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
636 (PID.TID 0000.0001) // 0.0: .
637 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
638 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
639 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
640 (PID.TID 0000.0001) // =======================================================
641 (PID.TID 0000.0001) // =======================================================
642 (PID.TID 0000.0001) // END OF FIELD =
643 (PID.TID 0000.0001) // =======================================================
644 (PID.TID 0000.0001)
645 (PID.TID 0000.0001)
646 (PID.TID 0000.0001) // ===================================
647 (PID.TID 0000.0001) // GAD parameters :
648 (PID.TID 0000.0001) // ===================================
649 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
650 (PID.TID 0000.0001) 2
651 (PID.TID 0000.0001) ;
652 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
653 (PID.TID 0000.0001) 2
654 (PID.TID 0000.0001) ;
655 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
656 (PID.TID 0000.0001) F
657 (PID.TID 0000.0001) ;
658 (PID.TID 0000.0001) tempAdamsBashforth = /* use Adams-Bashforth time-stepping for Temp */
659 (PID.TID 0000.0001) T
660 (PID.TID 0000.0001) ;
661 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
662 (PID.TID 0000.0001) 2
663 (PID.TID 0000.0001) ;
664 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
665 (PID.TID 0000.0001) 2
666 (PID.TID 0000.0001) ;
667 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
668 (PID.TID 0000.0001) F
669 (PID.TID 0000.0001) ;
670 (PID.TID 0000.0001) saltAdamsBashforth = /* use Adams-Bashforth time-stepping for Salt */
671 (PID.TID 0000.0001) T
672 (PID.TID 0000.0001) ;
673 (PID.TID 0000.0001) // ===================================
674 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
675 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
676 (PID.TID 0000.0001) F
677 (PID.TID 0000.0001) ;
678 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
679 (PID.TID 0000.0001) F
680 (PID.TID 0000.0001) ;
681 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
682 (PID.TID 0000.0001) F
683 (PID.TID 0000.0001) ;
684 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity ( m^2/s ) */
685 (PID.TID 0000.0001) 8.000000000000000E+02
686 (PID.TID 0000.0001) ;
687 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity ( m^2/s ) */
688 (PID.TID 0000.0001) 8.000000000000000E+02
689 (PID.TID 0000.0001) ;
690 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity ( m^2/s ) */
691 (PID.TID 0000.0001) 0.000000000000000E+00
692 (PID.TID 0000.0001) ;
693 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. ( ) */
694 (PID.TID 0000.0001) 0.000000000000000E+00
695 (PID.TID 0000.0001) ;
696 (PID.TID 0000.0001) Tapering/Cliping : gkw91
697 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
698 (PID.TID 0000.0001) 1.000000000000000E-12
699 (PID.TID 0000.0001) ;
700 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
701 (PID.TID 0000.0001) 1.000000000000000E+48
702 (PID.TID 0000.0001) ;
703 (PID.TID 0000.0001) %MON fCori_max = 1.4535016908525E-04
704 (PID.TID 0000.0001) %MON fCori_min = -1.4535016908525E-04
705 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
706 (PID.TID 0000.0001) %MON fCori_sd = 8.3972192788621E-05
707 (PID.TID 0000.0001) %MON fCoriG_max = 1.4544410433286E-04
708 (PID.TID 0000.0001) %MON fCoriG_min = -1.4544410433286E-04
709 (PID.TID 0000.0001) %MON fCoriG_mean = 0.0000000000000E+00
710 (PID.TID 0000.0001) %MON fCoriG_sd = 8.4860812167727E-05
711 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4540341538469E-04
712 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2264550201501E-06
713 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1482595466044E-04
714 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0292878037194E-05
715 (PID.TID 0000.0001) // CG2D normalisation factor = 0.1915656415494955311373814E-03
716 (PID.TID 0000.0001)
717 (PID.TID 0000.0001) CONFIG_CHECK: OK
718 (PID.TID 0000.0001) // =======================================================
719 (PID.TID 0000.0001) // Model configuration
720 (PID.TID 0000.0001) // =======================================================
721 (PID.TID 0000.0001) //
722 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
723 (PID.TID 0000.0001) //
724 (PID.TID 0000.0001) buoyancyRelation = OCEANIC
725 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
726 (PID.TID 0000.0001) F
727 (PID.TID 0000.0001) ;
728 (PID.TID 0000.0001) fluidIsWater= /* fuild major constituent is Water */
729 (PID.TID 0000.0001) T
730 (PID.TID 0000.0001) ;
731 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
732 (PID.TID 0000.0001) F
733 (PID.TID 0000.0001) ;
734 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
735 (PID.TID 0000.0001) T
736 (PID.TID 0000.0001) ;
737 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or oK ) */
738 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
739 (PID.TID 0000.0001) ;
740 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( ppt ) */
741 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
742 (PID.TID 0000.0001) ;
743 (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
744 (PID.TID 0000.0001) 3.000000000000000E+05
745 (PID.TID 0000.0001) ;
746 (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
747 (PID.TID 0000.0001) 1.000000000000000E+21
748 (PID.TID 0000.0001) ;
749 (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
750 (PID.TID 0000.0001) 0.000000000000000E+00
751 (PID.TID 0000.0001) ;
752 (PID.TID 0000.0001) viscC2leith = /* Leith harmonic viscosity factor ( non-dom. ) */
753 (PID.TID 0000.0001) 0.000000000000000E+00
754 (PID.TID 0000.0001) ;
755 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
756 (PID.TID 0000.0001) 0.000000000000000E+00
757 (PID.TID 0000.0001) ;
758 (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
759 (PID.TID 0000.0001) 1.000000000000000E+21
760 (PID.TID 0000.0001) ;
761 (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
762 (PID.TID 0000.0001) 0.000000000000000E+00
763 (PID.TID 0000.0001) ;
764 (PID.TID 0000.0001) viscC4leith = /* Leith biharmonic viscosity factor ( non-dom. ) */
765 (PID.TID 0000.0001) 0.000000000000000E+00
766 (PID.TID 0000.0001) ;
767 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
768 (PID.TID 0000.0001) T
769 (PID.TID 0000.0001) ;
770 (PID.TID 0000.0001) viscAr = /* Vertical eddy viscosity ( units of r^2/s ) */
771 (PID.TID 0000.0001) 1.000000000000000E-03
772 (PID.TID 0000.0001) ;
773 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
774 (PID.TID 0000.0001) T
775 (PID.TID 0000.0001) ;
776 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
777 (PID.TID 0000.0001) 0.000000000000000E+00
778 (PID.TID 0000.0001) ;
779 (PID.TID 0000.0001) diffK4T = /* Bihaarmonic diffusion of heat laterally ( m^4/s ) */
780 (PID.TID 0000.0001) 0.000000000000000E+00
781 (PID.TID 0000.0001) ;
782 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
783 (PID.TID 0000.0001) 0.000000000000000E+00
784 (PID.TID 0000.0001) ;
785 (PID.TID 0000.0001) diffK4S = /* Bihaarmonic diffusion of salt laterally ( m^4/s ) */
786 (PID.TID 0000.0001) 0.000000000000000E+00
787 (PID.TID 0000.0001) ;
788 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
789 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
790 (PID.TID 0000.0001) ;
791 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
792 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
793 (PID.TID 0000.0001) ;
794 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 1979 ( m^2/s ) */
795 (PID.TID 0000.0001) 0.000000000000000E+00
796 (PID.TID 0000.0001) ;
797 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
798 (PID.TID 0000.0001) 0.000000000000000E+00
799 (PID.TID 0000.0001) ;
800 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
801 (PID.TID 0000.0001) 2.000000000000000E+02
802 (PID.TID 0000.0001) ;
803 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
804 (PID.TID 0000.0001) -2.000000000000000E+03
805 (PID.TID 0000.0001) ;
806 (PID.TID 0000.0001) Equation of State : eosType = JMD95Z
807 (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/degree ) */
808 (PID.TID 0000.0001) 1.234567000000000E+05
809 (PID.TID 0000.0001) ;
810 (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/ppt ) */
811 (PID.TID 0000.0001) 1.234567000000000E+05
812 (PID.TID 0000.0001) ;
813 (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
814 (PID.TID 0000.0001) 1.035000000000000E+03
815 (PID.TID 0000.0001) ;
816 (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
817 (PID.TID 0000.0001) 1.035000000000000E+03
818 (PID.TID 0000.0001) ;
819 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
820 (PID.TID 0000.0001) 1.035000000000000E+03
821 (PID.TID 0000.0001) ;
822 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
823 (PID.TID 0000.0001) 9.810000000000000E+00
824 (PID.TID 0000.0001) ;
825 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
826 (PID.TID 0000.0001) 9.810000000000000E+00
827 (PID.TID 0000.0001) ;
828 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
829 (PID.TID 0000.0001) 8.640000000000000E+04
830 (PID.TID 0000.0001) ;
831 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
832 (PID.TID 0000.0001) 7.272205216643039E-05
833 (PID.TID 0000.0001) ;
834 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
835 (PID.TID 0000.0001) 1.000000000000000E-04
836 (PID.TID 0000.0001) ;
837 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
838 (PID.TID 0000.0001) 1.000000000000000E-11
839 (PID.TID 0000.0001) ;
840 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
841 (PID.TID 0000.0001) 1.000000000000000E+00
842 (PID.TID 0000.0001) ;
843 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
844 (PID.TID 0000.0001) T
845 (PID.TID 0000.0001) ;
846 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
847 (PID.TID 0000.0001) F
848 (PID.TID 0000.0001) ;
849 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
850 (PID.TID 0000.0001) 1.000000000000000E+00
851 (PID.TID 0000.0001) ;
852 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
853 (PID.TID 0000.0001) 1.000000000000000E+00
854 (PID.TID 0000.0001) ;
855 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
856 (PID.TID 0000.0001) T
857 (PID.TID 0000.0001) ;
858 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
859 (PID.TID 0000.0001) T
860 (PID.TID 0000.0001) ;
861 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
862 (PID.TID 0000.0001) 4
863 (PID.TID 0000.0001) ;
864 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
865 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
866 (PID.TID 0000.0001) 2.000000000000000E-01
867 (PID.TID 0000.0001) ;
868 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
869 (PID.TID 0000.0001) 2.000000000000000E+00
870 (PID.TID 0000.0001) ;
871 (PID.TID 0000.0001) select_rStar = /* r* Coordinate options (not yet implemented)*/
872 (PID.TID 0000.0001) 2
873 (PID.TID 0000.0001) ;
874 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
875 (PID.TID 0000.0001) T
876 (PID.TID 0000.0001) ;
877 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
878 (PID.TID 0000.0001) 0.000000000000000E+00
879 (PID.TID 0000.0001) ;
880 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(ppt)*/
881 (PID.TID 0000.0001) 0.000000000000000E+00
882 (PID.TID 0000.0001) ;
883 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
884 (PID.TID 0000.0001) F
885 (PID.TID 0000.0001) ;
886 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
887 (PID.TID 0000.0001) T
888 (PID.TID 0000.0001) ;
889 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
890 (PID.TID 0000.0001) T
891 (PID.TID 0000.0001) ;
892 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
893 (PID.TID 0000.0001) T
894 (PID.TID 0000.0001) ;
895 (PID.TID 0000.0001) momImplVertAdv =/* Momentum implicit vert. advection on/off*/
896 (PID.TID 0000.0001) F
897 (PID.TID 0000.0001) ;
898 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
899 (PID.TID 0000.0001) F
900 (PID.TID 0000.0001) ;
901 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
902 (PID.TID 0000.0001) T
903 (PID.TID 0000.0001) ;
904 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
905 (PID.TID 0000.0001) F
906 (PID.TID 0000.0001) ;
907 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
908 (PID.TID 0000.0001) F
909 (PID.TID 0000.0001) ;
910 (PID.TID 0000.0001) useJamartMomAdv= /* V.I. Non-linear terms Jamart flag */
911 (PID.TID 0000.0001) F
912 (PID.TID 0000.0001) ;
913 (PID.TID 0000.0001) SadournyCoriolis= /* Sadourny Coriolis discr. flag */
914 (PID.TID 0000.0001) F
915 (PID.TID 0000.0001) ;
916 (PID.TID 0000.0001) upwindVorticity= /* Upwind bias vorticity flag */
917 (PID.TID 0000.0001) F
918 (PID.TID 0000.0001) ;
919 (PID.TID 0000.0001) useAbsVorticity= /* Work with f+zeta in Coriolis */
920 (PID.TID 0000.0001) F
921 (PID.TID 0000.0001) ;
922 (PID.TID 0000.0001) highOrderVorticity= /* High order interp. of vort. flag */
923 (PID.TID 0000.0001) F
924 (PID.TID 0000.0001) ;
925 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
926 (PID.TID 0000.0001) T
927 (PID.TID 0000.0001) ;
928 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
929 (PID.TID 0000.0001) T
930 (PID.TID 0000.0001) ;
931 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
932 (PID.TID 0000.0001) T
933 (PID.TID 0000.0001) ;
934 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
935 (PID.TID 0000.0001) T
936 (PID.TID 0000.0001) ;
937 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
938 (PID.TID 0000.0001) F
939 (PID.TID 0000.0001) ;
940 (PID.TID 0000.0001) implicitDiffusion =/* Implicit Diffusion on/off flag */
941 (PID.TID 0000.0001) T
942 (PID.TID 0000.0001) ;
943 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
944 (PID.TID 0000.0001) T
945 (PID.TID 0000.0001) ;
946 (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
947 (PID.TID 0000.0001) T
948 (PID.TID 0000.0001) ;
949 (PID.TID 0000.0001) tempImplVertAdv =/* Temp. implicit vert. advection on/off */
950 (PID.TID 0000.0001) F
951 (PID.TID 0000.0001) ;
952 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
953 (PID.TID 0000.0001) T
954 (PID.TID 0000.0001) ;
955 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
956 (PID.TID 0000.0001) T
957 (PID.TID 0000.0001) ;
958 (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
959 (PID.TID 0000.0001) T
960 (PID.TID 0000.0001) ;
961 (PID.TID 0000.0001) saltImplVertAdv =/* Sali. implicit vert. advection on/off */
962 (PID.TID 0000.0001) F
963 (PID.TID 0000.0001) ;
964 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
965 (PID.TID 0000.0001) T
966 (PID.TID 0000.0001) ;
967 (PID.TID 0000.0001) //
968 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
969 (PID.TID 0000.0001) //
970 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
971 (PID.TID 0000.0001) 200
972 (PID.TID 0000.0001) ;
973 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
974 (PID.TID 0000.0001) 1
975 (PID.TID 0000.0001) ;
976 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
977 (PID.TID 0000.0001) 1.000000000000000E-09
978 (PID.TID 0000.0001) ;
979 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
980 (PID.TID 0000.0001) -1.000000000000000E+00
981 (PID.TID 0000.0001) ;
982 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
983 (PID.TID 0000.0001) 1
984 (PID.TID 0000.0001) ;
985 (PID.TID 0000.0001) //
986 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
987 (PID.TID 0000.0001) //
988 (PID.TID 0000.0001) nIter0 = /* Base timestep number */
989 (PID.TID 0000.0001) 0
990 (PID.TID 0000.0001) ;
991 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
992 (PID.TID 0000.0001) 5
993 (PID.TID 0000.0001) ;
994 (PID.TID 0000.0001) deltatTmom = /* Momentum equation timestep ( s ) */
995 (PID.TID 0000.0001) 3.600000000000000E+03
996 (PID.TID 0000.0001) ;
997 (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
998 (PID.TID 0000.0001) 3.600000000000000E+03
999 (PID.TID 0000.0001) ;
1000 (PID.TID 0000.0001) deltatTtracer = /* Tracer equation timestep ( s ) */
1001 (PID.TID 0000.0001) 3.600000000000000E+03
1002 (PID.TID 0000.0001) ;
1003 (PID.TID 0000.0001) deltatTClock = /* Model clock timestep ( s ) */
1004 (PID.TID 0000.0001) 3.600000000000000E+03
1005 (PID.TID 0000.0001) ;
1006 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1007 (PID.TID 0000.0001) 0.000000000000000E+00
1008 (PID.TID 0000.0001) ;
1009 (PID.TID 0000.0001) forcing_In_AB = /* put T,S Forcing in Adams-Bash. stepping */
1010 (PID.TID 0000.0001) F
1011 (PID.TID 0000.0001) ;
1012 (PID.TID 0000.0001) abeps = /* Adams-Bashforth stabilizing weight */
1013 (PID.TID 0000.0001) 1.000000000000000E-01
1014 (PID.TID 0000.0001) ;
1015 (PID.TID 0000.0001) startTime = /* Run start time ( s ). */
1016 (PID.TID 0000.0001) 0.000000000000000E+00
1017 (PID.TID 0000.0001) ;
1018 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ). */
1019 (PID.TID 0000.0001) 1.800000000000000E+04
1020 (PID.TID 0000.0001) ;
1021 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/checkpoint file interval ( s ). */
1022 (PID.TID 0000.0001) 2.592000000000000E+06
1023 (PID.TID 0000.0001) ;
1024 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/checkpoint file interval ( s ). */
1025 (PID.TID 0000.0001) 0.000000000000000E+00
1026 (PID.TID 0000.0001) ;
1027 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1028 (PID.TID 0000.0001) T
1029 (PID.TID 0000.0001) ;
1030 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1031 (PID.TID 0000.0001) T
1032 (PID.TID 0000.0001) ;
1033 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1034 (PID.TID 0000.0001) F
1035 (PID.TID 0000.0001) ;
1036 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1037 (PID.TID 0000.0001) 8.640000000000000E+05
1038 (PID.TID 0000.0001) ;
1039 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1040 (PID.TID 0000.0001) F
1041 (PID.TID 0000.0001) ;
1042 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1043 (PID.TID 0000.0001) 1.000000000000000E+00
1044 (PID.TID 0000.0001) ;
1045 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1046 (PID.TID 0000.0001) T
1047 (PID.TID 0000.0001) ;
1048 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1049 (PID.TID 0000.0001) 2.592000000000000E+06
1050 (PID.TID 0000.0001) ;
1051 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1052 (PID.TID 0000.0001) 3.110400000000000E+07
1053 (PID.TID 0000.0001) ;
1054 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1055 (PID.TID 0000.0001) 0.000000000000000E+00
1056 (PID.TID 0000.0001) ;
1057 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1058 (PID.TID 0000.0001) 6.220800000000000E+08
1059 (PID.TID 0000.0001) ;
1060 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1061 (PID.TID 0000.0001) 1.800000000000000E+02
1062 (PID.TID 0000.0001) ;
1063 (PID.TID 0000.0001) //
1064 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1065 (PID.TID 0000.0001) //
1066 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True / False ) */
1067 (PID.TID 0000.0001) F
1068 (PID.TID 0000.0001) ;
1069 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True / False ) */
1070 (PID.TID 0000.0001) F
1071 (PID.TID 0000.0001) ;
1072 (PID.TID 0000.0001) usingCylindricalGrid = /* Spherical coordinates flag ( True / False ) */
1073 (PID.TID 0000.0001) F
1074 (PID.TID 0000.0001) ;
1075 (PID.TID 0000.0001) groundAtK1 = /* Lower Boundary (ground) at the surface(k=1) ( T / F ) */
1076 (PID.TID 0000.0001) F
1077 (PID.TID 0000.0001) ;
1078 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r ) */
1079 (PID.TID 0000.0001) 0.000000000000000E+00
1080 (PID.TID 0000.0001) ;
1081 (PID.TID 0000.0001) rkFac = /* minus Vertical index orientation */
1082 (PID.TID 0000.0001) 1.000000000000000E+00
1083 (PID.TID 0000.0001) ;
1084 (PID.TID 0000.0001) horiVertRatio = /* Ratio on units : Horiz - Vertical */
1085 (PID.TID 0000.0001) 1.000000000000000E+00
1086 (PID.TID 0000.0001) ;
1087 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1088 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1089 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1090 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1091 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1092 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1093 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1094 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1095 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1096 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1097 (PID.TID 0000.0001) 4.150000000000001E+02, /* K = 10 */
1098 (PID.TID 0000.0001) 4.650000000000001E+02, /* K = 11 */
1099 (PID.TID 0000.0001) 5.150000000000001E+02, /* K = 12 */
1100 (PID.TID 0000.0001) 5.650000000000001E+02, /* K = 13 */
1101 (PID.TID 0000.0001) 6.150000000000001E+02, /* K = 14 */
1102 (PID.TID 0000.0001) 6.650000000000001E+02 /* K = 15 */
1103 (PID.TID 0000.0001) ;
1104 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1105 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1106 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1107 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1108 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1109 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1110 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1111 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1112 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1113 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1114 (PID.TID 0000.0001) 4.400000000000001E+02, /* K = 10 */
1115 (PID.TID 0000.0001) 4.900000000000001E+02, /* K = 11 */
1116 (PID.TID 0000.0001) 5.400000000000001E+02, /* K = 12 */
1117 (PID.TID 0000.0001) 5.900000000000001E+02, /* K = 13 */
1118 (PID.TID 0000.0001) 6.400000000000001E+02, /* K = 14 */
1119 (PID.TID 0000.0001) 6.900000000000001E+02 /* K = 15 */
1120 (PID.TID 0000.0001) ;
1121 (PID.TID 0000.0001) delX = /* U spacing ( m - cartesian, degrees - spherical ) */
1122 (PID.TID 0000.0001) 192 @ 1.234567000000000E+05 /* I = 1:192 */
1123 (PID.TID 0000.0001) ;
1124 (PID.TID 0000.0001) delY = /* V spacing ( m - cartesian, degrees - spherical ) */
1125 (PID.TID 0000.0001) 32 @ 1.234567000000000E+05 /* J = 1: 32 */
1126 (PID.TID 0000.0001) ;
1127 (PID.TID 0000.0001) phiMin = /* South edge (ignored - cartesian, degrees - spherical ) */
1128 (PID.TID 0000.0001) 0.000000000000000E+00
1129 (PID.TID 0000.0001) ;
1130 (PID.TID 0000.0001) thetaMin = /* West edge ( ignored - cartesian, degrees - spherical ) */
1131 (PID.TID 0000.0001) 0.000000000000000E+00
1132 (PID.TID 0000.0001) ;
1133 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1134 (PID.TID 0000.0001) 6.370000000000000E+06
1135 (PID.TID 0000.0001) ;
1136 (PID.TID 0000.0001) xcoord = /* P-point X coord ( m - cartesian, degrees - spherical ) */
1137 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1138 (PID.TID 0000.0001) -4.295641272275884E+01, /* I = 2 */
1139 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1140 (PID.TID 0000.0001) -3.923446288487304E+01, /* I = 4 */
1141 (PID.TID 0000.0001) -3.702585158682200E+01, /* I = 5 */
1142 (PID.TID 0000.0001) -3.461179367094151E+01, /* I = 6 */
1143 (PID.TID 0000.0001) -3.200434569041793E+01, /* I = 7 */
1144 (PID.TID 0000.0001) -2.921355965632675E+01, /* I = 8 */
1145 (PID.TID 0000.0001) -2.624932223028289E+01, /* I = 9 */
1146 (PID.TID 0000.0001) -2.312261250426344E+01, /* I = 10 */
1147 (PID.TID 0000.0001) -1.984640717127058E+01, /* I = 11 */
1148 (PID.TID 0000.0001) -1.643630800555134E+01, /* I = 12 */
1149 (PID.TID 0000.0001) -1.291089806302069E+01, /* I = 13 */
1150 (PID.TID 0000.0001) -9.291807802719402E+00, /* I = 14 */
1151 (PID.TID 0000.0001) -5.603475335822333E+00, /* I = 15 */
1152 (PID.TID 0000.0001) -1.872608513033445E+00, /* I = 16 */
1153 (PID.TID 0000.0001) 1.872608513033445E+00, /* I = 17 */
1154 (PID.TID 0000.0001) 5.603475335822333E+00, /* I = 18 */
1155 (PID.TID 0000.0001) 9.291807802719402E+00, /* I = 19 */
1156 (PID.TID 0000.0001) 1.291089806302069E+01, /* I = 20 */
1157 (PID.TID 0000.0001) 1.643630800555134E+01, /* I = 21 */
1158 (PID.TID 0000.0001) 1.984640717127058E+01, /* I = 22 */
1159 (PID.TID 0000.0001) 2.312261250426344E+01, /* I = 23 */
1160 (PID.TID 0000.0001) 2.624932223028289E+01, /* I = 24 */
1161 (PID.TID 0000.0001) 2.921355965632675E+01, /* I = 25 */
1162 (PID.TID 0000.0001) 3.200434569041793E+01, /* I = 26 */
1163 (PID.TID 0000.0001) 3.461179367094151E+01, /* I = 27 */
1164 (PID.TID 0000.0001) 3.702585158682200E+01, /* I = 28 */
1165 (PID.TID 0000.0001) 3.923446288487304E+01, /* I = 29 */
1166 (PID.TID 0000.0001) 4.122055553388957E+01, /* I = 30 */
1167 (PID.TID 0000.0001) 4.295641272275884E+01, /* I = 31 */
1168 (PID.TID 0000.0001) 4.439521994760536E+01, /* I = 32 */
1169 (PID.TID 0000.0001) 4.560478005239465E+01, /* I = 33 */
1170 (PID.TID 0000.0001) 4.704358727724117E+01, /* I = 34 */
1171 (PID.TID 0000.0001) 4.877944446611044E+01, /* I = 35 */
1172 (PID.TID 0000.0001) 5.076553711512697E+01, /* I = 36 */
1173 (PID.TID 0000.0001) 5.297414841317801E+01, /* I = 37 */
1174 (PID.TID 0000.0001) 5.538820632905850E+01, /* I = 38 */
1175 (PID.TID 0000.0001) 5.799565430958209E+01, /* I = 39 */
1176 (PID.TID 0000.0001) 6.078644034367325E+01, /* I = 40 */
1177 (PID.TID 0000.0001) 6.375067776971711E+01, /* I = 41 */
1178 (PID.TID 0000.0001) 6.687738749573657E+01, /* I = 42 */
1179 (PID.TID 0000.0001) 7.015359282872943E+01, /* I = 43 */
1180 (PID.TID 0000.0001) 7.356369199444866E+01, /* I = 44 */
1181 (PID.TID 0000.0001) 7.708910193697932E+01, /* I = 45 */
1182 (PID.TID 0000.0001) 8.070819219728059E+01, /* I = 46 */
1183 (PID.TID 0000.0001) 8.439652466417765E+01, /* I = 47 */
1184 (PID.TID 0000.0001) 8.812739148696655E+01, /* I = 48 */
1185 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1186 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1187 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1188 (PID.TID 0000.0001) 1.029108980630207E+02, /* I = 52 */
1189 (PID.TID 0000.0001) 1.064363080055513E+02, /* I = 53 */
1190 (PID.TID 0000.0001) 1.098464071712706E+02, /* I = 54 */
1191 (PID.TID 0000.0001) 1.131226125042634E+02, /* I = 55 */
1192 (PID.TID 0000.0001) 1.162493222302829E+02, /* I = 56 */
1193 (PID.TID 0000.0001) 1.192135596563268E+02, /* I = 57 */
1194 (PID.TID 0000.0001) 1.220043456904179E+02, /* I = 58 */
1195 (PID.TID 0000.0001) 1.246117936709415E+02, /* I = 59 */
1196 (PID.TID 0000.0001) 1.270258515868220E+02, /* I = 60 */
1197 (PID.TID 0000.0001) 1.292344628848730E+02, /* I = 61 */
1198 (PID.TID 0000.0001) 1.312205555338896E+02, /* I = 62 */
1199 (PID.TID 0000.0001) 1.329564127227588E+02, /* I = 63 */
1200 (PID.TID 0000.0001) 1.343952199476053E+02, /* I = 64 */
1201 (PID.TID 0000.0001) 4.500000000000000E+01, /* I = 65 */
1202 (PID.TID 0000.0001) 4.620805468796297E+01, /* I = 66 */
1203 (PID.TID 0000.0001) 4.781369642513039E+01, /* I = 67 */
1204 (PID.TID 0000.0001) 4.971767671143929E+01, /* I = 68 */
1205 (PID.TID 0000.0001) 5.187738319787235E+01, /* I = 69 */
1206 (PID.TID 0000.0001) 5.427004371478711E+01, /* I = 70 */
1207 (PID.TID 0000.0001) 5.688128325334060E+01, /* I = 71 */
1208 (PID.TID 0000.0001) 5.970018167786760E+01, /* I = 72 */
1209 (PID.TID 0000.0001) 6.271654991792348E+01, /* I = 73 */
1210 (PID.TID 0000.0001) 6.591914604853015E+01, /* I = 74 */
1211 (PID.TID 0000.0001) 6.929439270484149E+01, /* I = 75 */
1212 (PID.TID 0000.0001) 7.282545807616151E+01, /* I = 76 */
1213 (PID.TID 0000.0001) 7.649168830618934E+01, /* I = 77 */
1214 (PID.TID 0000.0001) 8.026842803787175E+01, /* I = 78 */
1215 (PID.TID 0000.0001) 8.412726743124185E+01, /* I = 79 */
1216 (PID.TID 0000.0001) 8.803672008547504E+01, /* I = 80 */
1217 (PID.TID 0000.0001) 9.196327991452495E+01, /* I = 81 */
1218 (PID.TID 0000.0001) 9.587273256875814E+01, /* I = 82 */
1219 (PID.TID 0000.0001) 9.973157196212824E+01, /* I = 83 */
1220 (PID.TID 0000.0001) 1.035083116938107E+02, /* I = 84 */
1221 (PID.TID 0000.0001) 1.071745419238385E+02, /* I = 85 */
1222 (PID.TID 0000.0001) 1.107056072951585E+02, /* I = 86 */
1223 (PID.TID 0000.0001) 1.140808539514698E+02, /* I = 87 */
1224 (PID.TID 0000.0001) 1.172834500820765E+02, /* I = 88 */
1225 (PID.TID 0000.0001) 1.202998183221324E+02, /* I = 89 */
1226 (PID.TID 0000.0001) 1.231187167466594E+02, /* I = 90 */
1227 (PID.TID 0000.0001) 1.257299562852129E+02, /* I = 91 */
1228 (PID.TID 0000.0001) 1.281226168021276E+02, /* I = 92 */
1229 (PID.TID 0000.0001) 1.302823232885607E+02, /* I = 93 */
1230 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1231 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1232 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1233 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1234 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1235 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1236 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =100 */
1237 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =101 */
1238 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =102 */
1239 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =103 */
1240 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =104 */
1241 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =105 */
1242 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =106 */
1243 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =107 */
1244 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =108 */
1245 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =109 */
1246 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =110 */
1247 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =111 */
1248 (PID.TID 0000.0001) 2 @ 1.363550967500717E+02, /* I =112:113 */
1249 (PID.TID 0000.0001) 1.363530600590580E+02, /* I =114 */
1250 (PID.TID 0000.0001) 1.363488978790713E+02, /* I =115 */
1251 (PID.TID 0000.0001) 1.363424272425760E+02, /* I =116 */
1252 (PID.TID 0000.0001) 1.363333595910255E+02, /* I =117 */
1253 (PID.TID 0000.0001) 1.363212817739446E+02, /* I =118 */
1254 (PID.TID 0000.0001) 1.363056266270901E+02, /* I =119 */
1255 (PID.TID 0000.0001) 1.362856280326734E+02, /* I =120 */
1256 (PID.TID 0000.0001) 1.362602511071934E+02, /* I =121 */
1257 (PID.TID 0000.0001) 1.362280794509603E+02, /* I =122 */
1258 (PID.TID 0000.0001) 1.361871219420981E+02, /* I =123 */
1259 (PID.TID 0000.0001) 1.361344533147042E+02, /* I =124 */
1260 (PID.TID 0000.0001) 1.360654656901789E+02, /* I =125 */
1261 (PID.TID 0000.0001) 1.359720382181193E+02, /* I =126 */
1262 (PID.TID 0000.0001) 1.358367907661329E+02, /* I =127 */
1263 (PID.TID 0000.0001) 1.356047800523947E+02, /* I =128 */
1264 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =129 */
1265 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =130 */
1266 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =131 */
1267 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =132 */
1268 (PID.TID 0000.0001) -1.338655466852957E+02, /* I =133 */
1269 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =134 */
1270 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =135 */
1271 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =136 */
1272 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =137 */
1273 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =138 */
1274 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =139 */
1275 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =140 */
1276 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =141 */
1277 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1278 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1279 (PID.TID 0000.0001) 2 @ -1.336449032499283E+02, /* I =144:145 */
1280 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1281 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1282 (PID.TID 0000.0001) -1.336575727574240E+02, /* I =148 */
1283 (PID.TID 0000.0001) -1.336666404089745E+02, /* I =149 */
1284 (PID.TID 0000.0001) -1.336787182260554E+02, /* I =150 */
1285 (PID.TID 0000.0001) -1.336943733729099E+02, /* I =151 */
1286 (PID.TID 0000.0001) -1.337143719673266E+02, /* I =152 */
1287 (PID.TID 0000.0001) -1.337397488928066E+02, /* I =153 */
1288 (PID.TID 0000.0001) -1.337719205490397E+02, /* I =154 */
1289 (PID.TID 0000.0001) -1.338128780579019E+02, /* I =155 */
1290 (PID.TID 0000.0001) -1.338655466852957E+02, /* I =156 */
1291 (PID.TID 0000.0001) -1.339345343098211E+02, /* I =157 */
1292 (PID.TID 0000.0001) -1.340279617818807E+02, /* I =158 */
1293 (PID.TID 0000.0001) -1.341632092338671E+02, /* I =159 */
1294 (PID.TID 0000.0001) -1.343952199476053E+02, /* I =160 */
1295 (PID.TID 0000.0001) -1.350000000000000E+02, /* I =161 */
1296 (PID.TID 0000.0001) -1.362080546879630E+02, /* I =162 */
1297 (PID.TID 0000.0001) -1.378136964251304E+02, /* I =163 */
1298 (PID.TID 0000.0001) -1.397176767114393E+02, /* I =164 */
1299 (PID.TID 0000.0001) -1.418773831978723E+02, /* I =165 */
1300 (PID.TID 0000.0001) -1.442700437147871E+02, /* I =166 */
1301 (PID.TID 0000.0001) -1.468812832533406E+02, /* I =167 */
1302 (PID.TID 0000.0001) -1.497001816778676E+02, /* I =168 */
1303 (PID.TID 0000.0001) -1.527165499179235E+02, /* I =169 */
1304 (PID.TID 0000.0001) -1.559191460485302E+02, /* I =170 */
1305 (PID.TID 0000.0001) -1.592943927048415E+02, /* I =171 */
1306 (PID.TID 0000.0001) -1.628254580761615E+02, /* I =172 */
1307 (PID.TID 0000.0001) -1.664916883061893E+02, /* I =173 */
1308 (PID.TID 0000.0001) -1.702684280378718E+02, /* I =174 */
1309 (PID.TID 0000.0001) -1.741272674312418E+02, /* I =175 */
1310 (PID.TID 0000.0001) -1.780367200854751E+02, /* I =176 */
1311 (PID.TID 0000.0001) 1.780367200854751E+02, /* I =177 */
1312 (PID.TID 0000.0001) 1.741272674312418E+02, /* I =178 */
1313 (PID.TID 0000.0001) 1.702684280378718E+02, /* I =179 */
1314 (PID.TID 0000.0001) 1.664916883061893E+02, /* I =180 */
1315 (PID.TID 0000.0001) 1.628254580761615E+02, /* I =181 */
1316 (PID.TID 0000.0001) 1.592943927048415E+02, /* I =182 */
1317 (PID.TID 0000.0001) 1.559191460485302E+02, /* I =183 */
1318 (PID.TID 0000.0001) 1.527165499179235E+02, /* I =184 */
1319 (PID.TID 0000.0001) 1.497001816778676E+02, /* I =185 */
1320 (PID.TID 0000.0001) 1.468812832533406E+02, /* I =186 */
1321 (PID.TID 0000.0001) 1.442700437147871E+02, /* I =187 */
1322 (PID.TID 0000.0001) 1.418773831978723E+02, /* I =188 */
1323 (PID.TID 0000.0001) 1.397176767114393E+02, /* I =189 */
1324 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1325 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1326 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1327 (PID.TID 0000.0001) ;
1328 (PID.TID 0000.0001) ycoord = /* P-point Y coord ( m - cartesian, degrees - spherical ) */
1329 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1330 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1331 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1332 (PID.TID 0000.0001) -3.045756348838640E+01, /* J = 4 */
1333 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1334 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1335 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1336 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1337 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1338 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1339 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1340 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1341 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1342 (PID.TID 0000.0001) -6.751293662992217E+00, /* J = 14 */
1343 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1344 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1345 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1346 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1347 (PID.TID 0000.0001) 6.751293662992217E+00, /* J = 19 */
1348 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1349 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1350 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1351 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1352 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1353 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1354 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1355 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1356 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1357 (PID.TID 0000.0001) 3.045756348838640E+01, /* J = 29 */
1358 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1359 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1360 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1361 (PID.TID 0000.0001) ;
1362 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1363 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1364 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1365 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1366 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1367 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1368 (PID.TID 0000.0001) -6.700000000000001E+02, /* K = 6 */
1369 (PID.TID 0000.0001) -9.349999999999999E+02, /* K = 7 */
1370 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1371 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1372 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1373 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1374 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1375 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1376 (PID.TID 0000.0001) -4.190000000000001E+03, /* K = 14 */
1377 (PID.TID 0000.0001) -4.855000000000001E+03 /* K = 15 */
1378 (PID.TID 0000.0001) ;
1379 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1380 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1381 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1382 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1383 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1384 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1385 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1386 (PID.TID 0000.0001) -7.900000000000001E+02, /* K = 7 */
1387 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1388 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1389 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1390 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1391 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1392 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1393 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1394 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1395 (PID.TID 0000.0001) -5.200000000000001E+03 /* K = 16 */
1396 (PID.TID 0000.0001) ;
1397 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1398 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1399 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1400 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1401 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 4 */
1402 (PID.TID 0000.0001) 2.218350349844184E+05, /* I = 5 */
1403 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 6 */
1404 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 7 */
1405 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 8 */
1406 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 9 */
1407 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 10 */
1408 (PID.TID 0000.0001) 2.842862532064523E+05, /* I = 11 */
1409 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 12 */
1410 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 13 */
1411 (PID.TID 0000.0001) 2.978501920522793E+05, /* I = 14 */
1412 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 15 */
1413 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* I = 16: 17 */
1414 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 18 */
1415 (PID.TID 0000.0001) 2.978501920522793E+05, /* I = 19 */
1416 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 20 */
1417 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 21 */
1418 (PID.TID 0000.0001) 2.842862532064523E+05, /* I = 22 */
1419 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 23 */
1420 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 24 */
1421 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 25 */
1422 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 26 */
1423 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 27 */
1424 (PID.TID 0000.0001) 2.218350349844184E+05, /* I = 28 */
1425 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 29 */
1426 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 30 */
1427 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 31 */
1428 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1429 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 34 */
1430 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 35 */
1431 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 36 */
1432 (PID.TID 0000.0001) 2.218350349844184E+05, /* I = 37 */
1433 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 38 */
1434 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 39 */
1435 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 40 */
1436 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 41 */
1437 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 42 */
1438 (PID.TID 0000.0001) 2.842862532064523E+05, /* I = 43 */
1439 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 44 */
1440 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 45 */
1441 (PID.TID 0000.0001) 2.978501920522793E+05, /* I = 46 */
1442 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1443 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* I = 48: 49 */
1444 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1445 (PID.TID 0000.0001) 2.978501920522793E+05, /* I = 51 */
1446 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 52 */
1447 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 53 */
1448 (PID.TID 0000.0001) 2.842862532064523E+05, /* I = 54 */
1449 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 55 */
1450 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 56 */
1451 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 57 */
1452 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 58 */
1453 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 59 */
1454 (PID.TID 0000.0001) 2.218350349844184E+05, /* I = 60 */
1455 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 61 */
1456 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 62 */
1457 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 63 */
1458 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1459 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 66 */
1460 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 67 */
1461 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 68 */
1462 (PID.TID 0000.0001) 2.218350349844184E+05, /* I = 69 */
1463 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 70 */
1464 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 71 */
1465 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 72 */
1466 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 73 */
1467 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 74 */
1468 (PID.TID 0000.0001) 2.842862532064523E+05, /* I = 75 */
1469 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 76 */
1470 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 77 */
1471 (PID.TID 0000.0001) 2.978501920522793E+05, /* I = 78 */
1472 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 79 */
1473 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* I = 80: 81 */
1474 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 82 */
1475 (PID.TID 0000.0001) 2.978501920522793E+05, /* I = 83 */
1476 (PID.TID 0000.0001) 2.944742915095688E+05, /* I = 84 */
1477 (PID.TID 0000.0001) 2.899590699694043E+05, /* I = 85 */
1478 (PID.TID 0000.0001) 2.842862532064523E+05, /* I = 86 */
1479 (PID.TID 0000.0001) 2.774243179696503E+05, /* I = 87 */
1480 (PID.TID 0000.0001) 2.693210245495156E+05, /* I = 88 */
1481 (PID.TID 0000.0001) 2.598919724358304E+05, /* I = 89 */
1482 (PID.TID 0000.0001) 2.490022710862746E+05, /* I = 90 */
1483 (PID.TID 0000.0001) 2.364352994647058E+05, /* I = 91 */
1484 (PID.TID 0000.0001) 2.218350349844184E+05, /* I = 92 */
1485 (PID.TID 0000.0001) 2.045883481718707E+05, /* I = 93 */
1486 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1487 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1488 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1489 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1490 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1491 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =100 */
1492 (PID.TID 0000.0001) 2.218350349844184E+05, /* I =101 */
1493 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =102 */
1494 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =103 */
1495 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =104 */
1496 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =105 */
1497 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =106 */
1498 (PID.TID 0000.0001) 2.842862532064523E+05, /* I =107 */
1499 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =108 */
1500 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =109 */
1501 (PID.TID 0000.0001) 2.978501920522793E+05, /* I =110 */
1502 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =111 */
1503 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* I =112:113 */
1504 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =114 */
1505 (PID.TID 0000.0001) 2.978501920522793E+05, /* I =115 */
1506 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =116 */
1507 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =117 */
1508 (PID.TID 0000.0001) 2.842862532064523E+05, /* I =118 */
1509 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =119 */
1510 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =120 */
1511 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =121 */
1512 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =122 */
1513 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =123 */
1514 (PID.TID 0000.0001) 2.218350349844184E+05, /* I =124 */
1515 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =125 */
1516 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =126 */
1517 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =127 */
1518 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1519 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =130 */
1520 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =131 */
1521 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =132 */
1522 (PID.TID 0000.0001) 2.218350349844184E+05, /* I =133 */
1523 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =134 */
1524 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =135 */
1525 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =136 */
1526 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =137 */
1527 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =138 */
1528 (PID.TID 0000.0001) 2.842862532064523E+05, /* I =139 */
1529 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =140 */
1530 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =141 */
1531 (PID.TID 0000.0001) 2.978501920522793E+05, /* I =142 */
1532 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
1533 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* I =144:145 */
1534 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
1535 (PID.TID 0000.0001) 2.978501920522793E+05, /* I =147 */
1536 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =148 */
1537 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =149 */
1538 (PID.TID 0000.0001) 2.842862532064523E+05, /* I =150 */
1539 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =151 */
1540 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =152 */
1541 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =153 */
1542 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =154 */
1543 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =155 */
1544 (PID.TID 0000.0001) 2.218350349844184E+05, /* I =156 */
1545 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =157 */
1546 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =158 */
1547 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =159 */
1548 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1549 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =162 */
1550 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =163 */
1551 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =164 */
1552 (PID.TID 0000.0001) 2.218350349844184E+05, /* I =165 */
1553 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =166 */
1554 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =167 */
1555 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =168 */
1556 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =169 */
1557 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =170 */
1558 (PID.TID 0000.0001) 2.842862532064523E+05, /* I =171 */
1559 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =172 */
1560 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =173 */
1561 (PID.TID 0000.0001) 2.978501920522793E+05, /* I =174 */
1562 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =175 */
1563 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* I =176:177 */
1564 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =178 */
1565 (PID.TID 0000.0001) 2.978501920522793E+05, /* I =179 */
1566 (PID.TID 0000.0001) 2.944742915095688E+05, /* I =180 */
1567 (PID.TID 0000.0001) 2.899590699694043E+05, /* I =181 */
1568 (PID.TID 0000.0001) 2.842862532064523E+05, /* I =182 */
1569 (PID.TID 0000.0001) 2.774243179696503E+05, /* I =183 */
1570 (PID.TID 0000.0001) 2.693210245495156E+05, /* I =184 */
1571 (PID.TID 0000.0001) 2.598919724358304E+05, /* I =185 */
1572 (PID.TID 0000.0001) 2.490022710862746E+05, /* I =186 */
1573 (PID.TID 0000.0001) 2.364352994647058E+05, /* I =187 */
1574 (PID.TID 0000.0001) 2.218350349844184E+05, /* I =188 */
1575 (PID.TID 0000.0001) 2.045883481718707E+05, /* I =189 */
1576 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
1577 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
1578 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1579 (PID.TID 0000.0001) ;
1580 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( m - cartesian, degrees - spherical ) */
1581 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1582 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
1583 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
1584 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
1585 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
1586 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
1587 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
1588 (PID.TID 0000.0001) 2.599949918261880E+05, /* J = 8 */
1589 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
1590 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
1591 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
1592 (PID.TID 0000.0001) 2.900303768613598E+05, /* J = 12 */
1593 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
1594 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
1595 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
1596 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
1597 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
1598 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
1599 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
1600 (PID.TID 0000.0001) 2.900303768613598E+05, /* J = 21 */
1601 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
1602 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
1603 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
1604 (PID.TID 0000.0001) 2.599949918261880E+05, /* J = 25 */
1605 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
1606 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
1607 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
1608 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
1609 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
1610 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
1611 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1612 (PID.TID 0000.0001) ;
1613 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1614 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1615 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
1616 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
1617 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 4 */
1618 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 5 */
1619 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 6 */
1620 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 7 */
1621 (PID.TID 0000.0001) 2.599949918261880E+05, /* I = 8 */
1622 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 9 */
1623 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 10 */
1624 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 11 */
1625 (PID.TID 0000.0001) 2.900303768613598E+05, /* I = 12 */
1626 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 13 */
1627 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 14 */
1628 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 15 */
1629 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 16: 17 */
1630 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 18 */
1631 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 19 */
1632 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 20 */
1633 (PID.TID 0000.0001) 2.900303768613598E+05, /* I = 21 */
1634 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 22 */
1635 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 23 */
1636 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 24 */
1637 (PID.TID 0000.0001) 2.599949918261880E+05, /* I = 25 */
1638 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 26 */
1639 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 27 */
1640 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 28 */
1641 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 29 */
1642 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 30 */
1643 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 31 */
1644 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 32: 33 */
1645 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 34 */
1646 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 35 */
1647 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 36 */
1648 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 37 */
1649 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 38 */
1650 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 39 */
1651 (PID.TID 0000.0001) 2.599949918261880E+05, /* I = 40 */
1652 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 41 */
1653 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 42 */
1654 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 43 */
1655 (PID.TID 0000.0001) 2.900303768613598E+05, /* I = 44 */
1656 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 45 */
1657 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
1658 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
1659 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 48: 49 */
1660 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
1661 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
1662 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 52 */
1663 (PID.TID 0000.0001) 2.900303768613598E+05, /* I = 53 */
1664 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 54 */
1665 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 55 */
1666 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 56 */
1667 (PID.TID 0000.0001) 2.599949918261880E+05, /* I = 57 */
1668 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 58 */
1669 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 59 */
1670 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 60 */
1671 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 61 */
1672 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 62 */
1673 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 63 */
1674 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 64: 65 */
1675 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 66 */
1676 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 67 */
1677 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 68 */
1678 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 69 */
1679 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 70 */
1680 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 71 */
1681 (PID.TID 0000.0001) 2.599949918261880E+05, /* I = 72 */
1682 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 73 */
1683 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 74 */
1684 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 75 */
1685 (PID.TID 0000.0001) 2.900303768613598E+05, /* I = 76 */
1686 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 77 */
1687 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 78 */
1688 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 79 */
1689 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I = 80: 81 */
1690 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 82 */
1691 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 83 */
1692 (PID.TID 0000.0001) 2.945429307892709E+05, /* I = 84 */
1693 (PID.TID 0000.0001) 2.900303768613598E+05, /* I = 85 */
1694 (PID.TID 0000.0001) 2.843615645344775E+05, /* I = 86 */
1695 (PID.TID 0000.0001) 2.775055554645015E+05, /* I = 87 */
1696 (PID.TID 0000.0001) 2.694110134598581E+05, /* I = 88 */
1697 (PID.TID 0000.0001) 2.599949918261880E+05, /* I = 89 */
1698 (PID.TID 0000.0001) 2.491250781852558E+05, /* I = 90 */
1699 (PID.TID 0000.0001) 2.365892017348392E+05, /* I = 91 */
1700 (PID.TID 0000.0001) 2.220405216043041E+05, /* I = 92 */
1701 (PID.TID 0000.0001) 2.048868197919576E+05, /* I = 93 */
1702 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
1703 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
1704 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I = 96: 97 */
1705 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
1706 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
1707 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =100 */
1708 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =101 */
1709 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =102 */
1710 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =103 */
1711 (PID.TID 0000.0001) 2.599949918261880E+05, /* I =104 */
1712 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =105 */
1713 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =106 */
1714 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =107 */
1715 (PID.TID 0000.0001) 2.900303768613598E+05, /* I =108 */
1716 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =109 */
1717 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =110 */
1718 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =111 */
1719 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =112:113 */
1720 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =114 */
1721 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =115 */
1722 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =116 */
1723 (PID.TID 0000.0001) 2.900303768613598E+05, /* I =117 */
1724 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =118 */
1725 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =119 */
1726 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =120 */
1727 (PID.TID 0000.0001) 2.599949918261880E+05, /* I =121 */
1728 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =122 */
1729 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =123 */
1730 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =124 */
1731 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =125 */
1732 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =126 */
1733 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =127 */
1734 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =128:129 */
1735 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =130 */
1736 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =131 */
1737 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =132 */
1738 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =133 */
1739 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =134 */
1740 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =135 */
1741 (PID.TID 0000.0001) 2.599949918261880E+05, /* I =136 */
1742 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =137 */
1743 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =138 */
1744 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =139 */
1745 (PID.TID 0000.0001) 2.900303768613598E+05, /* I =140 */
1746 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =141 */
1747 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
1748 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
1749 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =144:145 */
1750 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
1751 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
1752 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =148 */
1753 (PID.TID 0000.0001) 2.900303768613598E+05, /* I =149 */
1754 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =150 */
1755 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =151 */
1756 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =152 */
1757 (PID.TID 0000.0001) 2.599949918261880E+05, /* I =153 */
1758 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =154 */
1759 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =155 */
1760 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =156 */
1761 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =157 */
1762 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =158 */
1763 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =159 */
1764 (PID.TID 0000.0001) 2 @ 1.202082051331828E+05, /* I =160:161 */
1765 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =162 */
1766 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =163 */
1767 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =164 */
1768 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =165 */
1769 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =166 */
1770 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =167 */
1771 (PID.TID 0000.0001) 2.599949918261880E+05, /* I =168 */
1772 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =169 */
1773 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =170 */
1774 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =171 */
1775 (PID.TID 0000.0001) 2.900303768613598E+05, /* I =172 */
1776 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =173 */
1777 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =174 */
1778 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =175 */
1779 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* I =176:177 */
1780 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =178 */
1781 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =179 */
1782 (PID.TID 0000.0001) 2.945429307892709E+05, /* I =180 */
1783 (PID.TID 0000.0001) 2.900303768613598E+05, /* I =181 */
1784 (PID.TID 0000.0001) 2.843615645344775E+05, /* I =182 */
1785 (PID.TID 0000.0001) 2.775055554645015E+05, /* I =183 */
1786 (PID.TID 0000.0001) 2.694110134598581E+05, /* I =184 */
1787 (PID.TID 0000.0001) 2.599949918261880E+05, /* I =185 */
1788 (PID.TID 0000.0001) 2.491250781852558E+05, /* I =186 */
1789 (PID.TID 0000.0001) 2.365892017348392E+05, /* I =187 */
1790 (PID.TID 0000.0001) 2.220405216043041E+05, /* I =188 */
1791 (PID.TID 0000.0001) 2.048868197919576E+05, /* I =189 */
1792 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
1793 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
1794 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1795 (PID.TID 0000.0001) ;
1796 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( m - cartesian, degrees - spherical ) */
1797 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1798 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
1799 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
1800 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
1801 (PID.TID 0000.0001) 2.218350349844184E+05, /* J = 5 */
1802 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
1803 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
1804 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
1805 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
1806 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
1807 (PID.TID 0000.0001) 2.842862532064523E+05, /* J = 11 */
1808 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
1809 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
1810 (PID.TID 0000.0001) 2.978501920522793E+05, /* J = 14 */
1811 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
1812 (PID.TID 0000.0001) 2 @ 3.012190981969054E+05, /* J = 16: 17 */
1813 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
1814 (PID.TID 0000.0001) 2.978501920522793E+05, /* J = 19 */
1815 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
1816 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
1817 (PID.TID 0000.0001) 2.842862532064523E+05, /* J = 22 */
1818 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
1819 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
1820 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
1821 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
1822 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
1823 (PID.TID 0000.0001) 2.218350349844184E+05, /* J = 28 */
1824 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
1825 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
1826 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
1827 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1828 (PID.TID 0000.0001) ;
1829 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( m - cartesian, degrees - spherical ) */
1830 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1831 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 2 */
1832 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
1833 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 4 */
1834 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 5 */
1835 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 6 */
1836 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 7 */
1837 (PID.TID 0000.0001) 2.597126963772146E+05, /* I = 8 */
1838 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 9 */
1839 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 10 */
1840 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 11 */
1841 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 12 */
1842 (PID.TID 0000.0001) 2.944035815526417E+05, /* I = 13 */
1843 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 14 */
1844 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 15 */
1845 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 16: 17 */
1846 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 18 */
1847 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 19 */
1848 (PID.TID 0000.0001) 2.944035815526417E+05, /* I = 20 */
1849 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 21 */
1850 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 22 */
1851 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 23 */
1852 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 24 */
1853 (PID.TID 0000.0001) 2.597126963772146E+05, /* I = 25 */
1854 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 26 */
1855 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 27 */
1856 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 28 */
1857 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 29 */
1858 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 30 */
1859 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 31 */
1860 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 32: 33 */
1861 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 34 */
1862 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 35 */
1863 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 36 */
1864 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 37 */
1865 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 38 */
1866 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 39 */
1867 (PID.TID 0000.0001) 2.597126963772146E+05, /* I = 40 */
1868 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 41 */
1869 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 42 */
1870 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 43 */
1871 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 44 */
1872 (PID.TID 0000.0001) 2.944035815526417E+05, /* I = 45 */
1873 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
1874 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
1875 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 48: 49 */
1876 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
1877 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
1878 (PID.TID 0000.0001) 2.944035815526417E+05, /* I = 52 */
1879 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 53 */
1880 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 54 */
1881 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 55 */
1882 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 56 */
1883 (PID.TID 0000.0001) 2.597126963772146E+05, /* I = 57 */
1884 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 58 */
1885 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 59 */
1886 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 60 */
1887 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 61 */
1888 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 62 */
1889 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 63 */
1890 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 64: 65 */
1891 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 66 */
1892 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 67 */
1893 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 68 */
1894 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 69 */
1895 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 70 */
1896 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 71 */
1897 (PID.TID 0000.0001) 2.597126963772146E+05, /* I = 72 */
1898 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 73 */
1899 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 74 */
1900 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 75 */
1901 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 76 */
1902 (PID.TID 0000.0001) 2.944035815526417E+05, /* I = 77 */
1903 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 78 */
1904 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 79 */
1905 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I = 80: 81 */
1906 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 82 */
1907 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 83 */
1908 (PID.TID 0000.0001) 2.944035815526417E+05, /* I = 84 */
1909 (PID.TID 0000.0001) 2.898778860929753E+05, /* I = 85 */
1910 (PID.TID 0000.0001) 2.841906470085516E+05, /* I = 86 */
1911 (PID.TID 0000.0001) 2.773091043277394E+05, /* I = 87 */
1912 (PID.TID 0000.0001) 2.691790288994575E+05, /* I = 88 */
1913 (PID.TID 0000.0001) 2.597126963772146E+05, /* I = 89 */
1914 (PID.TID 0000.0001) 2.487693460283865E+05, /* I = 90 */
1915 (PID.TID 0000.0001) 2.361211699596122E+05, /* I = 91 */
1916 (PID.TID 0000.0001) 2.213884732245467E+05, /* I = 92 */
1917 (PID.TID 0000.0001) 2.038999045536999E+05, /* I = 93 */
1918 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
1919 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 95 */
1920 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I = 96: 97 */
1921 (PID.TID 0000.0001) 1.534505834330337E+05, /* I = 98 */
1922 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
1923 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =100 */
1924 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =101 */
1925 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =102 */
1926 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =103 */
1927 (PID.TID 0000.0001) 2.597126963772146E+05, /* I =104 */
1928 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =105 */
1929 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =106 */
1930 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =107 */
1931 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =108 */
1932 (PID.TID 0000.0001) 2.944035815526417E+05, /* I =109 */
1933 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =110 */
1934 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =111 */
1935 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =112:113 */
1936 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =114 */
1937 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =115 */
1938 (PID.TID 0000.0001) 2.944035815526417E+05, /* I =116 */
1939 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =117 */
1940 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =118 */
1941 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =119 */
1942 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =120 */
1943 (PID.TID 0000.0001) 2.597126963772146E+05, /* I =121 */
1944 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =122 */
1945 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =123 */
1946 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =124 */
1947 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =125 */
1948 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =126 */
1949 (PID.TID 0000.0001) 1.534505834330337E+05, /* I =127 */
1950 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =128:129 */
1951 (PID.TID 0000.0001) 1.534505834330337E+05, /* I =130 */
1952 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =131 */
1953 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =132 */
1954 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =133 */
1955 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =134 */
1956 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =135 */
1957 (PID.TID 0000.0001) 2.597126963772146E+05, /* I =136 */
1958 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =137 */
1959 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =138 */
1960 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =139 */
1961 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =140 */
1962 (PID.TID 0000.0001) 2.944035815526417E+05, /* I =141 */
1963 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
1964 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
1965 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =144:145 */
1966 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
1967 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
1968 (PID.TID 0000.0001) 2.944035815526417E+05, /* I =148 */
1969 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =149 */
1970 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =150 */
1971 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =151 */
1972 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =152 */
1973 (PID.TID 0000.0001) 2.597126963772146E+05, /* I =153 */
1974 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =154 */
1975 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =155 */
1976 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =156 */
1977 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =157 */
1978 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =158 */
1979 (PID.TID 0000.0001) 1.534505834330337E+05, /* I =159 */
1980 (PID.TID 0000.0001) 2 @ 1.009837800879055E+05, /* I =160:161 */
1981 (PID.TID 0000.0001) 1.534505834330337E+05, /* I =162 */
1982 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =163 */
1983 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =164 */
1984 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =165 */
1985 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =166 */
1986 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =167 */
1987 (PID.TID 0000.0001) 2.597126963772146E+05, /* I =168 */
1988 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =169 */
1989 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =170 */
1990 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =171 */
1991 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =172 */
1992 (PID.TID 0000.0001) 2.944035815526417E+05, /* I =173 */
1993 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =174 */
1994 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =175 */
1995 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* I =176:177 */
1996 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =178 */
1997 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =179 */
1998 (PID.TID 0000.0001) 2.944035815526417E+05, /* I =180 */
1999 (PID.TID 0000.0001) 2.898778860929753E+05, /* I =181 */
2000 (PID.TID 0000.0001) 2.841906470085516E+05, /* I =182 */
2001 (PID.TID 0000.0001) 2.773091043277394E+05, /* I =183 */
2002 (PID.TID 0000.0001) 2.691790288994575E+05, /* I =184 */
2003 (PID.TID 0000.0001) 2.597126963772146E+05, /* I =185 */
2004 (PID.TID 0000.0001) 2.487693460283865E+05, /* I =186 */
2005 (PID.TID 0000.0001) 2.361211699596122E+05, /* I =187 */
2006 (PID.TID 0000.0001) 2.213884732245467E+05, /* I =188 */
2007 (PID.TID 0000.0001) 2.038999045536999E+05, /* I =189 */
2008 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
2009 (PID.TID 0000.0001) 1.534505834330337E+05, /* I =191 */
2010 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
2011 (PID.TID 0000.0001) ;
2012 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2013 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2014 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
2015 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
2016 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
2017 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
2018 (PID.TID 0000.0001) 2.295958105911513E+05, /* J = 6 */
2019 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
2020 (PID.TID 0000.0001) 2.547526806712888E+05, /* J = 8 */
2021 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
2022 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
2023 (PID.TID 0000.0001) 2.810845823202646E+05, /* J = 11 */
2024 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
2025 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
2026 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
2027 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
2028 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
2029 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
2030 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
2031 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
2032 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
2033 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
2034 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
2035 (PID.TID 0000.0001) 2.810845823202646E+05, /* J = 23 */
2036 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
2037 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
2038 (PID.TID 0000.0001) 2.547526806712888E+05, /* J = 26 */
2039 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
2040 (PID.TID 0000.0001) 2.295958105911513E+05, /* J = 28 */
2041 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
2042 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
2043 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
2044 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
2045 (PID.TID 0000.0001) ;
2046 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2047 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
2048 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
2049 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
2050 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 4 */
2051 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 5 */
2052 (PID.TID 0000.0001) 2.295958105911513E+05, /* I = 6 */
2053 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 7 */
2054 (PID.TID 0000.0001) 2.547526806712888E+05, /* I = 8 */
2055 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 9 */
2056 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 10 */
2057 (PID.TID 0000.0001) 2.810845823202646E+05, /* I = 11 */
2058 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 12 */
2059 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 13 */
2060 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 14 */
2061 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 15 */
2062 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 16 */
2063 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 17 */
2064 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 18 */
2065 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 19 */
2066 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 20 */
2067 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 21 */
2068 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 22 */
2069 (PID.TID 0000.0001) 2.810845823202646E+05, /* I = 23 */
2070 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 24 */
2071 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 25 */
2072 (PID.TID 0000.0001) 2.547526806712888E+05, /* I = 26 */
2073 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 27 */
2074 (PID.TID 0000.0001) 2.295958105911513E+05, /* I = 28 */
2075 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 29 */
2076 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 30 */
2077 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 31 */
2078 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 32 */
2079 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 33 */
2080 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 34 */
2081 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 35 */
2082 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 36 */
2083 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 37 */
2084 (PID.TID 0000.0001) 2.295958105911513E+05, /* I = 38 */
2085 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 39 */
2086 (PID.TID 0000.0001) 2.547526806712888E+05, /* I = 40 */
2087 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 41 */
2088 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 42 */
2089 (PID.TID 0000.0001) 2.810845823202646E+05, /* I = 43 */
2090 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 44 */
2091 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 45 */
2092 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
2093 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
2094 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
2095 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
2096 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
2097 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
2098 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 52 */
2099 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 53 */
2100 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 54 */
2101 (PID.TID 0000.0001) 2.810845823202646E+05, /* I = 55 */
2102 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 56 */
2103 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 57 */
2104 (PID.TID 0000.0001) 2.547526806712888E+05, /* I = 58 */
2105 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 59 */
2106 (PID.TID 0000.0001) 2.295958105911513E+05, /* I = 60 */
2107 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 61 */
2108 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 62 */
2109 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 63 */
2110 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 64 */
2111 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 65 */
2112 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 66 */
2113 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 67 */
2114 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 68 */
2115 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 69 */
2116 (PID.TID 0000.0001) 2.295958105911513E+05, /* I = 70 */
2117 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 71 */
2118 (PID.TID 0000.0001) 2.547526806712888E+05, /* I = 72 */
2119 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 73 */
2120 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 74 */
2121 (PID.TID 0000.0001) 2.810845823202646E+05, /* I = 75 */
2122 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 76 */
2123 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 77 */
2124 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 78 */
2125 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 79 */
2126 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 80 */
2127 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 81 */
2128 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 82 */
2129 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 83 */
2130 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 84 */
2131 (PID.TID 0000.0001) 2.924298293668651E+05, /* I = 85 */
2132 (PID.TID 0000.0001) 2.873420591008078E+05, /* I = 86 */
2133 (PID.TID 0000.0001) 2.810845823202646E+05, /* I = 87 */
2134 (PID.TID 0000.0001) 2.736173771018112E+05, /* I = 88 */
2135 (PID.TID 0000.0001) 2.648750305193301E+05, /* I = 89 */
2136 (PID.TID 0000.0001) 2.547526806712888E+05, /* I = 90 */
2137 (PID.TID 0000.0001) 2.430829951739083E+05, /* I = 91 */
2138 (PID.TID 0000.0001) 2.295958105911513E+05, /* I = 92 */
2139 (PID.TID 0000.0001) 2.138410773065497E+05, /* I = 93 */
2140 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
2141 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
2142 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
2143 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
2144 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
2145 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
2146 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =100 */
2147 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =101 */
2148 (PID.TID 0000.0001) 2.295958105911513E+05, /* I =102 */
2149 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =103 */
2150 (PID.TID 0000.0001) 2.547526806712888E+05, /* I =104 */
2151 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =105 */
2152 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =106 */
2153 (PID.TID 0000.0001) 2.810845823202646E+05, /* I =107 */
2154 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =108 */
2155 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =109 */
2156 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =110 */
2157 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =111 */
2158 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =112 */
2159 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =113 */
2160 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =114 */
2161 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =115 */
2162 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =116 */
2163 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =117 */
2164 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =118 */
2165 (PID.TID 0000.0001) 2.810845823202646E+05, /* I =119 */
2166 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =120 */
2167 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =121 */
2168 (PID.TID 0000.0001) 2.547526806712888E+05, /* I =122 */
2169 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =123 */
2170 (PID.TID 0000.0001) 2.295958105911513E+05, /* I =124 */
2171 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =125 */
2172 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =126 */
2173 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =127 */
2174 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =128 */
2175 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =129 */
2176 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =130 */
2177 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =131 */
2178 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =132 */
2179 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =133 */
2180 (PID.TID 0000.0001) 2.295958105911513E+05, /* I =134 */
2181 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =135 */
2182 (PID.TID 0000.0001) 2.547526806712888E+05, /* I =136 */
2183 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =137 */
2184 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =138 */
2185 (PID.TID 0000.0001) 2.810845823202646E+05, /* I =139 */
2186 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =140 */
2187 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =141 */
2188 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
2189 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
2190 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
2191 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
2192 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
2193 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
2194 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =148 */
2195 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =149 */
2196 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =150 */
2197 (PID.TID 0000.0001) 2.810845823202646E+05, /* I =151 */
2198 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =152 */
2199 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =153 */
2200 (PID.TID 0000.0001) 2.547526806712888E+05, /* I =154 */
2201 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =155 */
2202 (PID.TID 0000.0001) 2.295958105911513E+05, /* I =156 */
2203 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =157 */
2204 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =158 */
2205 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =159 */
2206 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =160 */
2207 (PID.TID 0000.0001) 1.009837800879055E+05, /* I =161 */
2208 (PID.TID 0000.0001) 1.403701524205398E+05, /* I =162 */
2209 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =163 */
2210 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =164 */
2211 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =165 */
2212 (PID.TID 0000.0001) 2.295958105911513E+05, /* I =166 */
2213 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =167 */
2214 (PID.TID 0000.0001) 2.547526806712888E+05, /* I =168 */
2215 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =169 */
2216 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =170 */
2217 (PID.TID 0000.0001) 2.810845823202646E+05, /* I =171 */
2218 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =172 */
2219 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =173 */
2220 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =174 */
2221 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =175 */
2222 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =176 */
2223 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =177 */
2224 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =178 */
2225 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =179 */
2226 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =180 */
2227 (PID.TID 0000.0001) 2.924298293668651E+05, /* I =181 */
2228 (PID.TID 0000.0001) 2.873420591008078E+05, /* I =182 */
2229 (PID.TID 0000.0001) 2.810845823202646E+05, /* I =183 */
2230 (PID.TID 0000.0001) 2.736173771018112E+05, /* I =184 */
2231 (PID.TID 0000.0001) 2.648750305193301E+05, /* I =185 */
2232 (PID.TID 0000.0001) 2.547526806712888E+05, /* I =186 */
2233 (PID.TID 0000.0001) 2.430829951739083E+05, /* I =187 */
2234 (PID.TID 0000.0001) 2.295958105911513E+05, /* I =188 */
2235 (PID.TID 0000.0001) 2.138410773065497E+05, /* I =189 */
2236 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
2237 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
2238 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
2239 (PID.TID 0000.0001) ;
2240 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2241 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
2242 (PID.TID 0000.0001) 1.534505834330337E+05, /* J = 2 */
2243 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
2244 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
2245 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
2246 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
2247 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
2248 (PID.TID 0000.0001) 2.597126963772146E+05, /* J = 8 */
2249 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
2250 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
2251 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
2252 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
2253 (PID.TID 0000.0001) 2.944035815526417E+05, /* J = 13 */
2254 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
2255 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
2256 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
2257 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
2258 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
2259 (PID.TID 0000.0001) 2.944035815526417E+05, /* J = 20 */
2260 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
2261 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
2262 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
2263 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
2264 (PID.TID 0000.0001) 2.597126963772146E+05, /* J = 25 */
2265 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
2266 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
2267 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
2268 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
2269 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
2270 (PID.TID 0000.0001) 1.534505834330337E+05, /* J = 31 */
2271 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
2272 (PID.TID 0000.0001) ;
2273 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2274 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2275 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 2 */
2276 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
2277 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 4 */
2278 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 5 */
2279 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 6 */
2280 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 7 */
2281 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 8 */
2282 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 9 */
2283 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 10 */
2284 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 11 */
2285 (PID.TID 0000.0001) 2.872689479506989E+05, /* I = 12 */
2286 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 13 */
2287 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 14 */
2288 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 15 */
2289 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 16 */
2290 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 17 */
2291 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 18 */
2292 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 19 */
2293 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 20 */
2294 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 21 */
2295 (PID.TID 0000.0001) 2.872689479506989E+05, /* I = 22 */
2296 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 23 */
2297 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 24 */
2298 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 25 */
2299 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 26 */
2300 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 27 */
2301 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 28 */
2302 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 29 */
2303 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 30 */
2304 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 31 */
2305 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 32 */
2306 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 33 */
2307 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 34 */
2308 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 35 */
2309 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 36 */
2310 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 37 */
2311 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 38 */
2312 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 39 */
2313 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 40 */
2314 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 41 */
2315 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 42 */
2316 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 43 */
2317 (PID.TID 0000.0001) 2.872689479506989E+05, /* I = 44 */
2318 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 45 */
2319 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
2320 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
2321 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
2322 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
2323 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
2324 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
2325 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 52 */
2326 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 53 */
2327 (PID.TID 0000.0001) 2.872689479506989E+05, /* I = 54 */
2328 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 55 */
2329 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 56 */
2330 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 57 */
2331 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 58 */
2332 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 59 */
2333 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 60 */
2334 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 61 */
2335 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 62 */
2336 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 63 */
2337 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 64 */
2338 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 65 */
2339 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 66 */
2340 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 67 */
2341 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 68 */
2342 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 69 */
2343 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 70 */
2344 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 71 */
2345 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 72 */
2346 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 73 */
2347 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 74 */
2348 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 75 */
2349 (PID.TID 0000.0001) 2.872689479506989E+05, /* I = 76 */
2350 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 77 */
2351 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 78 */
2352 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 79 */
2353 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 80 */
2354 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 81 */
2355 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 82 */
2356 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 83 */
2357 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 84 */
2358 (PID.TID 0000.0001) 2.923599955312932E+05, /* I = 85 */
2359 (PID.TID 0000.0001) 2.872689479506989E+05, /* I = 86 */
2360 (PID.TID 0000.0001) 2.810065951609633E+05, /* I = 87 */
2361 (PID.TID 0000.0001) 2.735321911346108E+05, /* I = 88 */
2362 (PID.TID 0000.0001) 2.647791839299727E+05, /* I = 89 */
2363 (PID.TID 0000.0001) 2.546408290696998E+05, /* I = 90 */
2364 (PID.TID 0000.0001) 2.429464709770498E+05, /* I = 91 */
2365 (PID.TID 0000.0001) 2.294195678257306E+05, /* I = 92 */
2366 (PID.TID 0000.0001) 2.135964483342134E+05, /* I = 93 */
2367 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
2368 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
2369 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 96 */
2370 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
2371 (PID.TID 0000.0001) 1.391343389937105E+05, /* I = 98 */
2372 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
2373 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =100 */
2374 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =101 */
2375 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =102 */
2376 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =103 */
2377 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =104 */
2378 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =105 */
2379 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =106 */
2380 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =107 */
2381 (PID.TID 0000.0001) 2.872689479506989E+05, /* I =108 */
2382 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =109 */
2383 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =110 */
2384 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =111 */
2385 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =112 */
2386 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =113 */
2387 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =114 */
2388 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =115 */
2389 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =116 */
2390 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =117 */
2391 (PID.TID 0000.0001) 2.872689479506989E+05, /* I =118 */
2392 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =119 */
2393 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =120 */
2394 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =121 */
2395 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =122 */
2396 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =123 */
2397 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =124 */
2398 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =125 */
2399 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =126 */
2400 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =127 */
2401 (PID.TID 0000.0001) 1.391343389937105E+05, /* I =128 */
2402 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =129 */
2403 (PID.TID 0000.0001) 1.391343389937105E+05, /* I =130 */
2404 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =131 */
2405 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =132 */
2406 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =133 */
2407 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =134 */
2408 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =135 */
2409 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =136 */
2410 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =137 */
2411 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =138 */
2412 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =139 */
2413 (PID.TID 0000.0001) 2.872689479506989E+05, /* I =140 */
2414 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =141 */
2415 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
2416 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
2417 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
2418 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
2419 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
2420 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
2421 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =148 */
2422 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =149 */
2423 (PID.TID 0000.0001) 2.872689479506989E+05, /* I =150 */
2424 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =151 */
2425 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =152 */
2426 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =153 */
2427 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =154 */
2428 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =155 */
2429 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =156 */
2430 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =157 */
2431 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =158 */
2432 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =159 */
2433 (PID.TID 0000.0001) 1.391343389937105E+05, /* I =160 */
2434 (PID.TID 0000.0001) 1.114203141013064E+05, /* I =161 */
2435 (PID.TID 0000.0001) 1.391343389937105E+05, /* I =162 */
2436 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =163 */
2437 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =164 */
2438 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =165 */
2439 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =166 */
2440 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =167 */
2441 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =168 */
2442 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =169 */
2443 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =170 */
2444 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =171 */
2445 (PID.TID 0000.0001) 2.872689479506989E+05, /* I =172 */
2446 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =173 */
2447 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =174 */
2448 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =175 */
2449 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =176 */
2450 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =177 */
2451 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =178 */
2452 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =179 */
2453 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =180 */
2454 (PID.TID 0000.0001) 2.923599955312932E+05, /* I =181 */
2455 (PID.TID 0000.0001) 2.872689479506989E+05, /* I =182 */
2456 (PID.TID 0000.0001) 2.810065951609633E+05, /* I =183 */
2457 (PID.TID 0000.0001) 2.735321911346108E+05, /* I =184 */
2458 (PID.TID 0000.0001) 2.647791839299727E+05, /* I =185 */
2459 (PID.TID 0000.0001) 2.546408290696998E+05, /* I =186 */
2460 (PID.TID 0000.0001) 2.429464709770498E+05, /* I =187 */
2461 (PID.TID 0000.0001) 2.294195678257306E+05, /* I =188 */
2462 (PID.TID 0000.0001) 2.135964483342134E+05, /* I =189 */
2463 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
2464 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
2465 (PID.TID 0000.0001) 1.391343389937105E+05 /* I =192 */
2466 (PID.TID 0000.0001) ;
2467 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2468 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2469 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
2470 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
2471 (PID.TID 0000.0001) 2.042717761866505E+05, /* J = 4 */
2472 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
2473 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
2474 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
2475 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
2476 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
2477 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
2478 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
2479 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
2480 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
2481 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
2482 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
2483 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
2484 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
2485 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
2486 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
2487 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
2488 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
2489 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
2490 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
2491 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
2492 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
2493 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
2494 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
2495 (PID.TID 0000.0001) 2.042717761866505E+05, /* J = 29 */
2496 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
2497 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
2498 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
2499 (PID.TID 0000.0001) ;
2500 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2501 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
2502 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
2503 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
2504 (PID.TID 0000.0001) 2.042717761866505E+05, /* I = 4 */
2505 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 5 */
2506 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 6 */
2507 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 7 */
2508 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 8 */
2509 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 9 */
2510 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 10 */
2511 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 11 */
2512 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 12 */
2513 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 13 */
2514 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 14 */
2515 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 15 */
2516 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 16: 17 */
2517 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 18 */
2518 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 19 */
2519 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 20 */
2520 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 21 */
2521 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 22 */
2522 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 23 */
2523 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 24 */
2524 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 25 */
2525 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 26 */
2526 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 27 */
2527 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 28 */
2528 (PID.TID 0000.0001) 2.042717761866505E+05, /* I = 29 */
2529 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 30 */
2530 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 31 */
2531 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 32: 33 */
2532 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 34 */
2533 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 35 */
2534 (PID.TID 0000.0001) 2.042717761866505E+05, /* I = 36 */
2535 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 37 */
2536 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 38 */
2537 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 39 */
2538 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 40 */
2539 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 41 */
2540 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 42 */
2541 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 43 */
2542 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 44 */
2543 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 45 */
2544 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
2545 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
2546 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 48: 49 */
2547 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
2548 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
2549 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 52 */
2550 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 53 */
2551 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 54 */
2552 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 55 */
2553 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 56 */
2554 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 57 */
2555 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 58 */
2556 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 59 */
2557 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 60 */
2558 (PID.TID 0000.0001) 2.042717761866505E+05, /* I = 61 */
2559 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 62 */
2560 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 63 */
2561 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 64: 65 */
2562 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 66 */
2563 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 67 */
2564 (PID.TID 0000.0001) 2.042717761866505E+05, /* I = 68 */
2565 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 69 */
2566 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 70 */
2567 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 71 */
2568 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 72 */
2569 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 73 */
2570 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 74 */
2571 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 75 */
2572 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 76 */
2573 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 77 */
2574 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 78 */
2575 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 79 */
2576 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I = 80: 81 */
2577 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 82 */
2578 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 83 */
2579 (PID.TID 0000.0001) 2.944741346384699E+05, /* I = 84 */
2580 (PID.TID 0000.0001) 2.899523122489403E+05, /* I = 85 */
2581 (PID.TID 0000.0001) 2.842706922224557E+05, /* I = 86 */
2582 (PID.TID 0000.0001) 2.773972106720365E+05, /* I = 87 */
2583 (PID.TID 0000.0001) 2.692787333338535E+05, /* I = 88 */
2584 (PID.TID 0000.0001) 2.598293319150326E+05, /* I = 89 */
2585 (PID.TID 0000.0001) 2.489113743322025E+05, /* I = 90 */
2586 (PID.TID 0000.0001) 2.363029564123586E+05, /* I = 91 */
2587 (PID.TID 0000.0001) 2.216367828252819E+05, /* I = 92 */
2588 (PID.TID 0000.0001) 2.042717761866505E+05, /* I = 93 */
2589 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
2590 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
2591 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I = 96: 97 */
2592 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
2593 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
2594 (PID.TID 0000.0001) 2.042717761866505E+05, /* I =100 */
2595 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =101 */
2596 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =102 */
2597 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =103 */
2598 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =104 */
2599 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =105 */
2600 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =106 */
2601 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =107 */
2602 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =108 */
2603 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =109 */
2604 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =110 */
2605 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =111 */
2606 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =112:113 */
2607 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =114 */
2608 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =115 */
2609 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =116 */
2610 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =117 */
2611 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =118 */
2612 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =119 */
2613 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =120 */
2614 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =121 */
2615 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =122 */
2616 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =123 */
2617 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =124 */
2618 (PID.TID 0000.0001) 2.042717761866505E+05, /* I =125 */
2619 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =126 */
2620 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =127 */
2621 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =128:129 */
2622 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =130 */
2623 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =131 */
2624 (PID.TID 0000.0001) 2.042717761866505E+05, /* I =132 */
2625 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =133 */
2626 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =134 */
2627 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =135 */
2628 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =136 */
2629 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =137 */
2630 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =138 */
2631 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =139 */
2632 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =140 */
2633 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =141 */
2634 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
2635 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
2636 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =144:145 */
2637 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
2638 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
2639 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =148 */
2640 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =149 */
2641 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =150 */
2642 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =151 */
2643 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =152 */
2644 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =153 */
2645 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =154 */
2646 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =155 */
2647 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =156 */
2648 (PID.TID 0000.0001) 2.042717761866505E+05, /* I =157 */
2649 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =158 */
2650 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =159 */
2651 (PID.TID 0000.0001) 2 @ 1.114203141013064E+05, /* I =160:161 */
2652 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =162 */
2653 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =163 */
2654 (PID.TID 0000.0001) 2.042717761866505E+05, /* I =164 */
2655 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =165 */
2656 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =166 */
2657 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =167 */
2658 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =168 */
2659 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =169 */
2660 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =170 */
2661 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =171 */
2662 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =172 */
2663 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =173 */
2664 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =174 */
2665 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =175 */
2666 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* I =176:177 */
2667 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =178 */
2668 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =179 */
2669 (PID.TID 0000.0001) 2.944741346384699E+05, /* I =180 */
2670 (PID.TID 0000.0001) 2.899523122489403E+05, /* I =181 */
2671 (PID.TID 0000.0001) 2.842706922224557E+05, /* I =182 */
2672 (PID.TID 0000.0001) 2.773972106720365E+05, /* I =183 */
2673 (PID.TID 0000.0001) 2.692787333338535E+05, /* I =184 */
2674 (PID.TID 0000.0001) 2.598293319150326E+05, /* I =185 */
2675 (PID.TID 0000.0001) 2.489113743322025E+05, /* I =186 */
2676 (PID.TID 0000.0001) 2.363029564123586E+05, /* I =187 */
2677 (PID.TID 0000.0001) 2.216367828252819E+05, /* I =188 */
2678 (PID.TID 0000.0001) 2.042717761866505E+05, /* I =189 */
2679 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
2680 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
2681 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
2682 (PID.TID 0000.0001) ;
2683 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2684 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
2685 (PID.TID 0000.0001) 1.391343389937105E+05, /* J = 2 */
2686 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
2687 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
2688 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
2689 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
2690 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
2691 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
2692 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
2693 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
2694 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
2695 (PID.TID 0000.0001) 2.872689479506989E+05, /* J = 12 */
2696 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
2697 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
2698 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
2699 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
2700 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
2701 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
2702 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
2703 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
2704 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
2705 (PID.TID 0000.0001) 2.872689479506989E+05, /* J = 22 */
2706 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
2707 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
2708 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
2709 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
2710 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
2711 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
2712 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
2713 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
2714 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
2715 (PID.TID 0000.0001) 1.391343389937105E+05 /* J = 32 */
2716 (PID.TID 0000.0001) ;
2717 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2718 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
2719 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
2720 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
2721 (PID.TID 0000.0001) 1.937548202849059E+05, /* I = 4 */
2722 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 5 */
2723 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 6 */
2724 (PID.TID 0000.0001) 2.426774358027004E+05, /* I = 7 */
2725 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 8 */
2726 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 9 */
2727 (PID.TID 0000.0001) 2.734046499619030E+05, /* I = 10 */
2728 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 11 */
2729 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 12 */
2730 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 13 */
2731 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 14 */
2732 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 15 */
2733 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 16 */
2734 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 17 */
2735 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 18 */
2736 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 19 */
2737 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 20 */
2738 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 21 */
2739 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 22 */
2740 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 23 */
2741 (PID.TID 0000.0001) 2.734046499619030E+05, /* I = 24 */
2742 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 25 */
2743 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 26 */
2744 (PID.TID 0000.0001) 2.426774358027004E+05, /* I = 27 */
2745 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 28 */
2746 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 29 */
2747 (PID.TID 0000.0001) 1.937548202849059E+05, /* I = 30 */
2748 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 31 */
2749 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 32 */
2750 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
2751 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 34 */
2752 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 35 */
2753 (PID.TID 0000.0001) 1.937548202849059E+05, /* I = 36 */
2754 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 37 */
2755 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 38 */
2756 (PID.TID 0000.0001) 2.426774358027004E+05, /* I = 39 */
2757 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 40 */
2758 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 41 */
2759 (PID.TID 0000.0001) 2.734046499619030E+05, /* I = 42 */
2760 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 43 */
2761 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 44 */
2762 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 45 */
2763 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
2764 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
2765 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
2766 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
2767 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
2768 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
2769 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 52 */
2770 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 53 */
2771 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 54 */
2772 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 55 */
2773 (PID.TID 0000.0001) 2.734046499619030E+05, /* I = 56 */
2774 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 57 */
2775 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 58 */
2776 (PID.TID 0000.0001) 2.426774358027004E+05, /* I = 59 */
2777 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 60 */
2778 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 61 */
2779 (PID.TID 0000.0001) 1.937548202849059E+05, /* I = 62 */
2780 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 63 */
2781 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 64 */
2782 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
2783 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 66 */
2784 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 67 */
2785 (PID.TID 0000.0001) 1.937548202849059E+05, /* I = 68 */
2786 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 69 */
2787 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 70 */
2788 (PID.TID 0000.0001) 2.426774358027004E+05, /* I = 71 */
2789 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 72 */
2790 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 73 */
2791 (PID.TID 0000.0001) 2.734046499619030E+05, /* I = 74 */
2792 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 75 */
2793 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 76 */
2794 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 77 */
2795 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 78 */
2796 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 79 */
2797 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 80 */
2798 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 81 */
2799 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 82 */
2800 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 83 */
2801 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 84 */
2802 (PID.TID 0000.0001) 2.922844849381675E+05, /* I = 85 */
2803 (PID.TID 0000.0001) 2.871811105274442E+05, /* I = 86 */
2804 (PID.TID 0000.0001) 2.809019351693761E+05, /* I = 87 */
2805 (PID.TID 0000.0001) 2.734046499619030E+05, /* I = 88 */
2806 (PID.TID 0000.0001) 2.646201463834826E+05, /* I = 89 */
2807 (PID.TID 0000.0001) 2.544372984215561E+05, /* I = 90 */
2808 (PID.TID 0000.0001) 2.426774358027004E+05, /* I = 91 */
2809 (PID.TID 0000.0001) 2.290479919481738E+05, /* I = 92 */
2810 (PID.TID 0000.0001) 2.130490056267208E+05, /* I = 93 */
2811 (PID.TID 0000.0001) 1.937548202849059E+05, /* I = 94 */
2812 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
2813 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
2814 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
2815 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
2816 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
2817 (PID.TID 0000.0001) 1.937548202849059E+05, /* I =100 */
2818 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =101 */
2819 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =102 */
2820 (PID.TID 0000.0001) 2.426774358027004E+05, /* I =103 */
2821 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =104 */
2822 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =105 */
2823 (PID.TID 0000.0001) 2.734046499619030E+05, /* I =106 */
2824 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =107 */
2825 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =108 */
2826 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =109 */
2827 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =110 */
2828 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =111 */
2829 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =112 */
2830 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =113 */
2831 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =114 */
2832 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =115 */
2833 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =116 */
2834 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =117 */
2835 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =118 */
2836 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =119 */
2837 (PID.TID 0000.0001) 2.734046499619030E+05, /* I =120 */
2838 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =121 */
2839 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =122 */
2840 (PID.TID 0000.0001) 2.426774358027004E+05, /* I =123 */
2841 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =124 */
2842 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =125 */
2843 (PID.TID 0000.0001) 1.937548202849059E+05, /* I =126 */
2844 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =127 */
2845 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =128 */
2846 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
2847 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =130 */
2848 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =131 */
2849 (PID.TID 0000.0001) 1.937548202849059E+05, /* I =132 */
2850 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =133 */
2851 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =134 */
2852 (PID.TID 0000.0001) 2.426774358027004E+05, /* I =135 */
2853 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =136 */
2854 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =137 */
2855 (PID.TID 0000.0001) 2.734046499619030E+05, /* I =138 */
2856 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =139 */
2857 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =140 */
2858 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =141 */
2859 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
2860 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
2861 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
2862 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
2863 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
2864 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
2865 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =148 */
2866 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =149 */
2867 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =150 */
2868 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =151 */
2869 (PID.TID 0000.0001) 2.734046499619030E+05, /* I =152 */
2870 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =153 */
2871 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =154 */
2872 (PID.TID 0000.0001) 2.426774358027004E+05, /* I =155 */
2873 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =156 */
2874 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =157 */
2875 (PID.TID 0000.0001) 1.937548202849059E+05, /* I =158 */
2876 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =159 */
2877 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =160 */
2878 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
2879 (PID.TID 0000.0001) 1.333130744933864E+05, /* I =162 */
2880 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =163 */
2881 (PID.TID 0000.0001) 1.937548202849059E+05, /* I =164 */
2882 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =165 */
2883 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =166 */
2884 (PID.TID 0000.0001) 2.426774358027004E+05, /* I =167 */
2885 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =168 */
2886 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =169 */
2887 (PID.TID 0000.0001) 2.734046499619030E+05, /* I =170 */
2888 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =171 */
2889 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =172 */
2890 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =173 */
2891 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =174 */
2892 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =175 */
2893 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =176 */
2894 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =177 */
2895 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =178 */
2896 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =179 */
2897 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =180 */
2898 (PID.TID 0000.0001) 2.922844849381675E+05, /* I =181 */
2899 (PID.TID 0000.0001) 2.871811105274442E+05, /* I =182 */
2900 (PID.TID 0000.0001) 2.809019351693761E+05, /* I =183 */
2901 (PID.TID 0000.0001) 2.734046499619030E+05, /* I =184 */
2902 (PID.TID 0000.0001) 2.646201463834826E+05, /* I =185 */
2903 (PID.TID 0000.0001) 2.544372984215561E+05, /* I =186 */
2904 (PID.TID 0000.0001) 2.426774358027004E+05, /* I =187 */
2905 (PID.TID 0000.0001) 2.290479919481738E+05, /* I =188 */
2906 (PID.TID 0000.0001) 2.130490056267208E+05, /* I =189 */
2907 (PID.TID 0000.0001) 1.937548202849059E+05, /* I =190 */
2908 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
2909 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
2910 (PID.TID 0000.0001) ;
2911 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( m - cartesian, degrees - spherical ) */
2912 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
2913 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
2914 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
2915 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
2916 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
2917 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
2918 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
2919 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
2920 (PID.TID 0000.0001) 2.647274964828302E+05, /* J = 9 */
2921 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
2922 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
2923 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
2924 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
2925 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
2926 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
2927 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
2928 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
2929 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
2930 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
2931 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
2932 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
2933 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
2934 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
2935 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
2936 (PID.TID 0000.0001) 2.647274964828302E+05, /* J = 25 */
2937 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
2938 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
2939 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
2940 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
2941 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
2942 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
2943 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
2944 (PID.TID 0000.0001) ;
2945 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( m - cartesian, degrees - spherical ) */
2946 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
2947 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
2948 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
2949 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 4 */
2950 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 5 */
2951 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 6 */
2952 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 7 */
2953 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 8 */
2954 (PID.TID 0000.0001) 2.647274964828302E+05, /* I = 9 */
2955 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 10 */
2956 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 11 */
2957 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 12 */
2958 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 13 */
2959 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 14 */
2960 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 15 */
2961 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 16 */
2962 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 17 */
2963 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 18 */
2964 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 19 */
2965 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 20 */
2966 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 21 */
2967 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 22 */
2968 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 23 */
2969 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 24 */
2970 (PID.TID 0000.0001) 2.647274964828302E+05, /* I = 25 */
2971 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 26 */
2972 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 27 */
2973 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 28 */
2974 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 29 */
2975 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 30 */
2976 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 31 */
2977 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 32 */
2978 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 33 */
2979 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 34 */
2980 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 35 */
2981 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 36 */
2982 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 37 */
2983 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 38 */
2984 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 39 */
2985 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 40 */
2986 (PID.TID 0000.0001) 2.647274964828302E+05, /* I = 41 */
2987 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 42 */
2988 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 43 */
2989 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 44 */
2990 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 45 */
2991 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
2992 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
2993 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
2994 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
2995 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
2996 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
2997 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 52 */
2998 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 53 */
2999 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 54 */
3000 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 55 */
3001 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 56 */
3002 (PID.TID 0000.0001) 2.647274964828302E+05, /* I = 57 */
3003 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 58 */
3004 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 59 */
3005 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 60 */
3006 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 61 */
3007 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 62 */
3008 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 63 */
3009 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 64 */
3010 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 65 */
3011 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 66 */
3012 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 67 */
3013 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 68 */
3014 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 69 */
3015 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 70 */
3016 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 71 */
3017 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 72 */
3018 (PID.TID 0000.0001) 2.647274964828302E+05, /* I = 73 */
3019 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 74 */
3020 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 75 */
3021 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 76 */
3022 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 77 */
3023 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 78 */
3024 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 79 */
3025 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 80 */
3026 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 81 */
3027 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 82 */
3028 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 83 */
3029 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 84 */
3030 (PID.TID 0000.0001) 2.923567890694162E+05, /* I = 85 */
3031 (PID.TID 0000.0001) 2.872580915202295E+05, /* I = 86 */
3032 (PID.TID 0000.0001) 2.809856491525217E+05, /* I = 87 */
3033 (PID.TID 0000.0001) 2.734980225206389E+05, /* I = 88 */
3034 (PID.TID 0000.0001) 2.647274964828302E+05, /* I = 89 */
3035 (PID.TID 0000.0001) 2.545652950875683E+05, /* I = 90 */
3036 (PID.TID 0000.0001) 2.428369969078989E+05, /* I = 91 */
3037 (PID.TID 0000.0001) 2.292584591272880E+05, /* I = 92 */
3038 (PID.TID 0000.0001) 2.133486626971531E+05, /* I = 93 */
3039 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
3040 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
3041 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
3042 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
3043 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
3044 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
3045 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =100 */
3046 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =101 */
3047 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =102 */
3048 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =103 */
3049 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =104 */
3050 (PID.TID 0000.0001) 2.647274964828302E+05, /* I =105 */
3051 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =106 */
3052 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =107 */
3053 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =108 */
3054 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =109 */
3055 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =110 */
3056 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =111 */
3057 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =112 */
3058 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =113 */
3059 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =114 */
3060 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =115 */
3061 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =116 */
3062 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =117 */
3063 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =118 */
3064 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =119 */
3065 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =120 */
3066 (PID.TID 0000.0001) 2.647274964828302E+05, /* I =121 */
3067 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =122 */
3068 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =123 */
3069 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =124 */
3070 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =125 */
3071 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =126 */
3072 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =127 */
3073 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =128 */
3074 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =129 */
3075 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =130 */
3076 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =131 */
3077 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =132 */
3078 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =133 */
3079 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =134 */
3080 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =135 */
3081 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =136 */
3082 (PID.TID 0000.0001) 2.647274964828302E+05, /* I =137 */
3083 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =138 */
3084 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =139 */
3085 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =140 */
3086 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =141 */
3087 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
3088 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
3089 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
3090 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
3091 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
3092 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
3093 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =148 */
3094 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =149 */
3095 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =150 */
3096 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =151 */
3097 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =152 */
3098 (PID.TID 0000.0001) 2.647274964828302E+05, /* I =153 */
3099 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =154 */
3100 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =155 */
3101 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =156 */
3102 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =157 */
3103 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =158 */
3104 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =159 */
3105 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =160 */
3106 (PID.TID 0000.0001) 8.015229982413632E+04, /* I =161 */
3107 (PID.TID 0000.0001) 1.362652340208229E+05, /* I =162 */
3108 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =163 */
3109 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =164 */
3110 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =165 */
3111 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =166 */
3112 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =167 */
3113 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =168 */
3114 (PID.TID 0000.0001) 2.647274964828302E+05, /* I =169 */
3115 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =170 */
3116 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =171 */
3117 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =172 */
3118 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =173 */
3119 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =174 */
3120 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =175 */
3121 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =176 */
3122 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =177 */
3123 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =178 */
3124 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =179 */
3125 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =180 */
3126 (PID.TID 0000.0001) 2.923567890694162E+05, /* I =181 */
3127 (PID.TID 0000.0001) 2.872580915202295E+05, /* I =182 */
3128 (PID.TID 0000.0001) 2.809856491525217E+05, /* I =183 */
3129 (PID.TID 0000.0001) 2.734980225206389E+05, /* I =184 */
3130 (PID.TID 0000.0001) 2.647274964828302E+05, /* I =185 */
3131 (PID.TID 0000.0001) 2.545652950875683E+05, /* I =186 */
3132 (PID.TID 0000.0001) 2.428369969078989E+05, /* I =187 */
3133 (PID.TID 0000.0001) 2.292584591272880E+05, /* I =188 */
3134 (PID.TID 0000.0001) 2.133486626971531E+05, /* I =189 */
3135 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
3136 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
3137 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
3138 (PID.TID 0000.0001) ;
3139 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3140 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
3141 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
3142 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
3143 (PID.TID 0000.0001) 1.937548202849059E+05, /* J = 4 */
3144 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
3145 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
3146 (PID.TID 0000.0001) 2.426774358027004E+05, /* J = 7 */
3147 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
3148 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
3149 (PID.TID 0000.0001) 2.734046499619030E+05, /* J = 10 */
3150 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
3151 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
3152 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
3153 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
3154 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
3155 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
3156 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
3157 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
3158 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
3159 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
3160 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
3161 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
3162 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
3163 (PID.TID 0000.0001) 2.734046499619030E+05, /* J = 24 */
3164 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
3165 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
3166 (PID.TID 0000.0001) 2.426774358027004E+05, /* J = 27 */
3167 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
3168 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
3169 (PID.TID 0000.0001) 1.937548202849059E+05, /* J = 30 */
3170 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
3171 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
3172 (PID.TID 0000.0001) ;
3173 (PID.TID 0000.0001) rA = /* rA(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3174 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
3175 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
3176 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
3177 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 4 */
3178 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 5 */
3179 (PID.TID 0000.0001) 5.594154126607554E+10, /* I = 6 */
3180 (PID.TID 0000.0001) 6.203683527772524E+10, /* I = 7 */
3181 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 8 */
3182 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 9 */
3183 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 10 */
3184 (PID.TID 0000.0001) 8.084683449728901E+10, /* I = 11 */
3185 (PID.TID 0000.0001) 8.410423102796222E+10, /* I = 12 */
3186 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 13 */
3187 (PID.TID 0000.0001) 8.874277443041927E+10, /* I = 14 */
3188 (PID.TID 0000.0001) 9.008620045350864E+10, /* I = 15 */
3189 (PID.TID 0000.0001) 9.076111290418456E+10, /* I = 16 */
3190 (PID.TID 0000.0001) 9.076111290422058E+10, /* I = 17 */
3191 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 18 */
3192 (PID.TID 0000.0001) 8.874277443041927E+10, /* I = 19 */
3193 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 20 */
3194 (PID.TID 0000.0001) 8.410423102799827E+10, /* I = 21 */
3195 (PID.TID 0000.0001) 8.084683449728901E+10, /* I = 22 */
3196 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 23 */
3197 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 24 */
3198 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 25 */
3199 (PID.TID 0000.0001) 6.203683527772524E+10, /* I = 26 */
3200 (PID.TID 0000.0001) 5.594154126611157E+10, /* I = 27 */
3201 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 28 */
3202 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 29 */
3203 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 30 */
3204 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 31 */
3205 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 32 */
3206 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 33 */
3207 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 34 */
3208 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 35 */
3209 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 36 */
3210 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 37 */
3211 (PID.TID 0000.0001) 5.594154126607554E+10, /* I = 38 */
3212 (PID.TID 0000.0001) 6.203683527772524E+10, /* I = 39 */
3213 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 40 */
3214 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 41 */
3215 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 42 */
3216 (PID.TID 0000.0001) 8.084683449728901E+10, /* I = 43 */
3217 (PID.TID 0000.0001) 8.410423102796222E+10, /* I = 44 */
3218 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 45 */
3219 (PID.TID 0000.0001) 8.874277443041927E+10, /* I = 46 */
3220 (PID.TID 0000.0001) 9.008620045350864E+10, /* I = 47 */
3221 (PID.TID 0000.0001) 9.076111290418456E+10, /* I = 48 */
3222 (PID.TID 0000.0001) 9.076111290422058E+10, /* I = 49 */
3223 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
3224 (PID.TID 0000.0001) 8.874277443041927E+10, /* I = 51 */
3225 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 52 */
3226 (PID.TID 0000.0001) 8.410423102799827E+10, /* I = 53 */
3227 (PID.TID 0000.0001) 8.084683449728901E+10, /* I = 54 */
3228 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 55 */
3229 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 56 */
3230 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 57 */
3231 (PID.TID 0000.0001) 6.203683527772524E+10, /* I = 58 */
3232 (PID.TID 0000.0001) 5.594154126611157E+10, /* I = 59 */
3233 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 60 */
3234 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 61 */
3235 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 62 */
3236 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 63 */
3237 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 64 */
3238 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 65 */
3239 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 66 */
3240 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 67 */
3241 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 68 */
3242 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 69 */
3243 (PID.TID 0000.0001) 5.594154126607554E+10, /* I = 70 */
3244 (PID.TID 0000.0001) 6.203683527772524E+10, /* I = 71 */
3245 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 72 */
3246 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 73 */
3247 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 74 */
3248 (PID.TID 0000.0001) 8.084683449728901E+10, /* I = 75 */
3249 (PID.TID 0000.0001) 8.410423102796222E+10, /* I = 76 */
3250 (PID.TID 0000.0001) 8.674306976737517E+10, /* I = 77 */
3251 (PID.TID 0000.0001) 8.874277443041927E+10, /* I = 78 */
3252 (PID.TID 0000.0001) 9.008620045350864E+10, /* I = 79 */
3253 (PID.TID 0000.0001) 9.076111290418456E+10, /* I = 80 */
3254 (PID.TID 0000.0001) 9.076111290422058E+10, /* I = 81 */
3255 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 82 */
3256 (PID.TID 0000.0001) 8.874277443041927E+10, /* I = 83 */
3257 (PID.TID 0000.0001) 8.674306976741121E+10, /* I = 84 */
3258 (PID.TID 0000.0001) 8.410423102799827E+10, /* I = 85 */
3259 (PID.TID 0000.0001) 8.084683449728901E+10, /* I = 86 */
3260 (PID.TID 0000.0001) 7.699293007098555E+10, /* I = 87 */
3261 (PID.TID 0000.0001) 7.256353271748119E+10, /* I = 88 */
3262 (PID.TID 0000.0001) 6.757541173817516E+10, /* I = 89 */
3263 (PID.TID 0000.0001) 6.203683527772524E+10, /* I = 90 */
3264 (PID.TID 0000.0001) 5.594154126611157E+10, /* I = 91 */
3265 (PID.TID 0000.0001) 4.925938996118163E+10, /* I = 92 */
3266 (PID.TID 0000.0001) 4.192037169898667E+10, /* I = 93 */
3267 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
3268 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
3269 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
3270 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
3271 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
3272 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
3273 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =100 */
3274 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =101 */
3275 (PID.TID 0000.0001) 5.594154126607554E+10, /* I =102 */
3276 (PID.TID 0000.0001) 6.203683527772524E+10, /* I =103 */
3277 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =104 */
3278 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =105 */
3279 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =106 */
3280 (PID.TID 0000.0001) 8.084683449728901E+10, /* I =107 */
3281 (PID.TID 0000.0001) 8.410423102796222E+10, /* I =108 */
3282 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =109 */
3283 (PID.TID 0000.0001) 8.874277443041927E+10, /* I =110 */
3284 (PID.TID 0000.0001) 9.008620045350864E+10, /* I =111 */
3285 (PID.TID 0000.0001) 9.076111290418456E+10, /* I =112 */
3286 (PID.TID 0000.0001) 9.076111290422058E+10, /* I =113 */
3287 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =114 */
3288 (PID.TID 0000.0001) 8.874277443041927E+10, /* I =115 */
3289 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =116 */
3290 (PID.TID 0000.0001) 8.410423102799827E+10, /* I =117 */
3291 (PID.TID 0000.0001) 8.084683449728901E+10, /* I =118 */
3292 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =119 */
3293 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =120 */
3294 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =121 */
3295 (PID.TID 0000.0001) 6.203683527772524E+10, /* I =122 */
3296 (PID.TID 0000.0001) 5.594154126611157E+10, /* I =123 */
3297 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =124 */
3298 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =125 */
3299 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =126 */
3300 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =127 */
3301 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =128 */
3302 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =129 */
3303 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =130 */
3304 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =131 */
3305 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =132 */
3306 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =133 */
3307 (PID.TID 0000.0001) 5.594154126607554E+10, /* I =134 */
3308 (PID.TID 0000.0001) 6.203683527772524E+10, /* I =135 */
3309 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =136 */
3310 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =137 */
3311 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =138 */
3312 (PID.TID 0000.0001) 8.084683449728901E+10, /* I =139 */
3313 (PID.TID 0000.0001) 8.410423102796222E+10, /* I =140 */
3314 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =141 */
3315 (PID.TID 0000.0001) 8.874277443041927E+10, /* I =142 */
3316 (PID.TID 0000.0001) 9.008620045350864E+10, /* I =143 */
3317 (PID.TID 0000.0001) 9.076111290418456E+10, /* I =144 */
3318 (PID.TID 0000.0001) 9.076111290422058E+10, /* I =145 */
3319 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
3320 (PID.TID 0000.0001) 8.874277443041927E+10, /* I =147 */
3321 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =148 */
3322 (PID.TID 0000.0001) 8.410423102799827E+10, /* I =149 */
3323 (PID.TID 0000.0001) 8.084683449728901E+10, /* I =150 */
3324 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =151 */
3325 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =152 */
3326 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =153 */
3327 (PID.TID 0000.0001) 6.203683527772524E+10, /* I =154 */
3328 (PID.TID 0000.0001) 5.594154126611157E+10, /* I =155 */
3329 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =156 */
3330 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =157 */
3331 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =158 */
3332 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =159 */
3333 (PID.TID 0000.0001) 1.401900702259215E+10, /* I =160 */
3334 (PID.TID 0000.0001) 1.401900702255611E+10, /* I =161 */
3335 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =162 */
3336 (PID.TID 0000.0001) 3.378518544307869E+10, /* I =163 */
3337 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =164 */
3338 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =165 */
3339 (PID.TID 0000.0001) 5.594154126607554E+10, /* I =166 */
3340 (PID.TID 0000.0001) 6.203683527772524E+10, /* I =167 */
3341 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =168 */
3342 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =169 */
3343 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =170 */
3344 (PID.TID 0000.0001) 8.084683449728901E+10, /* I =171 */
3345 (PID.TID 0000.0001) 8.410423102796222E+10, /* I =172 */
3346 (PID.TID 0000.0001) 8.674306976737517E+10, /* I =173 */
3347 (PID.TID 0000.0001) 8.874277443041927E+10, /* I =174 */
3348 (PID.TID 0000.0001) 9.008620045350864E+10, /* I =175 */
3349 (PID.TID 0000.0001) 9.076111290418456E+10, /* I =176 */
3350 (PID.TID 0000.0001) 9.076111290422058E+10, /* I =177 */
3351 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =178 */
3352 (PID.TID 0000.0001) 8.874277443041927E+10, /* I =179 */
3353 (PID.TID 0000.0001) 8.674306976741121E+10, /* I =180 */
3354 (PID.TID 0000.0001) 8.410423102799827E+10, /* I =181 */
3355 (PID.TID 0000.0001) 8.084683449728901E+10, /* I =182 */
3356 (PID.TID 0000.0001) 7.699293007098555E+10, /* I =183 */
3357 (PID.TID 0000.0001) 7.256353271748119E+10, /* I =184 */
3358 (PID.TID 0000.0001) 6.757541173817516E+10, /* I =185 */
3359 (PID.TID 0000.0001) 6.203683527772524E+10, /* I =186 */
3360 (PID.TID 0000.0001) 5.594154126611157E+10, /* I =187 */
3361 (PID.TID 0000.0001) 4.925938996118163E+10, /* I =188 */
3362 (PID.TID 0000.0001) 4.192037169898667E+10, /* I =189 */
3363 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
3364 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
3365 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
3366 (PID.TID 0000.0001) ;
3367 (PID.TID 0000.0001) rA = /* rA(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3368 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
3369 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
3370 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
3371 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
3372 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
3373 (PID.TID 0000.0001) 5.594154126607554E+10, /* J = 6 */
3374 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
3375 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
3376 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
3377 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
3378 (PID.TID 0000.0001) 8.084683449728901E+10, /* J = 11 */
3379 (PID.TID 0000.0001) 8.410423102799827E+10, /* J = 12 */
3380 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
3381 (PID.TID 0000.0001) 8.874277443041927E+10, /* J = 14 */
3382 (PID.TID 0000.0001) 9.008620045350864E+10, /* J = 15 */
3383 (PID.TID 0000.0001) 9.076111290418456E+10, /* J = 16 */
3384 (PID.TID 0000.0001) 9.076111290422058E+10, /* J = 17 */
3385 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
3386 (PID.TID 0000.0001) 8.874277443041927E+10, /* J = 19 */
3387 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
3388 (PID.TID 0000.0001) 8.410423102799827E+10, /* J = 21 */
3389 (PID.TID 0000.0001) 8.084683449728901E+10, /* J = 22 */
3390 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
3391 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
3392 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
3393 (PID.TID 0000.0001) 6.203683527772524E+10, /* J = 26 */
3394 (PID.TID 0000.0001) 5.594154126607554E+10, /* J = 27 */
3395 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
3396 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
3397 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
3398 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
3399 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
3400 (PID.TID 0000.0001) ;
3401 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3402 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3403 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
3404 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
3405 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 4 */
3406 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 5 */
3407 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 6 */
3408 (PID.TID 0000.0001) 5.907428494299064E+10, /* I = 7 */
3409 (PID.TID 0000.0001) 6.488320895111515E+10, /* I = 8 */
3410 (PID.TID 0000.0001) 7.014205907741883E+10, /* I = 9 */
3411 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 10 */
3412 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 11 */
3413 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 12 */
3414 (PID.TID 0000.0001) 8.549360686473493E+10, /* I = 13 */
3415 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 14 */
3416 (PID.TID 0000.0001) 8.948571540392020E+10, /* I = 15 */
3417 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 16 */
3418 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 17 */
3419 (PID.TID 0000.0001) 9.049530583087069E+10, /* I = 18 */
3420 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 19 */
3421 (PID.TID 0000.0001) 8.781353403174184E+10, /* I = 20 */
3422 (PID.TID 0000.0001) 8.549360686467183E+10, /* I = 21 */
3423 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 22 */
3424 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 23 */
3425 (PID.TID 0000.0001) 7.484854821844796E+10, /* I = 24 */
3426 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 25 */
3427 (PID.TID 0000.0001) 6.488320895111515E+10, /* I = 26 */
3428 (PID.TID 0000.0001) 5.907428494299064E+10, /* I = 27 */
3429 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 28 */
3430 (PID.TID 0000.0001) 4.571243814190768E+10, /* I = 29 */
3431 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 30 */
3432 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 31 */
3433 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 32 */
3434 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 33 */
3435 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 34 */
3436 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 35 */
3437 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 36 */
3438 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 37 */
3439 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 38 */
3440 (PID.TID 0000.0001) 5.907428494299064E+10, /* I = 39 */
3441 (PID.TID 0000.0001) 6.488320895111515E+10, /* I = 40 */
3442 (PID.TID 0000.0001) 7.014205907741883E+10, /* I = 41 */
3443 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 42 */
3444 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 43 */
3445 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 44 */
3446 (PID.TID 0000.0001) 8.549360686473493E+10, /* I = 45 */
3447 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
3448 (PID.TID 0000.0001) 8.948571540392020E+10, /* I = 47 */
3449 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
3450 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
3451 (PID.TID 0000.0001) 9.049530583087069E+10, /* I = 50 */
3452 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
3453 (PID.TID 0000.0001) 8.781353403174184E+10, /* I = 52 */
3454 (PID.TID 0000.0001) 8.549360686467183E+10, /* I = 53 */
3455 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 54 */
3456 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 55 */
3457 (PID.TID 0000.0001) 7.484854821844796E+10, /* I = 56 */
3458 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 57 */
3459 (PID.TID 0000.0001) 6.488320895111515E+10, /* I = 58 */
3460 (PID.TID 0000.0001) 5.907428494299064E+10, /* I = 59 */
3461 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 60 */
3462 (PID.TID 0000.0001) 4.571243814190768E+10, /* I = 61 */
3463 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 62 */
3464 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 63 */
3465 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 64 */
3466 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 65 */
3467 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 66 */
3468 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 67 */
3469 (PID.TID 0000.0001) 3.801790263324359E+10, /* I = 68 */
3470 (PID.TID 0000.0001) 4.571243814189866E+10, /* I = 69 */
3471 (PID.TID 0000.0001) 5.269930713599979E+10, /* I = 70 */
3472 (PID.TID 0000.0001) 5.907428494299064E+10, /* I = 71 */
3473 (PID.TID 0000.0001) 6.488320895111515E+10, /* I = 72 */
3474 (PID.TID 0000.0001) 7.014205907741883E+10, /* I = 73 */
3475 (PID.TID 0000.0001) 7.484854821847499E+10, /* I = 74 */
3476 (PID.TID 0000.0001) 7.898934631431560E+10, /* I = 75 */
3477 (PID.TID 0000.0001) 8.254500894894537E+10, /* I = 76 */
3478 (PID.TID 0000.0001) 8.549360686473493E+10, /* I = 77 */
3479 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 78 */
3480 (PID.TID 0000.0001) 8.948571540392020E+10, /* I = 79 */
3481 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 80 */
3482 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 81 */
3483 (PID.TID 0000.0001) 9.049530583087069E+10, /* I = 82 */
3484 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 83 */
3485 (PID.TID 0000.0001) 8.781353403174184E+10, /* I = 84 */
3486 (PID.TID 0000.0001) 8.549360686467183E+10, /* I = 85 */
3487 (PID.TID 0000.0001) 8.254500894890933E+10, /* I = 86 */
3488 (PID.TID 0000.0001) 7.898934631434262E+10, /* I = 87 */
3489 (PID.TID 0000.0001) 7.484854821844796E+10, /* I = 88 */
3490 (PID.TID 0000.0001) 7.014205907742783E+10, /* I = 89 */
3491 (PID.TID 0000.0001) 6.488320895111515E+10, /* I = 90 */
3492 (PID.TID 0000.0001) 5.907428494299064E+10, /* I = 91 */
3493 (PID.TID 0000.0001) 5.269930713599078E+10, /* I = 92 */
3494 (PID.TID 0000.0001) 4.571243814190768E+10, /* I = 93 */
3495 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
3496 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
3497 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
3498 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
3499 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
3500 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
3501 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =100 */
3502 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =101 */
3503 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =102 */
3504 (PID.TID 0000.0001) 5.907428494299064E+10, /* I =103 */
3505 (PID.TID 0000.0001) 6.488320895111515E+10, /* I =104 */
3506 (PID.TID 0000.0001) 7.014205907741883E+10, /* I =105 */
3507 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =106 */
3508 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =107 */
3509 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =108 */
3510 (PID.TID 0000.0001) 8.549360686473493E+10, /* I =109 */
3511 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =110 */
3512 (PID.TID 0000.0001) 8.948571540392020E+10, /* I =111 */
3513 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =112 */
3514 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =113 */
3515 (PID.TID 0000.0001) 9.049530583087069E+10, /* I =114 */
3516 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =115 */
3517 (PID.TID 0000.0001) 8.781353403174184E+10, /* I =116 */
3518 (PID.TID 0000.0001) 8.549360686467183E+10, /* I =117 */
3519 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =118 */
3520 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =119 */
3521 (PID.TID 0000.0001) 7.484854821844796E+10, /* I =120 */
3522 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =121 */
3523 (PID.TID 0000.0001) 6.488320895111515E+10, /* I =122 */
3524 (PID.TID 0000.0001) 5.907428494299064E+10, /* I =123 */
3525 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =124 */
3526 (PID.TID 0000.0001) 4.571243814190768E+10, /* I =125 */
3527 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =126 */
3528 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =127 */
3529 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =128 */
3530 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =129 */
3531 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =130 */
3532 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =131 */
3533 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =132 */
3534 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =133 */
3535 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =134 */
3536 (PID.TID 0000.0001) 5.907428494299064E+10, /* I =135 */
3537 (PID.TID 0000.0001) 6.488320895111515E+10, /* I =136 */
3538 (PID.TID 0000.0001) 7.014205907741883E+10, /* I =137 */
3539 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =138 */
3540 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =139 */
3541 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =140 */
3542 (PID.TID 0000.0001) 8.549360686473493E+10, /* I =141 */
3543 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
3544 (PID.TID 0000.0001) 8.948571540392020E+10, /* I =143 */
3545 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
3546 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
3547 (PID.TID 0000.0001) 9.049530583087069E+10, /* I =146 */
3548 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
3549 (PID.TID 0000.0001) 8.781353403174184E+10, /* I =148 */
3550 (PID.TID 0000.0001) 8.549360686467183E+10, /* I =149 */
3551 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =150 */
3552 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =151 */
3553 (PID.TID 0000.0001) 7.484854821844796E+10, /* I =152 */
3554 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =153 */
3555 (PID.TID 0000.0001) 6.488320895111515E+10, /* I =154 */
3556 (PID.TID 0000.0001) 5.907428494299064E+10, /* I =155 */
3557 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =156 */
3558 (PID.TID 0000.0001) 4.571243814190768E+10, /* I =157 */
3559 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =158 */
3560 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =159 */
3561 (PID.TID 0000.0001) 1.974052138509018E+10, /* I =160 */
3562 (PID.TID 0000.0001) 1.216690346714270E+10, /* I =161 */
3563 (PID.TID 0000.0001) 1.974052138506315E+10, /* I =162 */
3564 (PID.TID 0000.0001) 2.943712825252015E+10, /* I =163 */
3565 (PID.TID 0000.0001) 3.801790263324359E+10, /* I =164 */
3566 (PID.TID 0000.0001) 4.571243814189866E+10, /* I =165 */
3567 (PID.TID 0000.0001) 5.269930713599979E+10, /* I =166 */
3568 (PID.TID 0000.0001) 5.907428494299064E+10, /* I =167 */
3569 (PID.TID 0000.0001) 6.488320895111515E+10, /* I =168 */
3570 (PID.TID 0000.0001) 7.014205907741883E+10, /* I =169 */
3571 (PID.TID 0000.0001) 7.484854821847499E+10, /* I =170 */
3572 (PID.TID 0000.0001) 7.898934631431560E+10, /* I =171 */
3573 (PID.TID 0000.0001) 8.254500894894537E+10, /* I =172 */
3574 (PID.TID 0000.0001) 8.549360686473493E+10, /* I =173 */
3575 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =174 */
3576 (PID.TID 0000.0001) 8.948571540392020E+10, /* I =175 */
3577 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =176 */
3578 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =177 */
3579 (PID.TID 0000.0001) 9.049530583087069E+10, /* I =178 */
3580 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =179 */
3581 (PID.TID 0000.0001) 8.781353403174184E+10, /* I =180 */
3582 (PID.TID 0000.0001) 8.549360686467183E+10, /* I =181 */
3583 (PID.TID 0000.0001) 8.254500894890933E+10, /* I =182 */
3584 (PID.TID 0000.0001) 7.898934631434262E+10, /* I =183 */
3585 (PID.TID 0000.0001) 7.484854821844796E+10, /* I =184 */
3586 (PID.TID 0000.0001) 7.014205907742783E+10, /* I =185 */
3587 (PID.TID 0000.0001) 6.488320895111515E+10, /* I =186 */
3588 (PID.TID 0000.0001) 5.907428494299064E+10, /* I =187 */
3589 (PID.TID 0000.0001) 5.269930713599078E+10, /* I =188 */
3590 (PID.TID 0000.0001) 4.571243814190768E+10, /* I =189 */
3591 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
3592 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
3593 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
3594 (PID.TID 0000.0001) ;
3595 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3596 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3597 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
3598 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
3599 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
3600 (PID.TID 0000.0001) 4.909074590409594E+10, /* J = 5 */
3601 (PID.TID 0000.0001) 5.581203765722642E+10, /* J = 6 */
3602 (PID.TID 0000.0001) 6.193257577506789E+10, /* J = 7 */
3603 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
3604 (PID.TID 0000.0001) 7.248875782324816E+10, /* J = 9 */
3605 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
3606 (PID.TID 0000.0001) 8.078743937057303E+10, /* J = 11 */
3607 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
3608 (PID.TID 0000.0001) 8.669186205742539E+10, /* J = 13 */
3609 (PID.TID 0000.0001) 8.869393350723612E+10, /* J = 14 */
3610 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
3611 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* J = 16: 17 */
3612 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
3613 (PID.TID 0000.0001) 8.869393350723612E+10, /* J = 19 */
3614 (PID.TID 0000.0001) 8.669186205742539E+10, /* J = 20 */
3615 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
3616 (PID.TID 0000.0001) 8.078743937057303E+10, /* J = 22 */
3617 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
3618 (PID.TID 0000.0001) 7.248875782324816E+10, /* J = 24 */
3619 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
3620 (PID.TID 0000.0001) 6.193257577506789E+10, /* J = 26 */
3621 (PID.TID 0000.0001) 5.581203765722642E+10, /* J = 27 */
3622 (PID.TID 0000.0001) 4.909074590409594E+10, /* J = 28 */
3623 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
3624 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
3625 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
3626 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
3627 (PID.TID 0000.0001) ;
3628 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( m - cartesian, degrees - spherical ) */
3629 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
3630 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
3631 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
3632 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 4 */
3633 (PID.TID 0000.0001) 4.909074590409594E+10, /* I = 5 */
3634 (PID.TID 0000.0001) 5.581203765722642E+10, /* I = 6 */
3635 (PID.TID 0000.0001) 6.193257577506789E+10, /* I = 7 */
3636 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 8 */
3637 (PID.TID 0000.0001) 7.248875782324816E+10, /* I = 9 */
3638 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 10 */
3639 (PID.TID 0000.0001) 8.078743937057303E+10, /* I = 11 */
3640 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 12 */
3641 (PID.TID 0000.0001) 8.669186205742539E+10, /* I = 13 */
3642 (PID.TID 0000.0001) 8.869393350723612E+10, /* I = 14 */
3643 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 15 */
3644 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* I = 16: 17 */
3645 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 18 */
3646 (PID.TID 0000.0001) 8.869393350723612E+10, /* I = 19 */
3647 (PID.TID 0000.0001) 8.669186205742539E+10, /* I = 20 */
3648 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 21 */
3649 (PID.TID 0000.0001) 8.078743937057303E+10, /* I = 22 */
3650 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 23 */
3651 (PID.TID 0000.0001) 7.248875782324816E+10, /* I = 24 */
3652 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 25 */
3653 (PID.TID 0000.0001) 6.193257577506789E+10, /* I = 26 */
3654 (PID.TID 0000.0001) 5.581203765722642E+10, /* I = 27 */
3655 (PID.TID 0000.0001) 4.909074590409594E+10, /* I = 28 */
3656 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 29 */
3657 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 30 */
3658 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 31 */
3659 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 32: 33 */
3660 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 34 */
3661 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 35 */
3662 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 36 */
3663 (PID.TID 0000.0001) 4.909074590409594E+10, /* I = 37 */
3664 (PID.TID 0000.0001) 5.581203765722642E+10, /* I = 38 */
3665 (PID.TID 0000.0001) 6.193257577506789E+10, /* I = 39 */
3666 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 40 */
3667 (PID.TID 0000.0001) 7.248875782324816E+10, /* I = 41 */
3668 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 42 */
3669 (PID.TID 0000.0001) 8.078743937057303E+10, /* I = 43 */
3670 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 44 */
3671 (PID.TID 0000.0001) 8.669186205742539E+10, /* I = 45 */
3672 (PID.TID 0000.0001) 8.869393350723612E+10, /* I = 46 */
3673 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
3674 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* I = 48: 49 */
3675 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
3676 (PID.TID 0000.0001) 8.869393350723612E+10, /* I = 51 */
3677 (PID.TID 0000.0001) 8.669186205742539E+10, /* I = 52 */
3678 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 53 */
3679 (PID.TID 0000.0001) 8.078743937057303E+10, /* I = 54 */
3680 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 55 */
3681 (PID.TID 0000.0001) 7.248875782324816E+10, /* I = 56 */
3682 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 57 */
3683 (PID.TID 0000.0001) 6.193257577506789E+10, /* I = 58 */
3684 (PID.TID 0000.0001) 5.581203765722642E+10, /* I = 59 */
3685 (PID.TID 0000.0001) 4.909074590409594E+10, /* I = 60 */
3686 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 61 */
3687 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 62 */
3688 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 63 */
3689 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 64: 65 */
3690 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 66 */
3691 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 67 */
3692 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 68 */
3693 (PID.TID 0000.0001) 4.909074590409594E+10, /* I = 69 */
3694 (PID.TID 0000.0001) 5.581203765722642E+10, /* I = 70 */
3695 (PID.TID 0000.0001) 6.193257577506789E+10, /* I = 71 */
3696 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 72 */
3697 (PID.TID 0000.0001) 7.248875782324816E+10, /* I = 73 */
3698 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 74 */
3699 (PID.TID 0000.0001) 8.078743937057303E+10, /* I = 75 */
3700 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 76 */
3701 (PID.TID 0000.0001) 8.669186205742539E+10, /* I = 77 */
3702 (PID.TID 0000.0001) 8.869393350723612E+10, /* I = 78 */
3703 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 79 */
3704 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* I = 80: 81 */
3705 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 82 */
3706 (PID.TID 0000.0001) 8.869393350723612E+10, /* I = 83 */
3707 (PID.TID 0000.0001) 8.669186205742539E+10, /* I = 84 */
3708 (PID.TID 0000.0001) 8.404959656062837E+10, /* I = 85 */
3709 (PID.TID 0000.0001) 8.078743937057303E+10, /* I = 86 */
3710 (PID.TID 0000.0001) 7.692702995909871E+10, /* I = 87 */
3711 (PID.TID 0000.0001) 7.248875782324816E+10, /* I = 88 */
3712 (PID.TID 0000.0001) 6.748840226738273E+10, /* I = 89 */
3713 (PID.TID 0000.0001) 6.193257577506789E+10, /* I = 90 */
3714 (PID.TID 0000.0001) 5.581203765722642E+10, /* I = 91 */
3715 (PID.TID 0000.0001) 4.909074590409594E+10, /* I = 92 */
3716 (PID.TID 0000.0001) 4.168532893152940E+10, /* I = 93 */
3717 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
3718 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
3719 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I = 96: 97 */
3720 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
3721 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
3722 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =100 */
3723 (PID.TID 0000.0001) 4.909074590409594E+10, /* I =101 */
3724 (PID.TID 0000.0001) 5.581203765722642E+10, /* I =102 */
3725 (PID.TID 0000.0001) 6.193257577506789E+10, /* I =103 */
3726 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =104 */
3727 (PID.TID 0000.0001) 7.248875782324816E+10, /* I =105 */
3728 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =106 */
3729 (PID.TID 0000.0001) 8.078743937057303E+10, /* I =107 */
3730 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =108 */
3731 (PID.TID 0000.0001) 8.669186205742539E+10, /* I =109 */
3732 (PID.TID 0000.0001) 8.869393350723612E+10, /* I =110 */
3733 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =111 */
3734 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* I =112:113 */
3735 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =114 */
3736 (PID.TID 0000.0001) 8.869393350723612E+10, /* I =115 */
3737 (PID.TID 0000.0001) 8.669186205742539E+10, /* I =116 */
3738 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =117 */
3739 (PID.TID 0000.0001) 8.078743937057303E+10, /* I =118 */
3740 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =119 */
3741 (PID.TID 0000.0001) 7.248875782324816E+10, /* I =120 */
3742 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =121 */
3743 (PID.TID 0000.0001) 6.193257577506789E+10, /* I =122 */
3744 (PID.TID 0000.0001) 5.581203765722642E+10, /* I =123 */
3745 (PID.TID 0000.0001) 4.909074590409594E+10, /* I =124 */
3746 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =125 */
3747 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =126 */
3748 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =127 */
3749 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =128:129 */
3750 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =130 */
3751 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =131 */
3752 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =132 */
3753 (PID.TID 0000.0001) 4.909074590409594E+10, /* I =133 */
3754 (PID.TID 0000.0001) 5.581203765722642E+10, /* I =134 */
3755 (PID.TID 0000.0001) 6.193257577506789E+10, /* I =135 */
3756 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =136 */
3757 (PID.TID 0000.0001) 7.248875782324816E+10, /* I =137 */
3758 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =138 */
3759 (PID.TID 0000.0001) 8.078743937057303E+10, /* I =139 */
3760 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =140 */
3761 (PID.TID 0000.0001) 8.669186205742539E+10, /* I =141 */
3762 (PID.TID 0000.0001) 8.869393350723612E+10, /* I =142 */
3763 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
3764 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* I =144:145 */
3765 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
3766 (PID.TID 0000.0001) 8.869393350723612E+10, /* I =147 */
3767 (PID.TID 0000.0001) 8.669186205742539E+10, /* I =148 */
3768 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =149 */
3769 (PID.TID 0000.0001) 8.078743937057303E+10, /* I =150 */
3770 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =151 */
3771 (PID.TID 0000.0001) 7.248875782324816E+10, /* I =152 */
3772 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =153 */
3773 (PID.TID 0000.0001) 6.193257577506789E+10, /* I =154 */
3774 (PID.TID 0000.0001) 5.581203765722642E+10, /* I =155 */
3775 (PID.TID 0000.0001) 4.909074590409594E+10, /* I =156 */
3776 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =157 */
3777 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =158 */
3778 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =159 */
3779 (PID.TID 0000.0001) 2 @ 1.216690346714270E+10, /* I =160:161 */
3780 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =162 */
3781 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =163 */
3782 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =164 */
3783 (PID.TID 0000.0001) 4.909074590409594E+10, /* I =165 */
3784 (PID.TID 0000.0001) 5.581203765722642E+10, /* I =166 */
3785 (PID.TID 0000.0001) 6.193257577506789E+10, /* I =167 */
3786 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =168 */
3787 (PID.TID 0000.0001) 7.248875782324816E+10, /* I =169 */
3788 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =170 */
3789 (PID.TID 0000.0001) 8.078743937057303E+10, /* I =171 */
3790 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =172 */
3791 (PID.TID 0000.0001) 8.669186205742539E+10, /* I =173 */
3792 (PID.TID 0000.0001) 8.869393350723612E+10, /* I =174 */
3793 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =175 */
3794 (PID.TID 0000.0001) 2 @ 9.071447638299398E+10, /* I =176:177 */
3795 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =178 */
3796 (PID.TID 0000.0001) 8.869393350723612E+10, /* I =179 */
3797 (PID.TID 0000.0001) 8.669186205742539E+10, /* I =180 */
3798 (PID.TID 0000.0001) 8.404959656062837E+10, /* I =181 */
3799 (PID.TID 0000.0001) 8.078743937057303E+10, /* I =182 */
3800 (PID.TID 0000.0001) 7.692702995909871E+10, /* I =183 */
3801 (PID.TID 0000.0001) 7.248875782324816E+10, /* I =184 */
3802 (PID.TID 0000.0001) 6.748840226738273E+10, /* I =185 */
3803 (PID.TID 0000.0001) 6.193257577506789E+10, /* I =186 */
3804 (PID.TID 0000.0001) 5.581203765722642E+10, /* I =187 */
3805 (PID.TID 0000.0001) 4.909074590409594E+10, /* I =188 */
3806 (PID.TID 0000.0001) 4.168532893152940E+10, /* I =189 */
3807 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
3808 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
3809 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
3810 (PID.TID 0000.0001) ;
3811 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( m - cartesian, degrees - spherical ) */
3812 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
3813 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
3814 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
3815 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
3816 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
3817 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
3818 (PID.TID 0000.0001) 5.907428494299064E+10, /* J = 7 */
3819 (PID.TID 0000.0001) 6.488320895111515E+10, /* J = 8 */
3820 (PID.TID 0000.0001) 7.014205907741883E+10, /* J = 9 */
3821 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
3822 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
3823 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
3824 (PID.TID 0000.0001) 8.549360686473493E+10, /* J = 13 */
3825 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
3826 (PID.TID 0000.0001) 8.948571540392020E+10, /* J = 15 */
3827 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
3828 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
3829 (PID.TID 0000.0001) 9.049530583087069E+10, /* J = 18 */
3830 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
3831 (PID.TID 0000.0001) 8.781353403174184E+10, /* J = 20 */
3832 (PID.TID 0000.0001) 8.549360686467183E+10, /* J = 21 */
3833 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
3834 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
3835 (PID.TID 0000.0001) 7.484854821844796E+10, /* J = 24 */
3836 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
3837 (PID.TID 0000.0001) 6.488320895111515E+10, /* J = 26 */
3838 (PID.TID 0000.0001) 5.907428494299064E+10, /* J = 27 */
3839 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
3840 (PID.TID 0000.0001) 4.571243814190768E+10, /* J = 29 */
3841 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
3842 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
3843 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
3844 (PID.TID 0000.0001) ;
3845 (PID.TID 0000.0001)
3846 (PID.TID 0000.0001) // =======================================================
3847 (PID.TID 0000.0001) // Field Atmosphere orography on ocean grid at iteration 1
3848 (PID.TID 0000.0001) // CMIN = 4.905667583685931E+04
3849 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+05
3850 (PID.TID 0000.0001) // CINT = 1.886789783820026E+03
3851 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
3852 (PID.TID 0000.0001) // 0.0: .
3853 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
3854 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
3855 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
3856 (PID.TID 0000.0001) // =======================================================
3857 (PID.TID 0000.0001) K = 1
3858 (PID.TID 0000.0001) I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
3859 (PID.TID 0000.0001) |--J--|*01234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
3860 (PID.TID 0000.0001) 34 ........................................................................................................................................................................................................................
3861 (PID.TID 0000.0001) 33 ........................................................................................................................................................................................................................
3862 (PID.TID 0000.0001) 32 ..++++++++++++++++wy+y+ww+xsrtwxyx....vonrywwzywommlmpppqtttsuy++yy++y....++++++++++yxxyyxxxxvqmnpqw++++++....++++++++++++++++++++++++++++++++....+++++++++++++++++zyxwwwww+++++++....++++++++++++++++++++++++++++++++..
3863 (PID.TID 0000.0001) 31 ..++++++++++++++wv++++++y+yxywxxyy....wqnotsswwphglqttrnnqssswz+++++++....+++++++++zxxxyyxxyxwuport+++++++....++++++++++++++++++++++++++++++++....+++++++++++++++++zyyxwwwww++++++....++++++++++++++++++++++++++++++++..
3864 (PID.TID 0000.0001) 30 ..++++++++++++++w+++++++++++++wwxz....yumnstsspmfdhmlhgfekosuxz+++++++....++++++++++xxxyzyyyxwwsptx+++++++....++++++++++++++++++++++++++++++++....++++++++++++++zzzzyyxxwxxwwy++++....++++++++++++++++++++++++++++++++..
3865 (PID.TID 0000.0001) 29 ..++++++++++++++++wwx+++++++++wwxy....zxrnosspllkeabbaabdhmsvyzz++++++....++++++++zxwwx++zyyxxwtps++++++++....++++++++++++++++++++++++++++++++....++++++++++++++yyzzyxxxxxxxxxz+++....++++++++++++++++++++++++++++++++..
3866 (PID.TID 0000.0001) 28 ..+++++++++++++xsvwxxxy+zzzzywwwwx....yzypnorqnrwnc--aaabelsvxyx++++++....++++++++zxxxx+++zyxxwvpr++++++++....++++++++++++++++++++++++++++++++....++++++++++++++yyzzyyxxyyyyyyzz++....++++++++++++++++++++++++++++++++..
3867 (PID.TID 0000.0001) 27 ..+++++++++++++vvwxxxxxxzzzyxwwvvw....xyz+++trrwzwkdabccbenvwxxw++++++....++++++++++xxyz++zyxxxwst++++++++....++++++++++++++++++++++++++++++++....+++++++++++++ywyz+zyxxyzz++zzz++....++++++++++++++++++++++++++++++++..
3868 (PID.TID 0000.0001) 26 ..++++++++++++yxxyxwwwwxyyxxyxyyvw....wxz++++yyyyyxvnmmmhhnuwxxy++++++....++++++++++++++++zyxxxwss++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywwx++zyyyxxxz++++z+....++++++++++++++++++++++++++++++++..
3869 (PID.TID 0000.0001) 25 ..+++++++++++yyyyyxvuvwwwxwxyxy+vv....wxzzx++++zxxxyxywwqorwxyy+++++++....++++++++++++x++yyyxxxwss++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywvwz+zzzwmkmrwyyzz+....++++++++++++++++++++++++++++++++..
3870 (PID.TID 0000.0001) 24 ..+++++++++++yyyyyxwwwwstwwxyxy+ws....wxyzz+++++xxxxy++xutvx++++++++++....++++++++++++xx+yyzyxxvst++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywxz++zzukgfghkqvxzz....++++++++++++++++++++++++++++++++..
3871 (PID.TID 0000.0001) 23 ..+++++++++++zyyyyxxwwxxwwwxxxw++p....vwxz++++++yxxy+++ywwwx++++++++++....+++++++++oq+++xxzzyyxvsr++++++++....++++++++++++++++++++++++++++++++....++++++++++++trwy+++wher+yumhkrwx....y+++++++++++++++ww++++++++++++++..
3872 (PID.TID 0000.0001) 22 ..+++++++++++zyyyyxyxxyyxwwwxxvr++....wy++++++++yxy+++++yxxw++++++++++....+++++++++vlr+++x++zzywusw+++++++....++++++++++++++++++++++++++++++++....++++++++++++wpqvy+xrht++++++xuuv....ww+++++++++++++lhhknw+++++++++++..
3873 (PID.TID 0000.0001) 21 ..+++++++++++yxxyyyyxxyyxwwwxxrnv+....+++++++++++yy++++++zyxy+++++++++....+++++++++vkkn++++++++xuutw++++++....++++++++++++++++++++++++++++++++....x++++++++++++ywqsuop++++++++++++....wuwy++++++++++pkhghkklw+++++++++..
3874 (PID.TID 0000.0001) 20 ..+++++++++++yxxyyyxxwxxxwwxxxpmqv....wx+++++++++y++++++++++++++++++++....++++++++++khknwt++++++wwwx++++++....++++++++++++++++++++++++++++++++....xxxz++++++++++++wuw+++++++++++++....++++++++x+++++okhhhhklr+++++++++..
3875 (PID.TID 0000.0001) 19 ..++++++++++++yyyyyyxwwwxwwxxwrnqw....xy+++++++++++++++++y++++++++++++....+++++++x++qlkmxx++++++xyy+++++++....++++++++++++++++++++++++++++++++....xxwxz+++++++y+++++++++++++++++++....+++++++++ws++xqkhgghlow+++++++++..
3876 (PID.TID 0000.0001) 18 ..+++++++++++++++++++wwxxxxwwwutwx....z+++++++++++++++++yy++++yy++++++....+++z++++++++rs++++++++++++++++++....++++++++++++++++++++++++++++++++....yyxxz++++++y++++++++++++++++++++....++++++++++xv+xqlhgfghkr+++++++++..
3877 (PID.TID 0000.0001) 17 ..+++++++++++++++++++yxxyyxwturuy+....+++++++++++++++++++yy++ywy++++++....++zy++++++++++++++++++++y+++++++....++++++++++++++++++++++++++++++++....yzzyz++++zw+++++++++++++++++++++....++++++++++xuwupkhgffghkq++++++++..
3878 (PID.TID 0000.0001) 16 ..+++++++++++++++++++zxxxxxvrtqtz+....++++++++++++++++++++y++yy++++++z....wzz++++++++++++++++++++xxy++++++....++++++++++++++++++++++++++++++++....yyyzz++++yw+++++++++++++++++++++....++++++++++xsonnkhhggghho++++++++..
3879 (PID.TID 0000.0001) 15 ..zy++++++++++++++++++yxxxxvsusv++....+++++++++++++++++++++z++++++++++....txy++xw++++++++++++++++wwx++++++....++++++++++++++++++++++++++++++y+....xxxyz++++y++++++++++++++++++++++....+++++++++++uoqsvkkhhhhkp++++++++..
3880 (PID.TID 0000.0001) 14 ..yxxy++++++++++++++++ywwwwvtttw++....++++++++++++++++++++++++++++++++....twxzzxwwwx++++++++++++zxwx++++++....+++++++++++++++++++++++++++++++y....wwxxxyz++v++++++++++++++++++++++....+++++++++++woux+xmkhhklv++++++++..
3881 (PID.TID 0000.0001) 13 ..xxx++++++++++++++++++vvvvutsux++....++++++++++++++++++++++++++++++++....vwxz++zzyy+++++++++++zyxwxx+++++....++++++++++++++++++++++++++++++++....uttvwwvqot++++++++++++++++++++++....++++++++++++vwy++plkkko+++++++++..
3882 (PID.TID 0000.0001) 12 ..wwy+++++++++++++++++xsuvuuuuwx++....++++++++++++++++++++++++++++++++....wwxzzzzzyy+++++++z+++xwwv++x++++....++++++++++++++++++++++++++++++++....nmlossqoq+++++++++++++++++++++++....+++++++++++++++++qlkklw+++++++++..
3883 (PID.TID 0000.0001) 11 ..ww++++++++++++++++++wtvvvvvvwy++....+y++++++++++++++++++++++++++zzzz....wwxyzzzzzz+++++zzyzywvtrv+++++++....++++++++++++++++++++++++++++++++....mllnqpqw++++++++++++++++++++++++....+++++++++++++++++qmmmq++++++++++..
3884 (PID.TID 0000.0001) 10 ..wx++++++++++++++++++xuvwwvuwy+++....xw+++++++++++++++++++++++++zyyyy....wwxyzzzzzzzzy++zxxxywvtsx+++++++....++++++++++++++++++++++++++++++++....nnoquw++++++++++++++++++++++++++....++++++++++++++++++ww++++++++++++..
3885 (PID.TID 0000.0001) 9 ..wy+++++++++++++++++++tuvwvvw++++....w+++++++++++++++++++++++++zzyxyy....+yzzzzzzzzyxxzzywwxxyxxwx+++++++....++++++++++++++++++++++++++++++++....onrwy+++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3886 (PID.TID 0000.0001) 8 ..y++++++++++++++++++++tuvvvwy++++....x+++++++++++++++++++++++yxxyxxxx....+++zzzzzzyxyz+zzwwxxyxxwwxy+++++....++++++++++++++++++++++++++++++++....posx++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3887 (PID.TID 0000.0001) 7 ..+++++++++++++++++++++wvvusuz++++....y+++++++++++++++++++++++yxxxxxxx....y++zzzzzzyyzzzzzxxxxwwwvvvxx++++....+++++++++++++++++++++++++yxxxyy+....xyy+++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3888 (PID.TID 0000.0001) 6 ..+++++++++++++++++++++ywusqw+++++....++++++++++++++++++++++++yxxxxxxx....w++wzzzzyxyzzzzzxxxwuuwwxwxx++++....++++++++++++++++++++++++zyyyyxxy....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3889 (PID.TID 0000.0001) 5 ..++++++++++++++++++++++vtrv++++++....++++++++++++++++++++++++yxxyyyyy....q++py++zyxzzzzzyxxxwsuwwxxxx++++....+++++++++++++++++++++++yyxyzzzyy....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3890 (PID.TID 0000.0001) 4 ..++++++++++++++++++++++yyy+++++++....++++++++++++++++++++++++yyyzzzzz....snnny++zyyyyzzywvtuvtvwwxxwx+++y....++++++++++++++++++w+++xxyyzzzzzz....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3891 (PID.TID 0000.0001) 3 ..++++++++++++++++++++++++++++++++....+++++++++++++++++++++++++++++++z....tmnvz+zzzyxxxxwqpnotsuvwyxwy++++....y++++++++++++++++wv+++zyzzzzzyz+....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3892 (PID.TID 0000.0001) 2 ..++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++....unny+zzzzzxxwwrnmmmqsuvvxxw+++++....y++++++++++++++++w++++zyyz+zyyy+....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
3893 (PID.TID 0000.0001) 1 ..++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++....uooy+yyzzyxwwqoomlmqtvutwyy+++++....y++++++++++++++++y++++zyyyzzzzz+....++++++++++++++++++++++++++++++++....++++++++++++++++++y+++++++++++++..
3894 (PID.TID 0000.0001) 0 ........................................................................................................................................................................................................................
3895 (PID.TID 0000.0001) -1 ........................................................................................................................................................................................................................
3896 (PID.TID 0000.0001) // =======================================================
3897 (PID.TID 0000.0001) // END OF FIELD =
3898 (PID.TID 0000.0001) // =======================================================
3899 (PID.TID 0000.0001)
3900 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_T_cs_15k.bin
3901 (PID.TID 0000.0001) // =======================================================
3902 (PID.TID 0000.0001) // Field Initial Temperature at iteration 1
3903 (PID.TID 0000.0001) // CMIN = -1.820018601798449E+00
3904 (PID.TID 0000.0001) // CMAX = 2.938267637698524E+01
3905 (PID.TID 0000.0001) // CINT = 1.155655369584581E+00
3906 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
3907 (PID.TID 0000.0001) // 0.0: .
3908 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 192: 1)
3909 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 32: 1: -1)
3910 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
3911 (PID.TID 0000.0001) // =======================================================
3912 (PID.TID 0000.0001) K = 1
3913 (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60 I=70 I=80 I=90 I=100 I=110 I=120 I=130 I=140 I=150 I=160 I=170 I=180 I=190
3914 (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|12
3915 (PID.TID 0000.0001) 32 ttsssrqqpppoonnn..o.o..p.................................kk..pp.tttsrrpmig................lnooppqqrrsttuvwxxyyyxxyyyyyyxxwvtsrqqttuuvvwxxxxyyyyy.........tuuttsrrqqponmlkjiihgggggghijklmnopqqqr
3916 (PID.TID 0000.0001) 31 tttsssrrqqqppo..pppqqq.q.................................lllrq.usssrolkhf................llmnoppqqrsstuuvwxxyyyxxyyzzyyyxwutsrqpttuuvwwxxxxyyyyy..........uuttsrqqpomlkjihggfeeeeeeefggijklnopqq
3917 (PID.TID 0000.0001) 30 uutttsssrrrqqq.pqqqqqrrrrrss.............................lmnrtvussrpkhfeed...............klmnnoppqrsttuvvwxxyyyxxyyzzzyxxvutsrqpttuuvwwxxxyyyy..............tssrqpomlkjhgfeedcccccccddfgghikmopq
3918 (PID.TID 0000.0001) 29 uuuutttsssrrrrpp...rrrrrsstt..............................opsvvvsrrojed......bb.........kkllmnnopqrstuuvvwxxyzyyyyzzzzyxwvutsrqpttuuvwxxxyyyyy...............qqqqpnlkjhgeddccbbbbbbbbcdeefghjmop
3919 (PID.TID 0000.0001) 28 vvuuuutttsssr........s....................................rsuvvvrqqojfdc.....bba........jkkklmnopqrstuvvvwxxyzyyyyzzzzyxwvutrqpotttuvwxxyyyyyy................nooonlkigedcbbbbaaaaabbbcddefghjmo
3920 (PID.TID 0000.0001) 27 vvvvvuutttssr......................wxx....................tvwwwvqqpokhgecc....bb........jjjjklmnoqrstuvvwwxxyzyyyzzzzzyxwvusrqpottuuvwxxyyyyy.................llmmmljgedcbaaaaaaaaaabbcccdeffhko
3921 (PID.TID 0000.0001) 26 wwvvvvuuutss.......................xxww...................uwwwwwqponljhgeedbbbbb........ijiijklmopqstuvvwwxxyzzyyzzzzzyxwutsrpontuuuvwxxyyyy...................kjkkjhfdccbaaaaaaaaaaabbbccdefhkn
3922 (PID.TID 0000.0001) 25 wwwwvvvuutr..................z.......wxxx................wxxxxxxponmkihffedc.ba.........iiiiijklnoqstuvwwwxxyzyyyzzzzzyxwutsrponruuuvwxxyyyy...................nkiiigfdcbaa-aaaaaaaaaaabbcdefhkn
3923 (PID.TID 0000.0001) 24 xwwwwvvvus...................z.......xxyyy.....zz.....vwwxyyyyyyponljigfedcb............hhhhhijkmoprtuvwwxxxyzyyyzzzzzyxwutsqpomotuuuvxxyyyy....................ljhhgfdbaa------aaaaaaabbccdegjm
3924 (PID.TID 0000.0001) 23 xxwwwwvvut...................++.....wxyyyy....zzz.....xxxyyzzzzzonmljihgf..baa..........hhghhhiklnprsuvwxxxyyzzyyz++zzyxwutrqpnmkquuuvwxy.yy...........r.........kiigfdba-------..-a-aaaabcdefhk
3925 (PID.TID 0000.0001) 22 xxxxwwwvvu....................zz..wxxyyyzz...zzzzz....xyyzzzzzzzonmlkjihf...baa.-a.......hggghijlnpqsuvwxxxyyzzyzz++zzyxvutrqpnminsuvvwxyyyy..........rrqpoo......hhgeca-------......-aaabcddefj
3926 (PID.TID 0000.0001) 21 xxxxxxwwwv.....................yyxxxyyyzzzz..zzzzzz....yzzzzzzzzonmlkjihf....aaa-aaa-.....gggghjkmoqsuvwxxxyyzzzzz++zzywvutrqpnm.kpvwwxx.zyyy.......qqrrrqpponmm....gfca.-----.........aaabcddfi
3927 (PID.TID 0000.0001) 20 yyyyyxxxxww.......................xyyyzzzzz.zzzzzzzzz.yzzzzzzzzznmmlkjjieb......-aa--a....degghikmoqstvwxxyyyzzzzz++zzyxvutrqonm....wxxy.zzyy.ww...ssssrrrqppomlkjihgfca.a----.........-aabccdfi
3928 (PID.TID 0000.0001) 19 yyyyyyyyyxxx......................yyyzzzzzzzzzzzzzz.zyzzzzzz.zz+nmllkjj.db......-----a...cdefgghjmoqstvwxxyyyzzzzz++zzywvusrqoom.......xzzzy.xxvtrsttsssrrrqponlkjihgecaa..--..........aaaabcdfi
3929 (PID.TID 0000.0001) 18 yyyyyyyyyyyyyywxxyx..............yyyzzzzzzzzzzzzzz..zzzz..zzzzz+nlk.kjhfdbaa..-------aabbbdeffghjmoqstvwxyyyyzzzz+++zzywvusrqpom.....vwxyyy.uxxvttuuttsssrrqpomljihgfecaa-.............aaaabcegi
3930 (PID.TID 0000.0001) 17 yyyyyyyyyyyxxxxxxxx.............yyyyzzzzzzzzzzzz+++..zz...zzzz++nl..ijhgfdbaa---------aa.cdeffghjloqstvwxyyyzzzzz+++zzxwvusrqpom.....vwxw..xvvxvtuvuutttssrqpomljihgfecba-..............-aabcegi
3931 (PID.TID 0000.0001) 16 yyyyyyyxxxxxwwwwwwv............yyyyzzzzzzzzzzzzzz+zz.zz..zzzzzz....jiiiihfddca---------...eeffghjloqstvwxyyyzzzzz+++zzxwvusrqqom......wxx..xvvxvsuvvuttttssrpomkjihgfecba-..............-abbcegi
3932 (PID.TID 0000.0001) 15 ..yyyyyyxxxxxwwwvvut..........yyyyyyzzzzzzzzzzzzzzzzz.zzzzzzzzzz...ji..ihgfc.----------...defffgimoqsuvxxyyyzzzzz+++zzywvusrq..l......wxx.xxwxxvtvvvuuutttsrpomkjihgfecbaaa.............-aabcefh
3933 (PID.TID 0000.0001) 14 ....yyyyyxxxxwwwvvut..........yyyyyyyyyyzzzzzzzzzzzzzzz.zzzzzzzz..........fca------aa-....defffgimoqsuvxxyyyzzzzz+++zyxwvusrqpo........xx.zyxxxvuvwvvuuuttsrpomkjihgfedbaa-.............-abbcefi
3934 (PID.TID 0000.0001) 13 ...yyyyyxxxwwwvvvvutt.........yyyyyyyyyyyyyyyyyyzzzzzzzzyyyzzzzz..........fdba-----aa......deffgimprsuvxyyyzzzzz++++zyxwvutrqpon..........zzyyxvuvwwvvuuuttrqomljihhgedcba--...........-aabcdegi
3935 (PID.TID 0000.0001) 12 ...yyyxxxwwwvvuuuutt..........yyyyxyyyyyyyyyyyyyyyyyyyyzzzzzzzz...........dcba--a.aaa....cc.eefgjmprtuwxyyyzzz++++++zyxwvutsrpon.........yzzyyxvuvwwvvvuuutrqonlkjhhgedcba-------......aabcddfhj
3936 (PID.TID 0000.0001) 11 ..yyyxxwwwvvvuutttsr..........yyy.xxxxxxxxxxxxxxxxxxxyyyyyzz..............cca--..........bcddefhjnqrtuwxyyzzzz++++++zyxwvuttrqpn........wxyzyyxvvwwwwvvvvutsqpnmkjihgfdcbaa-----a.....aabcddegij
3937 (PID.TID 0000.0001) 10 ..xxxxxwwvvvuuuttssq.........xyy..xxxxxxxwwwxwwwwwwwwxxxyyy..............................bcdddehknqstuwxyyzzzz++++++zyxwvuutsrpo......uvvxyyzyxvvwwwwwvvvutsrpnmkjihgfedbaaa------..-aabccdefhjk
3938 (PID.TID 0000.0001) 9 ..xxxxwwwvvvuutttsrqo.......xxxx.xxxxwwwwwwvwvvvvvvvvvwwxy......l........................bbcddehlorstvwxyzzzz+++++++zyxwvvuutrqo.....srtvwyyyyxwvwxxwwwvvutsrpomlkihhgfdcbaaaaaaa---aabcddefhijk
3939 (PID.TID 0000.0001) 8 .wwwwwwwvvvuuuttssrqo.......xxxx.xwwwwwwvvvvuuuuuuuuuuvv........kk.........................dcdeimprtuvwxyzzzz++++++zzyxxwwvutsqp....pqrtvwyyyyxwvwxxxwwwvvutrqonlkjihhfedbaaaaabbaaaabbcdefhijkl
3940 (PID.TID 0000.0001) 7 uvwwvvvvvuuutttssrrqp.......wwww.wwwwvvvvuuuttttttttttuu.........kj.........................deginqstuvwxyzzzz++++++zyyxxw......o...opqrsuwxyyyxwvwxxxxxwwvutsqpnmljjihhfecbbbbbccccbbbcdefgijkkl
3941 (PID.TID 0000.0001) 6 uvvvuuuutttttsssrrrqp......wwvvvvvvvvuuutttssssrrrrrsstu.........jj.........................h.ikorttuvwyyzzzz+++++zzyyxx........mmnopqrtuwxyyyxwwwxxxxxwwvutsrpomlkjjiihgeddddddeeeddddefgijkklm
3942 (PID.TID 0000.0001) 5 uuuutttssssrrrrrrqqqqo....vvvvvuuuuutttsssrrrrqqqqqqqrst.........kk.........................gi.lortuuvwyyzzzz+++++zyyyx.........nnopqrstuvxxyyxwwxxxxxxxwvutsrponmlkkjiihggfffffgggfffgghijkklmn
3943 (PID.TID 0000.0001) 4 ttttssrrrqqqqppppppqqq...uuuuuuttttsssrrrqqpppooooooppqs....................................eil.pstuuvwyyzzzz+++++.yyy..........oopqrrstuvwxyyxwwxxyyyxxwwutsrqoonmlkjjjiiihhhhhhhhhhhiijjkllmmn
3944 (PID.TID 0000.0001) 3 sssrrrqqppooonnnmnnpqrrssttttstssssrrrqqppoonnnnmnnnnopqqqqqqqq.............................gjmo.ttuuvwyyzzzz++++..zy..........oppqqrsttuvxxyyxwwxyyyyyxxwvtsrqponnmlkkjjjjjjjjiiiiijjjkkllmmnno
3945 (PID.TID 0000.0001) 2 rrrqqqpoonmmmllkkklnpqqqrssssrssrrrrqqppoonnmmmlllllmmnoopppppqq...........................hjlop.tuuvvwyyzzzz++++.yzyy.........ppqqrrstuvwxxyyyxxxyyyyyxxwvtsrqppoonmllkkkkkkkkjiijkkkllmmmnnnoo
3946 (PID.TID 0000.0001) 1 rrqqpponmlkkkjijiiiklnnopqrrrrrrrrqqqpponnmllkkkjjkkkklmmnoooppq...........................jmopp.tuuvvwxyzzzz++++.yzyy.........pqqrrsstuvwxxyyyxxxyyyyyxxwvtsrqqppoonnmmlllllllkkj.mlmmnnnnnooop
3947 (PID.TID 0000.0001) // =======================================================
3948 (PID.TID 0000.0001) // END OF FIELD =
3949 (PID.TID 0000.0001) // =======================================================
3950 (PID.TID 0000.0001)
3951 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_S_cs_15k.bin
3952 (PID.TID 0000.0001) // =======================================================
3953 (PID.TID 0000.0001) // Field Initial Salinity at iteration 1
3954 (PID.TID 0000.0001) // CMIN = 1.814484149562675E+01
3955 (PID.TID 0000.0001) // CMAX = 3.993039913177490E+01
3956 (PID.TID 0000.0001) // CINT = 8.068725050425241E-01
3957 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
3958 (PID.TID 0000.0001) // 0.0: .
3959 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( 1: 192: 1)
3960 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 32: 1: -1)
3961 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
3962 (PID.TID 0000.0001) // =======================================================
3963 (PID.TID 0000.0001) K = 1
3964 (PID.TID 0000.0001) I=10 I=20 I=30 I=40 I=50 I=60 I=70 I=80 I=90 I=100 I=110 I=120 I=130 I=140 I=150 I=160 I=170 I=180 I=190
3965 (PID.TID 0000.0001) |--J--|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|12
3966 (PID.TID 0000.0001) 32 wwwwvvvvvvvvvvvu..y.y..y.................................pq..tt.wwwvvvutrq................rrrsssstttuuuuttttttuuuuuvvvwvvvvuuuuuwwwwwxxxwwwvvvvv.........vvwwvvvvvuuuuuutttttttttttttttuuuuuuvvv
3967 (PID.TID 0000.0001) 31 wwwwwvvvvvvvvv..yxyyyy.y.................................pqrtt.twwvvutsrp................rrrrssssttuuuuuutttttuuuuuvvvvvvvvuuuuuwwwwwxxxwwvvvvvv..........vvvvvvvvuuutttttttttttttsttttttttuuuvv
3968 (PID.TID 0000.0001) 30 wwwwwwwwwwvvvv.xxxxxyyyzzzzy.............................qqrttttwvvvtsrqpp...............rrrrssssttuuuuuutttttuuuuuvvvvvvvuuuuuuwwwwwwwwwwvvvv..............uuvvvuuuttttttttssssttttttttttttuuuv
3969 (PID.TID 0000.0001) 29 wwwwwwwwwwwwwwww...xxyyzzzzz..............................rsttttvvvutrq......km.........qrrrrrsssttuuuuuutttttuuuuuvvvvvvvvuuuuuwwwwwwwwwvvuuv...............tuuvuutttttttttsssttttttttttttttuuu
3970 (PID.TID 0000.0001) 28 wwwwwwwwwwwww........y....................................ssttttvvvutssr.....npq........qrrrrrsssttuuuuuutttttuuuuvvvvvvvvvuuuutwwwwwwwwvvuuuv................suuuuttttttttsssttttttttttttssttuu
3971 (PID.TID 0000.0001) 27 xxxxxxwwwwwww......................+yw....................ttttuuvvvuuttsss....oq........qrrrrrsssttuuuuuutttttuuuuvvvvvvvvvuuuutwwwwwwwwvvuuv.................sttuuttttttttssttttttttttttttssttu
3972 (PID.TID 0000.0001) 26 xxxxxxxxwwww.......................+www...................tttuuuvvvuutttttsrqqpq........qrrrrrrssttuuuuuutttttuuuuvvvvvvvvuuuuutvwwwwwwwvvuv...................sttttttttttttttttttttsssttttssttu
3973 (PID.TID 0000.0001) 25 xxxxxxxwwww..................z.......wwww................ttttuuuvvvuuututtts.rr.........qrrrrrrssstuuuuuutttttuuuuvvvvvvvuuuuuttvvwwwwwwvvuv...................sstttttttttttttttttttsssttttssttu
3974 (PID.TID 0000.0001) 24 xxxwwwwwww...................z.......vwwwv.....qq.....sttttttttuvvvuuuuuttss............rrrrrrrsssttuuuuutttttuuuuvvvvvvvvuuuutttvwwwwwwvuvv....................sstttttttttttttttttttttttttssttu
3975 (PID.TID 0000.0001) 23 wwwwwwwwvv...................yy.....vvwwwv....srr.....sttsstttttvvvuuuuuu..srr..........qrrrrrrsstttuuuuuuttttuuuuvvvvvvvvuuuuttsuvwwwwww.vv...........u.........ssstttttttttttt..ttttttssttsstt
3976 (PID.TID 0000.0001) 22 wwwwwwvvvv....................xw..vvvvvwwv...sssrr....ssssstttttvvvuuuuuu...sss.qq.......qrrrrrsstttuuuuuuttttuuuuuuvvvvvvvuuuttrtvvwwwwwvvv..........uuuttt......ssstttttttttt......tttsssssstt
3977 (PID.TID 0000.0001) 21 vvvvvvvvvv.....................vvvvvvvvvvvu..sssrrq....sssstttttvvvuuuuut....ssrqqqpp.....qrrrrsstttuuuuuuttttuuuuuuuuuuuvvuuuut.stvwwww.vvvv.......uuuuuttttsss....tttt.ttttt.........tsssstttt
3978 (PID.TID 0000.0001) 20 vvvvvvvvvvu.......................vvvvvvvvu.sssssrrqq.ssssstttttvvuuuuuuts......qqpooo....qqrrrsstttuuuuuuttttuuuuuuuuuuuvvvuuuu....vvvv.vvvv.ss...uuuuuutttttssssssstts.ttttt.........tsssstttt
3979 (PID.TID 0000.0001) 19 vvvvvvvvvvuu......................vvvvvvvuuuttttssr.rssssstt.tttvuuuuuu.tt......qpooop...qpqrrrsstttuuuuuuttttuuuuuuuuuuuvvvuuuu.......vvvvv.rsstuuuuuuuuutttttssssstttss..tt..........tsssttttt
3980 (PID.TID 0000.0001) 18 vvvvvvvvvuuuuuuuuut..............uuuuuuuuuuuuttttt..ssss..ttttttvuu.uuuuuttr..pqpoooopqqrqqrrrrsstttuuuuuuttttuuuuuuuuuuuvvvuuuu.....vvvvvv.tssttuuuuvuuuuuttttttttttttsss.............tsstttttt
3981 (PID.TID 0000.0001) 17 vvvvvvvvvvvuuuuuuut.............uuuuuuuuuuuuuutttts..rs...ttttttuu..uuuuuuttrrpppppoopqr.rrrsrrsstttuuuuuuutttuuuuuuuuuuvvvvvuuu.....vvvw..sttstuuuuvvvvuuuttttttttttttsss..............sttttttt
3982 (PID.TID 0000.0001) 16 vvvvvvvvvvvvvvuuuuu............uuuuuuuuuuuuuuuutttsr.rr..sttttt....tuuuuuuuutssrqqpooop...rssrrsstttuuuuuuuttttuuuuuuuuuuvvvvvuu......vww..tttstuuuuvvvvuuuutttttttttttsss..............tttttttt
3983 (PID.TID 0000.0001) 15 ..vvvvvvvvvvvvvvvvvv..........uuuuuuuuuuuuuuuuuttttss.rrsssttttt...tt..ttuut.ssssrqpnno...rssrrrstttuuuuuuuttttuuuuuuuuuvvvvv..t......vww.ttttstuuuuvvvvvuuutttttttttttssst.............tttttttt
3984 (PID.TID 0000.0001) 14 ....vvvvvvvvvvvvvvvv..........uuuuuuuuuuuuutttttttttsss.sssstttt..........utttttsrqomm....rrrrrrstttuuuuuuutttuuuuuuuuuuvvvvuuu........ww.ttttttuuuuvvvvvuuuttttttttttttsst.............tttttttt
3985 (PID.TID 0000.0001) 13 ...wwwwwwwwwwwwvvvvvv.........uuuuuuuuuuuutttttttttttttttttttttt..........uutttssrpol......rrrrsstttuuuuuuutttuuuuuuuuuuvvvvvuuu..........tttsttuuuuvvvvvuuuttttttttttttssst...........ttttttttt
3986 (PID.TID 0000.0001) 12 ...wwwwwwwwwwwwwvvvv..........uuuuuuuuuuuuttttttttttttttttttttt...........tttsssr.pom....rr.rrrsstttuuuuuuuttttuuuutuuuuvvvvvuuu.........ttsssttuuuuvvvvvvuutttttttttttttsssstttt......ttttttttt
3987 (PID.TID 0000.0001) 11 ..wwwwwwwwwwwwwwvvvv..........uuu.uuuuuuuutttttttttttttttttt..............stsrq..........rrrrrrsstttuuuuuuutttttuuttuuuuvvvvvvuu........tttsssttuuuuvvvvvvuutttttttttttttsssstttt.....tttttttttt
3988 (PID.TID 0000.0001) 10 ..xxxxxwwwwwwwwvvvvv.........uuu..uuuuuuuuuuuuuuuuuuuuuuuuu..............................rrrrrrsstttuuuuuuutttttuuutuuuuvvvvvvuu......uutttsssttuuuuvvvvvvvuuttttttttttttttttttttt..tttttttttttt
3989 (PID.TID 0000.0001) 9 ..wwwwwwwwwwwwvvvvvuu.......uuuu.uuuuuuuuuuuuuuuuuuuuuuuuu......-........................rrrrrrsttttuuuuuuutttttttuuuuuuvvvvvvuu.....utttttsssttuuuuvvvvvvvuuttttttttttttttttttttttttttssttttttu
3990 (PID.TID 0000.0001) 8 .wwwwwwwwwwwwvvvvvvuu.......uuuu.uuuuuuuuuuuvvvvvuvuuuuu........--.........................rrrrsttttuuuuuuutttttttuuuuuuuuvvvvvu....sssttttssttuuuuuvvwwvvvuuttttttttttttttttttttttttttssttttttu
3991 (PID.TID 0000.0001) 7 wwwwwwwwwwvvvvvvvvvuu.......uuuu.uuuuuuuvvvvvvvvvvvvvvvu.........--.........................srssttttuuuuuutttttttuuuuuuuu......u...ssstttttssttuuuuuvvwwwvvuuuttttttttttttttttttttttttssttttttuu
3992 (PID.TID 0000.0001) 6 wwwwwvvvvvvvvvvvvvvvu......uuuuuuuuuuuuvvvvvvvvvvvvvvvvv.........--.........................t.sstttuuuuuuuttttttttuuuuuu........rsssssttttttsttuuuuuvvwwwvvvuuttttttttttttttttttttttttttttttttuu
3993 (PID.TID 0000.0001) 5 wwvvvvvvvvvvvvvvvvvvuu....uuuuuuuuuuuvvvvvvvvvvvvvvvvvvv.........--.........................tt.stttuuuuuuuuttttttttuuuu.........rrsssttttttttttuuuuuvvwwwvvvuuttttttttttttttttttttttttttttttuuuu
3994 (PID.TID 0000.0001) 4 wvvvvvvvvvuuuuuuuuuuuu...uuvuuuuvvvvvvvvvvvuuuuuuuuvvvvv....................................ttt.tttuuuuuuutttttttt.uuu..........rssssttttttttttuuuuvvvwwwvvvuuuttttttttttttttttttttttttttttuuuuu
3995 (PID.TID 0000.0001) 3 vvvvvvvvuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvuuuuuuuuuuuuuuuvvvvvvvvvv.............................tttt.tttuuuuuuttttttt..ut..........vsssstttttttttttuuuuvvvwwwvvvuuuttttttttttttttttttttttttuuuuuuuuu
3996 (PID.TID 0000.0001) 2 vvvvvvuuuuuuuutttttuuuuuuvvvvvvvvvvvvuuuuuuuuuuuuuuuuuuuuuvvvvvv...........................stttt.tttuuuuutttttttt.tttt.........vssttttuutttttttuuuuvvvwwvvvuuuuutttttttttttttttttttuttuuuuuuuuuu
3997 (PID.TID 0000.0001) 1 vvvvuuuuuuutttttttttuuuuuuuvvvvvvvvvuuuuuuuutttttttuuuuuuuuuuuvv...........................stttt.ttttuuuutttttttt.tttt.........vsstttuuuttttttuuuuuvvvwvvvvuuuuuutttttttttttuuuttt.uuuuuuuuuuvvv
3998 (PID.TID 0000.0001) // =======================================================
3999 (PID.TID 0000.0001) // END OF FIELD =
4000 (PID.TID 0000.0001) // =======================================================
4001 (PID.TID 0000.0001)
4002 (PID.TID 0000.0001) Start initial hydrostatic pressure computation
4003 (PID.TID 0000.0001) Pressure is predetermined for buoyancyRelation OCEANIC
4004 (PID.TID 0000.0001)
4005 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4006 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4007 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiQnet_cs32.bin
4008 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiEmPR_cs32.bin
4009 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4010 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4011 (PID.TID 0000.0001) // =======================================================
4012 (PID.TID 0000.0001) // Model current state
4013 (PID.TID 0000.0001) // =======================================================
4014 (PID.TID 0000.0001)
4015 (PID.TID 0000.0001) // =======================================================
4016 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4017 (PID.TID 0000.0001) // =======================================================
4018 (PID.TID 0000.0001) %MON time_tsnumber = 0
4019 (PID.TID 0000.0001) %MON time_secondsf = 0.0000000000000E+00
4020 (PID.TID 0000.0001) %MON dynstat_eta_max = 0.0000000000000E+00
4021 (PID.TID 0000.0001) %MON dynstat_eta_min = 0.0000000000000E+00
4022 (PID.TID 0000.0001) %MON dynstat_eta_mean = 0.0000000000000E+00
4023 (PID.TID 0000.0001) %MON dynstat_eta_sd = 0.0000000000000E+00
4024 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 0.0000000000000E+00
4025 (PID.TID 0000.0001) %MON dynstat_uvel_max = 0.0000000000000E+00
4026 (PID.TID 0000.0001) %MON dynstat_uvel_min = 0.0000000000000E+00
4027 (PID.TID 0000.0001) %MON dynstat_uvel_mean = 0.0000000000000E+00
4028 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 0.0000000000000E+00
4029 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 0.0000000000000E+00
4030 (PID.TID 0000.0001) %MON dynstat_vvel_max = 0.0000000000000E+00
4031 (PID.TID 0000.0001) %MON dynstat_vvel_min = 0.0000000000000E+00
4032 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 0.0000000000000E+00
4033 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 0.0000000000000E+00
4034 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 0.0000000000000E+00
4035 (PID.TID 0000.0001) %MON dynstat_wvel_max = 0.0000000000000E+00
4036 (PID.TID 0000.0001) %MON dynstat_wvel_min = 0.0000000000000E+00
4037 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 0.0000000000000E+00
4038 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 0.0000000000000E+00
4039 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 0.0000000000000E+00
4040 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382676376985E+01
4041 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8552983134796E+00
4042 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030349459887E+00
4043 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406771433446E+00
4044 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4668080606120E-02
4045 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715748807407E+01
4046 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144841495627E+01
4047 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721451128586E+01
4048 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858744433685E-01
4049 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1848960662010E-02
4050 (PID.TID 0000.0001) %MON advcfl_uvel_max = 0.0000000000000E+00
4051 (PID.TID 0000.0001) %MON advcfl_vvel_max = 0.0000000000000E+00
4052 (PID.TID 0000.0001) %MON advcfl_wvel_max = 0.0000000000000E+00
4053 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 0.0000000000000E+00
4054 (PID.TID 0000.0001) %MON pe_b_mean = 0.0000000000000E+00
4055 (PID.TID 0000.0001) %MON ke_max = 0.0000000000000E+00
4056 (PID.TID 0000.0001) %MON ke_mean = 0.0000000000000E+00
4057 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4058 (PID.TID 0000.0001) %MON vort_r_min = 0.0000000000000E+00
4059 (PID.TID 0000.0001) %MON vort_r_max = 0.0000000000000E+00
4060 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748263E-05
4061 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053689203591E-05
4062 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715826612701E-05
4063 (PID.TID 0000.0001) %MON vort_p_sd = 1.2775790705020E-04
4064 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 0.0000000000000E+00
4065 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 0.0000000000000E+00
4066 (PID.TID 0000.0001) // =======================================================
4067 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4068 (PID.TID 0000.0001) // =======================================================
4069 S/R EXTERNAL_FIELDS_LOAD: Reading new data 0.00000000000000D+000 0
4070 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4071 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_taux.bin
4072 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4073 (PID.TID 0000.0001) MDSREADFIELD: opening global file: trenberth_tauy.bin
4074 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiQnet_cs32.bin
4075 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiQnet_cs32.bin
4076 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiEmPR_cs32.bin
4077 (PID.TID 0000.0001) MDSREADFIELD: opening global file: shiEmPR_cs32.bin
4078 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4079 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfT_cs_12m.bin
4080 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4081 (PID.TID 0000.0001) MDSREADFIELD: opening global file: lev_surfS_cs_12m.bin
4082 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 0.0000E+00 1.9749E+01 3.6365E+01 1.0765E-01 4.4783E-02 1.8522E+02 7.7658E-09 12 1 5.0000E-01 5.0000E-01
4083 time,fu0,fu1,fu = 0.0000E+00 1.3167E-01 8.3633E-02 1.0765E-01 5.0000E-01 5.0000E-01
4084 cg2d: Sum(rhs),rhsMax = -1.77635683940025E-15 6.08029293772294E+00
4085 (PID.TID 0000.0001) cg2d_init_res = 5.53819992347834E+00
4086 (PID.TID 0000.0001) cg2d_iters = 49
4087 (PID.TID 0000.0001) cg2d_res = 7.50352692220369E-10
4088 (PID.TID 0000.0001) // =======================================================
4089 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4090 (PID.TID 0000.0001) // =======================================================
4091 (PID.TID 0000.0001) %MON time_tsnumber = 1
4092 (PID.TID 0000.0001) %MON time_secondsf = 3.6000000000000E+03
4093 (PID.TID 0000.0001) %MON dynstat_eta_max = 4.7683941781113E-01
4094 (PID.TID 0000.0001) %MON dynstat_eta_min = -3.3888095667996E-01
4095 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.2022971845469E-17
4096 (PID.TID 0000.0001) %MON dynstat_eta_sd = 8.3517545621320E-02
4097 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0870835960107E-02
4098 (PID.TID 0000.0001) %MON dynstat_uvel_max = 4.9731821708283E-02
4099 (PID.TID 0000.0001) %MON dynstat_uvel_min = -7.3457577612390E-02
4100 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.1017739743220E-04
4101 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 6.0193096142730E-03
4102 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 6.8310022395502E-04
4103 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.0775670639669E-01
4104 (PID.TID 0000.0001) %MON dynstat_vvel_min = -7.2785139924133E-02
4105 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 1.1308847389827E-04
4106 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 5.9003533058356E-03
4107 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 6.6327294176461E-04
4108 (PID.TID 0000.0001) %MON dynstat_wvel_max = 4.4822395842870E-04
4109 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.7549129825889E-04
4110 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.4626493192304E-07
4111 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 1.7381938081303E-05
4112 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 4.4239983654874E-06
4113 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382560510842E+01
4114 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8553132023555E+00
4115 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030168020650E+00
4116 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406498120234E+00
4117 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4632253689430E-02
4118 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715747175020E+01
4119 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144945989646E+01
4120 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721450530127E+01
4121 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858308717995E-01
4122 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1845531019647E-02
4123 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.7671622181108E-04
4124 (PID.TID 0000.0001) %MON advcfl_vvel_max = 1.2692918031156E-03
4125 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.4122723999582E-03
4126 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 6.8651569789982E-03
4127 (PID.TID 0000.0001) %MON pe_b_mean = 9.2922293143189E-06
4128 (PID.TID 0000.0001) %MON ke_max = 2.9319014562740E-03
4129 (PID.TID 0000.0001) %MON ke_mean = 3.2806577214880E-05
4130 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4131 (PID.TID 0000.0001) %MON vort_r_min = -3.9439622248868E-07
4132 (PID.TID 0000.0001) %MON vort_r_max = 3.5006026969639E-07
4133 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4134 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053553641452E-05
4135 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715826612701E-05
4136 (PID.TID 0000.0001) %MON vort_p_sd = 1.2775877849544E-04
4137 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 1.8556806921310E-05
4138 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 6.0494676883413E-07
4139 (PID.TID 0000.0001) // =======================================================
4140 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4141 (PID.TID 0000.0001) // =======================================================
4142 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 3.6000E+03 1.9747E+01 3.6365E+01 1.0758E-01 4.4834E-02 1.8518E+02 7.7658E-09 12 1 5.0139E-01 4.9861E-01
4143 time,fu0,fu1,fu = 3.6000E+03 1.3167E-01 8.3633E-02 1.0758E-01 5.0139E-01 4.9861E-01
4144 cg2d: Sum(rhs),rhsMax = 3.31975712700398E-01 7.38833272025591E+00
4145 (PID.TID 0000.0001) cg2d_init_res = 1.84909623796422E+00
4146 (PID.TID 0000.0001) cg2d_iters = 48
4147 (PID.TID 0000.0001) cg2d_res = 7.79804987547692E-10
4148 (PID.TID 0000.0001) // =======================================================
4149 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4150 (PID.TID 0000.0001) // =======================================================
4151 (PID.TID 0000.0001) %MON time_tsnumber = 2
4152 (PID.TID 0000.0001) %MON time_secondsf = 7.2000000000000E+03
4153 (PID.TID 0000.0001) %MON dynstat_eta_max = 6.9312408773371E-01
4154 (PID.TID 0000.0001) %MON dynstat_eta_min = -6.2280748798193E-01
4155 (PID.TID 0000.0001) %MON dynstat_eta_mean = -3.9817439186787E-04
4156 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.7483413914339E-01
4157 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3974502689298E-02
4158 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.0354993217972E-01
4159 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.3098256643859E-01
4160 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.3966709702271E-04
4161 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.0560273959062E-02
4162 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.2987079746877E-03
4163 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.8687589075291E-01
4164 (PID.TID 0000.0001) %MON dynstat_vvel_min = -1.5476978032639E-01
4165 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -2.4609048883492E-04
4166 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.0922534288344E-02
4167 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.2680568187518E-03
4168 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.6463124566092E-04
4169 (PID.TID 0000.0001) %MON dynstat_wvel_min = -5.2896672014481E-04
4170 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.7365659109554E-07
4171 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.1463198721113E-05
4172 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 7.8500626838366E-06
4173 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9372820062070E+01
4174 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8554542600541E+00
4175 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6029377012963E+00
4176 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4403106783199E+00
4177 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4552587267715E-02
4178 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746921238E+01
4179 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145179850444E+01
4180 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721453491516E+01
4181 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858291468126E-01
4182 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1841454507417E-02
4183 (PID.TID 0000.0001) %MON advcfl_uvel_max = 1.5531677967066E-03
4184 (PID.TID 0000.0001) %MON advcfl_vvel_max = 2.2012554416741E-03
4185 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.0418729800230E-02
4186 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.3200388702897E-02
4187 (PID.TID 0000.0001) %MON pe_b_mean = 4.0726029851771E-05
4188 (PID.TID 0000.0001) %MON ke_max = 1.2477387540406E-02
4189 (PID.TID 0000.0001) %MON ke_mean = 1.0673801616867E-04
4190 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
4191 (PID.TID 0000.0001) %MON vort_r_min = -6.8172230559858E-07
4192 (PID.TID 0000.0001) %MON vort_r_max = 6.0708819807365E-07
4193 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4194 (PID.TID 0000.0001) %MON vort_a_sd = 7.5053027841186E-05
4195 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715799006741E-05
4196 (PID.TID 0000.0001) %MON vort_p_sd = 1.2775737064717E-04
4197 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.1463384025811E-05
4198 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.1034340703599E-06
4199 (PID.TID 0000.0001) // =======================================================
4200 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4201 (PID.TID 0000.0001) // =======================================================
4202 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 7.2000E+03 1.9745E+01 3.6365E+01 1.0752E-01 4.4885E-02 1.8514E+02 7.7658E-09 12 1 5.0278E-01 4.9722E-01
4203 time,fu0,fu1,fu = 7.2000E+03 1.3167E-01 8.3633E-02 1.0752E-01 5.0278E-01 4.9722E-01
4204 cg2d: Sum(rhs),rhsMax = 6.74650450574262E-01 7.20272137332657E+00
4205 (PID.TID 0000.0001) cg2d_init_res = 1.39284744946188E+00
4206 (PID.TID 0000.0001) cg2d_iters = 48
4207 (PID.TID 0000.0001) cg2d_res = 8.52195755506476E-10
4208 (PID.TID 0000.0001) // =======================================================
4209 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4210 (PID.TID 0000.0001) // =======================================================
4211 (PID.TID 0000.0001) %MON time_tsnumber = 3
4212 (PID.TID 0000.0001) %MON time_secondsf = 1.0800000000000E+04
4213 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1280798039227E-01
4214 (PID.TID 0000.0001) %MON dynstat_eta_min = -8.1777833327649E-01
4215 (PID.TID 0000.0001) %MON dynstat_eta_mean = -7.8882451123878E-04
4216 (PID.TID 0000.0001) %MON dynstat_eta_sd = 2.5207800246176E-01
4217 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3935617400839E-02
4218 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.5196562115928E-01
4219 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.8749187660394E-01
4220 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.1953097605956E-03
4221 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.3600339329982E-02
4222 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 1.8365834584100E-03
4223 (PID.TID 0000.0001) %MON dynstat_vvel_max = 2.6195070136634E-01
4224 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.3099576483406E-01
4225 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -8.0364677289101E-04
4226 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.4567923307672E-02
4227 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 1.7958462989664E-03
4228 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.2450556727487E-03
4229 (PID.TID 0000.0001) %MON dynstat_wvel_min = -7.6472935793991E-04
4230 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.1804459674267E-07
4231 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.1253360834193E-05
4232 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.0482996666170E-05
4233 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9363992750254E+01
4234 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556088845699E+00
4235 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028846202055E+00
4236 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4400228998540E+00
4237 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4451920968327E-02
4238 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746889513E+01
4239 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145480854219E+01
4240 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721456826079E+01
4241 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858343963113E-01
4242 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1835872800995E-02
4243 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.2232450684331E-03
4244 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.0855794426442E-03
4245 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.4963843873605E-02
4246 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.8910667622512E-02
4247 (PID.TID 0000.0001) %MON pe_b_mean = 8.4659671456662E-05
4248 (PID.TID 0000.0001) %MON ke_max = 2.6059268886793E-02
4249 (PID.TID 0000.0001) %MON ke_mean = 1.8438376225815E-04
4250 (PID.TID 0000.0001) %MON ke_vol = 1.3398023004724E+18
4251 (PID.TID 0000.0001) %MON vort_r_min = -9.5099352393984E-07
4252 (PID.TID 0000.0001) %MON vort_r_max = 8.5097750510195E-07
4253 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4254 (PID.TID 0000.0001) %MON vort_a_sd = 7.5052433933467E-05
4255 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715765444971E-05
4256 (PID.TID 0000.0001) %MON vort_p_sd = 1.2775519068705E-04
4257 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.2748270206416E-05
4258 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.3007235706534E-06
4259 (PID.TID 0000.0001) // =======================================================
4260 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4261 (PID.TID 0000.0001) // =======================================================
4262 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 1.0800E+04 1.9743E+01 3.6365E+01 1.0745E-01 4.4936E-02 1.8510E+02 7.7658E-09 12 1 5.0417E-01 4.9583E-01
4263 time,fu0,fu1,fu = 1.0800E+04 1.3167E-01 8.3633E-02 1.0745E-01 5.0417E-01 4.9583E-01
4264 cg2d: Sum(rhs),rhsMax = 1.01836418856482E+00 6.97858289641831E+00
4265 (PID.TID 0000.0001) cg2d_init_res = 1.12757762610061E+00
4266 (PID.TID 0000.0001) cg2d_iters = 48
4267 (PID.TID 0000.0001) cg2d_res = 7.07735394565551E-10
4268 (PID.TID 0000.0001) // =======================================================
4269 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4270 (PID.TID 0000.0001) // =======================================================
4271 (PID.TID 0000.0001) %MON time_tsnumber = 4
4272 (PID.TID 0000.0001) %MON time_secondsf = 1.4400000000000E+04
4273 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0425648186010E+00
4274 (PID.TID 0000.0001) %MON dynstat_eta_min = -9.3617091478141E-01
4275 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.1504082524019E-03
4276 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.0772202732451E-01
4277 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3418377955053E-02
4278 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.9597717017322E-01
4279 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.4123376226584E-01
4280 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.8715442458759E-03
4281 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.5852238679990E-02
4282 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 2.3098857622445E-03
4283 (PID.TID 0000.0001) %MON dynstat_vvel_max = 3.3338285731990E-01
4284 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.0110335863259E-01
4285 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.3855667069566E-03
4286 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.7091479864116E-02
4287 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 2.2565486556295E-03
4288 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.5973924805076E-03
4289 (PID.TID 0000.0001) %MON dynstat_wvel_min = -9.8502588510277E-04
4290 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.9986285593509E-07
4291 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.7751159785635E-05
4292 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.2511302751261E-05
4293 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9355467854125E+01
4294 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556819110186E+00
4295 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028435651794E+00
4296 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4397526421656E+00
4297 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4336322436079E-02
4298 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746790433E+01
4299 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145842713077E+01
4300 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721460335209E+01
4301 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858546841948E-01
4302 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1829591291849E-02
4303 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.8605067164057E-03
4304 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.9269957503860E-03
4305 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.9164311616842E-02
4306 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.4170978357769E-02
4307 (PID.TID 0000.0001) %MON pe_b_mean = 1.2615783400087E-04
4308 (PID.TID 0000.0001) %MON ke_max = 4.1803490517878E-02
4309 (PID.TID 0000.0001) %MON ke_mean = 2.5346324997994E-04
4310 (PID.TID 0000.0001) %MON ke_vol = 1.3398021583200E+18
4311 (PID.TID 0000.0001) %MON vort_r_min = -1.2091443179877E-06
4312 (PID.TID 0000.0001) %MON vort_r_max = 1.0830332222287E-06
4313 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4314 (PID.TID 0000.0001) %MON vort_a_sd = 7.5051967304779E-05
4315 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715737891420E-05
4316 (PID.TID 0000.0001) %MON vort_p_sd = 1.2775309176667E-04
4317 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.8203917294472E-05
4318 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.2408537314758E-06
4319 (PID.TID 0000.0001) // =======================================================
4320 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4321 (PID.TID 0000.0001) // =======================================================
4322 time,SST,SSS,fu,fv,Q,E-P,i0,i1,a,b = 1.4400E+04 1.9741E+01 3.6365E+01 1.0738E-01 4.4986E-02 1.8506E+02 7.7658E-09 12 1 5.0556E-01 4.9444E-01
4323 time,fu0,fu1,fu = 1.4400E+04 1.3167E-01 8.3633E-02 1.0738E-01 5.0556E-01 4.9444E-01
4324 cg2d: Sum(rhs),rhsMax = 1.34788221943649E+00 6.87970735590067E+00
4325 (PID.TID 0000.0001) cg2d_init_res = 9.36799134593734E-01
4326 (PID.TID 0000.0001) cg2d_iters = 47
4327 (PID.TID 0000.0001) cg2d_res = 9.74703401834247E-10
4328 (PID.TID 0000.0001) // =======================================================
4329 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
4330 (PID.TID 0000.0001) // =======================================================
4331 (PID.TID 0000.0001) %MON time_tsnumber = 5
4332 (PID.TID 0000.0001) %MON time_secondsf = 1.8000000000000E+04
4333 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0997660383974E+00
4334 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.0575392684905E+00
4335 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.4971767917109E-03
4336 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.4191004488407E-01
4337 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.3272943370624E-02
4338 (PID.TID 0000.0001) %MON dynstat_uvel_max = 2.3663198056782E-01
4339 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.9102483428562E-01
4340 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -2.3571341304878E-03
4341 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.7630849771520E-02
4342 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 2.7348822041647E-03
4343 (PID.TID 0000.0001) %MON dynstat_vvel_max = 4.0039435851596E-01
4344 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.6622835082015E-01
4345 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.8866534856203E-03
4346 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.8821386534606E-02
4347 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 2.6625052963495E-03
4348 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.9277177501572E-03
4349 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.1904252453738E-03
4350 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -4.9474985223547E-08
4351 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 5.1843277033051E-05
4352 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.4066246919296E-05
4353 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9347264482826E+01
4354 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556376504065E+00
4355 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028084360918E+00
4356 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4394967563530E+00
4357 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 7.4208430800757E-02
4358 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746684087E+01
4359 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8146256950908E+01
4360 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721464041464E+01
4361 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858786689390E-01
4362 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 1.1822773840864E-02
4363 (PID.TID 0000.0001) %MON advcfl_uvel_max = 3.4509203243180E-03
4364 (PID.TID 0000.0001) %MON advcfl_vvel_max = 4.7163401172183E-03
4365 (PID.TID 0000.0001) %MON advcfl_wvel_max = 2.3106777802060E-02
4366 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.9108647859894E-02
4367 (PID.TID 0000.0001) %MON pe_b_mean = 1.5574825166582E-04
4368 (PID.TID 0000.0001) %MON ke_max = 5.9069036140094E-02
4369 (PID.TID 0000.0001) %MON ke_mean = 3.1134991528107E-04
4370 (PID.TID 0000.0001) %MON ke_vol = 1.3398020267444E+18
4371 (PID.TID 0000.0001) %MON vort_r_min = -1.4541816236870E-06
4372 (PID.TID 0000.0001) %MON vort_r_max = 1.3007279251003E-06
4373 (PID.TID 0000.0001) %MON vort_a_mean = -2.0493733748264E-05
4374 (PID.TID 0000.0001) %MON vort_a_sd = 7.5051705922008E-05
4375 (PID.TID 0000.0001) %MON vort_p_mean = -2.4715720391824E-05
4376 (PID.TID 0000.0001) %MON vort_p_sd = 1.2775143352550E-04
4377 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.1510835846868E-05
4378 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 9.6120814758768E-07
4379 (PID.TID 0000.0001) // =======================================================
4380 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
4381 (PID.TID 0000.0001) // =======================================================
4382 (PID.TID 0000.0001) %CHECKPOINT 5 ckptA
4383 (PID.TID 0000.0001) Seconds in section "ALL [THE_MODEL_MAIN]":
4384 (PID.TID 0000.0001) User time: 48.4199986271560
4385 (PID.TID 0000.0001) System time: 0.619999976828694
4386 (PID.TID 0000.0001) Wall clock time: 60.6594250202179
4387 (PID.TID 0000.0001) No. starts: 1
4388 (PID.TID 0000.0001) No. stops: 1
4389 (PID.TID 0000.0001) Seconds in section "INITIALISE_FIXED [THE_MODEL_MAIN]":
4390 (PID.TID 0000.0001) User time: 4.15000007674098
4391 (PID.TID 0000.0001) System time: 0.289999993517995
4392 (PID.TID 0000.0001) Wall clock time: 10.7181439399719
4393 (PID.TID 0000.0001) No. starts: 1
4394 (PID.TID 0000.0001) No. stops: 1
4395 (PID.TID 0000.0001) Seconds in section "THE_MAIN_LOOP [THE_MODEL_MAIN]":
4396 (PID.TID 0000.0001) User time: 44.0700016021729
4397 (PID.TID 0000.0001) System time: 0.310000002384186
4398 (PID.TID 0000.0001) Wall clock time: 49.0722060203552
4399 (PID.TID 0000.0001) No. starts: 1
4400 (PID.TID 0000.0001) No. stops: 1
4401 (PID.TID 0000.0001) Seconds in section "INITIALISE_VARIA [THE_MAIN_LOOP]":
4402 (PID.TID 0000.0001) User time: 0.529999732971191
4403 (PID.TID 0000.0001) System time: 8.00000131130219D-002
4404 (PID.TID 0000.0001) Wall clock time: 1.51888704299927
4405 (PID.TID 0000.0001) No. starts: 1
4406 (PID.TID 0000.0001) No. stops: 1
4407 (PID.TID 0000.0001) Seconds in section "MONITOR [THE_MAIN_LOOP]":
4408 (PID.TID 0000.0001) User time: 0.390000343322754
4409 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4410 (PID.TID 0000.0001) Wall clock time: 0.392561912536621
4411 (PID.TID 0000.0001) No. starts: 1
4412 (PID.TID 0000.0001) No. stops: 1
4413 (PID.TID 0000.0001) Seconds in section "DO_THE_MODEL_IO [THE_MAIN_LOOP]":
4414 (PID.TID 0000.0001) User time: 0.809999942779541
4415 (PID.TID 0000.0001) System time: 6.99999928474426D-002
4416 (PID.TID 0000.0001) Wall clock time: 3.22630715370178
4417 (PID.TID 0000.0001) No. starts: 1
4418 (PID.TID 0000.0001) No. stops: 1
4419 (PID.TID 0000.0001) Seconds in section "MAIN LOOP [THE_MAIN_LOOP]":
4420 (PID.TID 0000.0001) User time: 42.3400015830994
4421 (PID.TID 0000.0001) System time: 0.159999996423721
4422 (PID.TID 0000.0001) Wall clock time: 43.9343249797821
4423 (PID.TID 0000.0001) No. starts: 1
4424 (PID.TID 0000.0001) No. stops: 1
4425 (PID.TID 0000.0001) Seconds in section "FORWARD_STEP [THE_MAIN_LOOP]":
4426 (PID.TID 0000.0001) User time: 42.3400015830994
4427 (PID.TID 0000.0001) System time: 0.159999996423721
4428 (PID.TID 0000.0001) Wall clock time: 43.9341948032379
4429 (PID.TID 0000.0001) No. starts: 5
4430 (PID.TID 0000.0001) No. stops: 5
4431 (PID.TID 0000.0001) Seconds in section "EXTERNAL_FIELDS_LOAD[FORWARD_STEP]":
4432 (PID.TID 0000.0001) User time: 3.99999618530273D-002
4433 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4434 (PID.TID 0000.0001) Wall clock time: 8.04250240325928D-002
4435 (PID.TID 0000.0001) No. starts: 5
4436 (PID.TID 0000.0001) No. stops: 5
4437 (PID.TID 0000.0001) Seconds in section "CPL_EXPORT-IMPORT [FORWARD_STEP]":
4438 (PID.TID 0000.0001) User time: 26.7600007057190
4439 (PID.TID 0000.0001) System time: 9.99999046325684D-003
4440 (PID.TID 0000.0001) Wall clock time: 26.7696783542633
4441 (PID.TID 0000.0001) No. starts: 5
4442 (PID.TID 0000.0001) No. stops: 5
4443 (PID.TID 0000.0001) Seconds in section "DO_ATMOSPHERIC_PHYS [FORWARD_STEP]":
4444 (PID.TID 0000.0001) User time: 0.00000000000000D+000
4445 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4446 (PID.TID 0000.0001) Wall clock time: 1.07049942016602D-004
4447 (PID.TID 0000.0001) No. starts: 5
4448 (PID.TID 0000.0001) No. stops: 5
4449 (PID.TID 0000.0001) Seconds in section "DO_OCEANIC_PHYS [FORWARD_STEP]":
4450 (PID.TID 0000.0001) User time: 1.62999963760376
4451 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4452 (PID.TID 0000.0001) Wall clock time: 1.64012074470520
4453 (PID.TID 0000.0001) No. starts: 5
4454 (PID.TID 0000.0001) No. stops: 5
4455 (PID.TID 0000.0001) Seconds in section "DYNAMICS [FORWARD_STEP]":
4456 (PID.TID 0000.0001) User time: 3.65999937057495
4457 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4458 (PID.TID 0000.0001) Wall clock time: 3.68638539314270
4459 (PID.TID 0000.0001) No. starts: 5
4460 (PID.TID 0000.0001) No. stops: 5
4461 (PID.TID 0000.0001) Seconds in section "UPDATE_R_STAR [FORWARD_STEP]":
4462 (PID.TID 0000.0001) User time: 0.200001716613770
4463 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4464 (PID.TID 0000.0001) Wall clock time: 0.190846920013428
4465 (PID.TID 0000.0001) No. starts: 5
4466 (PID.TID 0000.0001) No. stops: 5
4467 (PID.TID 0000.0001) Seconds in section "UPDATE_CG2D [FORWARD_STEP]":
4468 (PID.TID 0000.0001) User time: 0.109998226165771
4469 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4470 (PID.TID 0000.0001) Wall clock time: 0.115832805633545
4471 (PID.TID 0000.0001) No. starts: 5
4472 (PID.TID 0000.0001) No. stops: 5
4473 (PID.TID 0000.0001) Seconds in section "SOLVE_FOR_PRESSURE [FORWARD_STEP]":
4474 (PID.TID 0000.0001) User time: 1.57000398635864
4475 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4476 (PID.TID 0000.0001) Wall clock time: 1.57479810714722
4477 (PID.TID 0000.0001) No. starts: 5
4478 (PID.TID 0000.0001) No. stops: 5
4479 (PID.TID 0000.0001) Seconds in section "UV_CORRECTION_STEP [FORWARD_STEP]":
4480 (PID.TID 0000.0001) User time: 0.299995899200439
4481 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4482 (PID.TID 0000.0001) Wall clock time: 0.294743061065674
4483 (PID.TID 0000.0001) No. starts: 5
4484 (PID.TID 0000.0001) No. stops: 5
4485 (PID.TID 0000.0001) Seconds in section "UPDATE_ETAH [FORWARD_STEP]":
4486 (PID.TID 0000.0001) User time: 0.00000000000000D+000
4487 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4488 (PID.TID 0000.0001) Wall clock time: 2.60567665100098D-003
4489 (PID.TID 0000.0001) No. starts: 5
4490 (PID.TID 0000.0001) No. stops: 5
4491 (PID.TID 0000.0001) Seconds in section "CALC_R_STAR [FORWARD_STEP]":
4492 (PID.TID 0000.0001) User time: 5.00044822692871D-002
4493 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4494 (PID.TID 0000.0001) Wall clock time: 3.89220714569092D-002
4495 (PID.TID 0000.0001) No. starts: 5
4496 (PID.TID 0000.0001) No. stops: 5
4497 (PID.TID 0000.0001) Seconds in section "BLOCKING_EXCHANGES [FORWARD_STEP]":
4498 (PID.TID 0000.0001) User time: 0.230000495910645
4499 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4500 (PID.TID 0000.0001) Wall clock time: 0.220146894454956
4501 (PID.TID 0000.0001) No. starts: 10
4502 (PID.TID 0000.0001) No. stops: 10
4503 (PID.TID 0000.0001) Seconds in section "THERMODYNAMICS [FORWARD_STEP]":
4504 (PID.TID 0000.0001) User time: 2.72999668121338
4505 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4506 (PID.TID 0000.0001) Wall clock time: 2.74668145179749
4507 (PID.TID 0000.0001) No. starts: 5
4508 (PID.TID 0000.0001) No. stops: 5
4509 (PID.TID 0000.0001) Seconds in section "TS_CORRECTION_STEP [FORWARD_STEP]":
4510 (PID.TID 0000.0001) User time: 3.99990081787109D-002
4511 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4512 (PID.TID 0000.0001) Wall clock time: 4.56790924072266D-002
4513 (PID.TID 0000.0001) No. starts: 5
4514 (PID.TID 0000.0001) No. stops: 5
4515 (PID.TID 0000.0001) Seconds in section "DO_STATEVARS_DIAGS [FORWARD_STEP]":
4516 (PID.TID 0000.0001) User time: 0.699998855590820
4517 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4518 (PID.TID 0000.0001) Wall clock time: 0.703940629959106
4519 (PID.TID 0000.0001) No. starts: 5
4520 (PID.TID 0000.0001) No. stops: 5
4521 (PID.TID 0000.0001) Seconds in section "MONITOR [FORWARD_STEP]":
4522 (PID.TID 0000.0001) User time: 1.90000057220459
4523 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4524 (PID.TID 0000.0001) Wall clock time: 1.89694190025330
4525 (PID.TID 0000.0001) No. starts: 5
4526 (PID.TID 0000.0001) No. stops: 5
4527 (PID.TID 0000.0001) Seconds in section "DO_THE_MODEL_IO [FORWARD_STEP]":
4528 (PID.TID 0000.0001) User time: 2.42000198364258
4529 (PID.TID 0000.0001) System time: 0.150000005960464
4530 (PID.TID 0000.0001) Wall clock time: 3.91982769966125
4531 (PID.TID 0000.0001) No. starts: 5
4532 (PID.TID 0000.0001) No. stops: 5
4533 (PID.TID 0000.0001) Seconds in section "WRITE_CHECKPOINT [FORWARD_STEP]":
4534 (PID.TID 0000.0001) User time: 0.00000000000000D+000
4535 (PID.TID 0000.0001) System time: 0.00000000000000D+000
4536 (PID.TID 0000.0001) Wall clock time: 1.26838684082031D-004
4537 (PID.TID 0000.0001) No. starts: 5
4538 (PID.TID 0000.0001) No. stops: 5
4539 (PID.TID 0000.0001) Seconds in section "WRITE_CHECKPOINT [THE_MODEL_MAIN]":
4540 (PID.TID 0000.0001) User time: 0.199996948242188
4541 (PID.TID 0000.0001) System time: 1.99999809265137D-002
4542 (PID.TID 0000.0001) Wall clock time: 0.868964910507202
4543 (PID.TID 0000.0001) No. starts: 1
4544 (PID.TID 0000.0001) No. stops: 1
4545 (PID.TID 0000.0001) // ======================================================
4546 (PID.TID 0000.0001) // Tile <-> Tile communication statistics
4547 (PID.TID 0000.0001) // ======================================================
4548 (PID.TID 0000.0001) // o Tile number: 000001
4549 (PID.TID 0000.0001) // No. X exchanges = 0
4550 (PID.TID 0000.0001) // Max. X spins = 0
4551 (PID.TID 0000.0001) // Min. X spins = 1000000000
4552 (PID.TID 0000.0001) // Total. X spins = 0
4553 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
4554 (PID.TID 0000.0001) // No. Y exchanges = 0
4555 (PID.TID 0000.0001) // Max. Y spins = 0
4556 (PID.TID 0000.0001) // Min. Y spins = 1000000000
4557 (PID.TID 0000.0001) // Total. Y spins = 0
4558 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
4559 (PID.TID 0000.0001) // o Tile number: 000002
4560 (PID.TID 0000.0001) // No. X exchanges = 0
4561 (PID.TID 0000.0001) // Max. X spins = 0
4562 (PID.TID 0000.0001) // Min. X spins = 1000000000
4563 (PID.TID 0000.0001) // Total. X spins = 0
4564 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
4565 (PID.TID 0000.0001) // No. Y exchanges = 0
4566 (PID.TID 0000.0001) // Max. Y spins = 0
4567 (PID.TID 0000.0001) // Min. Y spins = 1000000000
4568 (PID.TID 0000.0001) // Total. Y spins = 0
4569 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
4570 (PID.TID 0000.0001) // o Tile number: 000003
4571 (PID.TID 0000.0001) // No. X exchanges = 0
4572 (PID.TID 0000.0001) // Max. X spins = 0
4573 (PID.TID 0000.0001) // Min. X spins = 1000000000
4574 (PID.TID 0000.0001) // Total. X spins = 0
4575 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
4576 (PID.TID 0000.0001) // No. Y exchanges = 0
4577 (PID.TID 0000.0001) // Max. Y spins = 0
4578 (PID.TID 0000.0001) // Min. Y spins = 1000000000
4579 (PID.TID 0000.0001) // Total. Y spins = 0
4580 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
4581 (PID.TID 0000.0001) // o Tile number: 000004
4582 (PID.TID 0000.0001) // No. X exchanges = 0
4583 (PID.TID 0000.0001) // Max. X spins = 0
4584 (PID.TID 0000.0001) // Min. X spins = 1000000000
4585 (PID.TID 0000.0001) // Total. X spins = 0
4586 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
4587 (PID.TID 0000.0001) // No. Y exchanges = 0
4588 (PID.TID 0000.0001) // Max. Y spins = 0
4589 (PID.TID 0000.0001) // Min. Y spins = 1000000000
4590 (PID.TID 0000.0001) // Total. Y spins = 0
4591 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
4592 (PID.TID 0000.0001) // o Tile number: 000005
4593 (PID.TID 0000.0001) // No. X exchanges = 0
4594 (PID.TID 0000.0001) // Max. X spins = 0
4595 (PID.TID 0000.0001) // Min. X spins = 1000000000
4596 (PID.TID 0000.0001) // Total. X spins = 0
4597 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
4598 (PID.TID 0000.0001) // No. Y exchanges = 0
4599 (PID.TID 0000.0001) // Max. Y spins = 0
4600 (PID.TID 0000.0001) // Min. Y spins = 1000000000
4601 (PID.TID 0000.0001) // Total. Y spins = 0
4602 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
4603 (PID.TID 0000.0001) // o Tile number: 000006
4604 (PID.TID 0000.0001) // No. X exchanges = 0
4605 (PID.TID 0000.0001) // Max. X spins = 0
4606 (PID.TID 0000.0001) // Min. X spins = 1000000000
4607 (PID.TID 0000.0001) // Total. X spins = 0
4608 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
4609 (PID.TID 0000.0001) // No. Y exchanges = 0
4610 (PID.TID 0000.0001) // Max. Y spins = 0
4611 (PID.TID 0000.0001) // Min. Y spins = 1000000000
4612 (PID.TID 0000.0001) // Total. Y spins = 0
4613 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
4614 (PID.TID 0000.0001) // o Thread number: 000001
4615 (PID.TID 0000.0001) // No. barriers = 7588
4616 (PID.TID 0000.0001) // Max. barrier spins = 1
4617 (PID.TID 0000.0001) // Min. barrier spins = 1
4618 (PID.TID 0000.0001) // Total barrier spins = 7588
4619 (PID.TID 0000.0001) // Avg. barrier spins = 1.00E+00

  ViewVC Help
Powered by ViewVC 1.1.22