/[MITgcm]/MITgcm/verification/cpl_aim+ocn/results/ocnSTDOUT.0000
ViewVC logotype

Contents of /MITgcm/verification/cpl_aim+ocn/results/ocnSTDOUT.0000

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph


Revision 1.15 - (show annotations) (download)
Mon May 12 02:15:53 2014 UTC (7 years, 6 months ago) by jmc
Branch: MAIN
CVS Tags: checkpoint64y, checkpoint64x, checkpoint64z, checkpoint65, checkpoint65z, checkpoint65x, checkpoint65y, checkpoint65r, checkpoint65s, checkpoint65p, checkpoint65q, checkpoint65v, checkpoint65w, checkpoint65t, checkpoint65u, checkpoint65j, checkpoint65k, checkpoint65h, checkpoint65i, checkpoint65n, checkpoint65o, checkpoint65l, checkpoint65m, checkpoint65b, checkpoint65c, checkpoint65a, checkpoint65f, checkpoint65g, checkpoint65d, checkpoint65e
Changes since 1.14: +668 -428 lines
update output after changes in atmospheric p*:
- Switch to more accurate p* coordinate slope term (calc_grad_phi_hyd.F)
- use constant reference Pot.Temp (thetaConst) instead of tRef
- Acount for true p* correction in theta <-> T conversion in pkg/aim_v23

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint64w
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: baudelaire
11 (PID.TID 0000.0001) // Build date: Sun May 11 21:43:30 EDT 2014
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx :: No. threads per process in X
19 (PID.TID 0000.0001) ># nTy :: No. threads per process in Y
20 (PID.TID 0000.0001) ># debugMode :: print debug msg (sequence of S/R calls)
21 (PID.TID 0000.0001) ># useCubedSphereExchange :: use Cubed-Sphere type topology for EXCH
22 (PID.TID 0000.0001) > &EEPARMS
23 (PID.TID 0000.0001) > useCoupler=.TRUE.,
24 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
25 (PID.TID 0000.0001) >#debugMode=.TRUE.,
26 (PID.TID 0000.0001) ># Activate one line below to support 2, 3 or 6 way multi-threading
27 (PID.TID 0000.0001) > nTx=1,
28 (PID.TID 0000.0001) >#nTx=2,
29 (PID.TID 0000.0001) >#nTx=3,
30 (PID.TID 0000.0001) >#nTx=6,
31 (PID.TID 0000.0001) > /
32 (PID.TID 0000.0001) ># Note: Some systems use & as the namelist terminator (as shown here).
33 (PID.TID 0000.0001) ># Other systems use a / character.
34 (PID.TID 0000.0001)
35 (PID.TID 0000.0001) // =======================================================
36 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
37 (PID.TID 0000.0001) // ( and "eedata" )
38 (PID.TID 0000.0001) // =======================================================
39 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
40 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
41 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
42 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
43 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
44 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
45 (PID.TID 0000.0001) OLx = 2 ; /* Tile overlap distance in X */
46 (PID.TID 0000.0001) OLy = 2 ; /* Tile overlap distance in Y */
47 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
48 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
49 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
50 (PID.TID 0000.0001) Nx = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
51 (PID.TID 0000.0001) Ny = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
52 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
53 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
54 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
55 (PID.TID 0000.0001) usingMPI = T ; /* Flag used to control whether MPI is in use */
56 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
57 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
58 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
59 (PID.TID 0000.0001) useCoupler= T ;/* Flag used to control communications with */
60 (PID.TID 0000.0001) /* other model components, through a coupler */
61 (PID.TID 0000.0001) debugMode = F ; /* print debug msg. (sequence of S/R calls) */
62 (PID.TID 0000.0001) printMapIncludesZeros= F ; /* print zeros in Std.Output maps */
63 (PID.TID 0000.0001) maxLengthPrt1D= 65 /* maxLength of 1D array printed to StdOut */
64 (PID.TID 0000.0001)
65 (PID.TID 0000.0001) ======= Starting MPI parallel Run =========
66 (PID.TID 0000.0001) My Processor Name (len: 10 ) = baudelaire
67 (PID.TID 0000.0001) Located at ( 0, 0) on processor grid (0: 0,0: 0)
68 (PID.TID 0000.0001) Origin at ( 1, 1) on global grid (1: 192,1: 32)
69 (PID.TID 0000.0001) North neighbor = processor 0000
70 (PID.TID 0000.0001) South neighbor = processor 0000
71 (PID.TID 0000.0001) East neighbor = processor 0000
72 (PID.TID 0000.0001) West neighbor = processor 0000
73 (PID.TID 0000.0001) // ======================================================
74 (PID.TID 0000.0001) // Mapping of tiles to threads
75 (PID.TID 0000.0001) // ======================================================
76 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
77 (PID.TID 0000.0001)
78 (PID.TID 0000.0001) W2_READPARMS: file data.exch2 not found
79 (PID.TID 0000.0001) => use W2_EXCH2 default: regular 6-facets Cube
80 (PID.TID 0000.0001) W2_useE2ioLayOut= T ;/* T: use Exch2 glob IO map; F: use model default */
81 (PID.TID 0000.0001) W2_mapIO = -1 ; /* select option for Exch2 global-IO map */
82 (PID.TID 0000.0001) W2_printMsg = -1 ; /* select option for printing information */
83 (PID.TID 0000.0001) ===== Start setting W2 TOPOLOGY:
84 (PID.TID 0000.0001) write to log-file: w2_tile_topology.0000.log
85 (PID.TID 0000.0001) ===== setting W2 TOPOLOGY: Done
86 (PID.TID 0000.0001)
87 (PID.TID 0000.0001) INI_PARMS: opening model parameter file "data"
88 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data
89 (PID.TID 0000.0001) // =======================================================
90 (PID.TID 0000.0001) // Parameter file "data"
91 (PID.TID 0000.0001) // =======================================================
92 (PID.TID 0000.0001) ># ====================
93 (PID.TID 0000.0001) ># | Model parameters |
94 (PID.TID 0000.0001) ># ====================
95 (PID.TID 0000.0001) >#
96 (PID.TID 0000.0001) ># Continuous equation parameters
97 (PID.TID 0000.0001) > &PARM01
98 (PID.TID 0000.0001) > tRef=15*20.,
99 (PID.TID 0000.0001) > sRef=15*35.,
100 (PID.TID 0000.0001) > viscAh =3.E5,
101 (PID.TID 0000.0001) > viscAr =1.E-3,
102 (PID.TID 0000.0001) > diffKhT=0.,
103 (PID.TID 0000.0001) > diffK4T=0.,
104 (PID.TID 0000.0001) > diffKrT=3.E-5,
105 (PID.TID 0000.0001) > diffKhS=0.,
106 (PID.TID 0000.0001) > diffK4S=0.,
107 (PID.TID 0000.0001) > diffKrS=3.E-5,
108 (PID.TID 0000.0001) > gravity=9.81,
109 (PID.TID 0000.0001) > rhoConst=1030.,
110 (PID.TID 0000.0001) > rhoConstFresh=1000.,
111 (PID.TID 0000.0001) > eosType='JMD95Z',
112 (PID.TID 0000.0001) >#allowFreezing=.TRUE.,
113 (PID.TID 0000.0001) > ivdc_kappa=10.,
114 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
115 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
116 (PID.TID 0000.0001) > exactConserv=.TRUE.,
117 (PID.TID 0000.0001) > select_rStar=2,
118 (PID.TID 0000.0001) > nonlinFreeSurf=4,
119 (PID.TID 0000.0001) > hFacInf=0.2,
120 (PID.TID 0000.0001) > hFacSup=2.0,
121 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
122 (PID.TID 0000.0001) > temp_EvPrRn=0.,
123 (PID.TID 0000.0001) > hFacMin=.1,
124 (PID.TID 0000.0001) > hFacMinDr=20.,
125 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
126 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
127 (PID.TID 0000.0001) > readBinaryPrec=64,
128 (PID.TID 0000.0001) > writeBinaryPrec=64,
129 (PID.TID 0000.0001) >#debugLevel=0,
130 (PID.TID 0000.0001) > /
131 (PID.TID 0000.0001) >
132 (PID.TID 0000.0001) ># Elliptic solver parameters
133 (PID.TID 0000.0001) > &PARM02
134 (PID.TID 0000.0001) > cg2dMaxIters=200,
135 (PID.TID 0000.0001) > cg2dTargetResidual=1.E-9,
136 (PID.TID 0000.0001) >#cg2dTargetResWunit=1.E-14,
137 (PID.TID 0000.0001) > /
138 (PID.TID 0000.0001) >
139 (PID.TID 0000.0001) ># Time stepping parameters
140 (PID.TID 0000.0001) > &PARM03
141 (PID.TID 0000.0001) > nIter0=0,
142 (PID.TID 0000.0001) > nTimeSteps=5,
143 (PID.TID 0000.0001) > deltaTmom =3600.,
144 (PID.TID 0000.0001) > deltaTtracer=3600.,
145 (PID.TID 0000.0001) > deltaTClock =3600.,
146 (PID.TID 0000.0001) > abEps = 0.1,
147 (PID.TID 0000.0001) > pChkptFreq =2592000.,
148 (PID.TID 0000.0001) >#taveFreq =2592000.,
149 (PID.TID 0000.0001) > dumpFreq =864000.,
150 (PID.TID 0000.0001) > monitorFreq =86400.,
151 (PID.TID 0000.0001) > monitorFreq =1.,
152 (PID.TID 0000.0001) > forcing_In_AB=.FALSE.,
153 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
154 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
155 (PID.TID 0000.0001) > externForcingCycle=31104000.,
156 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
157 (PID.TID 0000.0001) >#tauThetaClimRelax= 5184000.,
158 (PID.TID 0000.0001) ># restoring timescale for salinity: 2yrs, 20 yrs
159 (PID.TID 0000.0001) >#tauSaltClimRelax = 62208000.,
160 (PID.TID 0000.0001) > tauSaltClimRelax = 622080000.,
161 (PID.TID 0000.0001) > /
162 (PID.TID 0000.0001) >
163 (PID.TID 0000.0001) ># Gridding parameters
164 (PID.TID 0000.0001) > &PARM04
165 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
166 (PID.TID 0000.0001) > horizGridFile='grid_cs32',
167 (PID.TID 0000.0001) > radius_fromHorizGrid=6370.E3,
168 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
169 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
170 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
171 (PID.TID 0000.0001) > /
172 (PID.TID 0000.0001) >
173 (PID.TID 0000.0001) ># Input datasets
174 (PID.TID 0000.0001) > &PARM05
175 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
176 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
177 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
178 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
179 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
180 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
181 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
182 (PID.TID 0000.0001) > surfQFile ='shiQnet_cs32.bin',
183 (PID.TID 0000.0001) > EmPmRFile ='shiEmPR_cs32.bin',
184 (PID.TID 0000.0001) > /
185 (PID.TID 0000.0001)
186 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM01
187 (PID.TID 0000.0001) INI_PARMS ; read PARM01 : OK
188 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM02
189 (PID.TID 0000.0001) INI_PARMS ; read PARM02 : OK
190 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM03
191 (PID.TID 0000.0001) INI_PARMS ; read PARM03 : OK
192 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM04
193 (PID.TID 0000.0001) INI_PARMS ; read PARM04 : OK
194 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM05
195 (PID.TID 0000.0001) INI_PARMS ; read PARM05 : OK
196 (PID.TID 0000.0001) INI_PARMS: finished reading file "data"
197 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
198 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
199 (PID.TID 0000.0001) // =======================================================
200 (PID.TID 0000.0001) // Parameter file "data.pkg"
201 (PID.TID 0000.0001) // =======================================================
202 (PID.TID 0000.0001) ># Packages
203 (PID.TID 0000.0001) > &PACKAGES
204 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
205 (PID.TID 0000.0001) > useDiagnostics=.TRUE.,
206 (PID.TID 0000.0001) >#useMNC=.TRUE.,
207 (PID.TID 0000.0001) > /
208 (PID.TID 0000.0001)
209 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
210 (PID.TID 0000.0001) PACKAGES_BOOT: On/Off package Summary
211 -------- pkgs with a standard "usePKG" On/Off switch in "data.pkg": --------
212 pkg/gmredi compiled and used ( useGMRedi = T )
213 pkg/diagnostics compiled and used ( useDiagnostics = T )
214 pkg/mnc compiled but not used ( useMNC = F )
215 -------- pkgs without standard "usePKG" On/Off switch in "data.pkg": --------
216 pkg/generic_advdiff compiled and used ( useGAD = T )
217 pkg/mom_common compiled and used ( momStepping = T )
218 pkg/mom_vecinv compiled and used ( +vectorInvariantMomentum = T )
219 pkg/mom_fluxform compiled but not used ( & not vectorInvariantMom = F )
220 pkg/monitor compiled and used ( monitorFreq > 0. = T )
221 pkg/timeave compiled but not used ( taveFreq > 0. = F )
222 pkg/debug compiled but not used ( debugMode = F )
223 pkg/compon_communic compiled and used ( useCoupler = T )
224 pkg/ocn_compon_interf compiled and used ( useCoupler = T )
225 pkg/exch2 compiled and used
226 pkg/rw compiled and used
227 pkg/mdsio compiled and used
228 (PID.TID 0000.0001) PACKAGES_BOOT: End of package Summary
229 (PID.TID 0000.0001)
230 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
231 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
232 (PID.TID 0000.0001) // =======================================================
233 (PID.TID 0000.0001) // Parameter file "data.gmredi"
234 (PID.TID 0000.0001) // =======================================================
235 (PID.TID 0000.0001) ># GM+Redi package parameters:
236 (PID.TID 0000.0001) >
237 (PID.TID 0000.0001) >#-from MOM :
238 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
239 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
240 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
241 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
242 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
243 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
244 (PID.TID 0000.0001) >
245 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
246 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
247 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
248 (PID.TID 0000.0001) >
249 (PID.TID 0000.0001) > &GM_PARM01
250 (PID.TID 0000.0001) > GM_background_K = 800.,
251 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
252 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
253 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
254 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
255 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
256 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
257 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
258 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
259 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
260 (PID.TID 0000.0001) > /
261 (PID.TID 0000.0001) >
262 (PID.TID 0000.0001) >
263 (PID.TID 0000.0001)
264 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
265 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: opening data.diagnostics
266 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.diagnostics
267 (PID.TID 0000.0001) // =======================================================
268 (PID.TID 0000.0001) // Parameter file "data.diagnostics"
269 (PID.TID 0000.0001) // =======================================================
270 (PID.TID 0000.0001) ># Diagnostic Package Choices
271 (PID.TID 0000.0001) >#--------------------
272 (PID.TID 0000.0001) ># dumpAtLast (logical): always write output at the end of simulation (default=F)
273 (PID.TID 0000.0001) ># diag_mnc (logical): write to NetCDF files (default=useMNC)
274 (PID.TID 0000.0001) >#--for each output-stream:
275 (PID.TID 0000.0001) ># fileName(n) : prefix of the output file name (max 80c long) for outp.stream n
276 (PID.TID 0000.0001) ># frequency(n):< 0 : write snap-shot output every |frequency| seconds
277 (PID.TID 0000.0001) ># > 0 : write time-average output every frequency seconds
278 (PID.TID 0000.0001) ># timePhase(n) : write at time = timePhase + multiple of |frequency|
279 (PID.TID 0000.0001) ># averagingFreq : frequency (in s) for periodic averaging interval
280 (PID.TID 0000.0001) ># averagingPhase : phase (in s) for periodic averaging interval
281 (PID.TID 0000.0001) ># repeatCycle : number of averaging intervals in 1 cycle
282 (PID.TID 0000.0001) ># levels(:,n) : list of levels to write to file (Notes: declared as REAL)
283 (PID.TID 0000.0001) ># when this entry is missing, select all common levels of this list
284 (PID.TID 0000.0001) ># fields(:,n) : list of selected diagnostics fields (8.c) in outp.stream n
285 (PID.TID 0000.0001) ># (see "available_diagnostics.log" file for the full list of diags)
286 (PID.TID 0000.0001) ># missing_value(n) : missing value for real-type fields in output file "n"
287 (PID.TID 0000.0001) ># fileFlags(n) : specific code (8c string) for output file "n"
288 (PID.TID 0000.0001) >#--------------------
289 (PID.TID 0000.0001) > &DIAGNOSTICS_LIST
290 (PID.TID 0000.0001) ># diag_mnc = .FALSE.,
291 (PID.TID 0000.0001) >#--
292 (PID.TID 0000.0001) > fields(1:10,1) = 'ETAN ','ETANSQ ','DETADT2 ','PHIBOT ','PHIBOTSQ',
293 (PID.TID 0000.0001) > 'oceTAUX ','oceTAUY ','TFLUX ','SFLUX ','SRELAX ',
294 (PID.TID 0000.0001) ># 'TRELAX ','oceFreez',
295 (PID.TID 0000.0001) > fileName(1) = 'surfDiag',
296 (PID.TID 0000.0001) > frequency(1) = 31104000.,
297 (PID.TID 0000.0001) >
298 (PID.TID 0000.0001) > fields(1:15,2) = 'UVEL ','VVEL ','WVEL ','PHIHYD ',
299 (PID.TID 0000.0001) > 'VVELMASS','UVELMASS','WVELSQ ',
300 (PID.TID 0000.0001) > 'THETA ','UTHMASS ','VTHMASS ','WTHMASS ',
301 (PID.TID 0000.0001) > 'SALT ','USLTMASS','VSLTMASS','WSLTMASS',
302 (PID.TID 0000.0001) > fileName(2) = 'dynDiag',
303 (PID.TID 0000.0001) > frequency(2) = 31104000.,
304 (PID.TID 0000.0001) >
305 (PID.TID 0000.0001) > fields(1:6,3) = 'DRHODR ','RHOAnoma','CONVADJ ',
306 (PID.TID 0000.0001) > 'GM_Kwx ','GM_Kwy ','GM_Kwz ',
307 (PID.TID 0000.0001) ># 'GM_PsiX ','GM_PsiY ',
308 (PID.TID 0000.0001) ># levels(1,3) = 2., 3., 4., 5., 6., 7., 8., 9., 10., 11., 12., 13.,
309 (PID.TID 0000.0001) ># fileName(3) = 'oceDiag',
310 (PID.TID 0000.0001) > frequency(3) = 31104000.,
311 (PID.TID 0000.0001) >
312 (PID.TID 0000.0001) > fields(1:7,4) = 'ADVx_TH ','ADVy_TH ','ADVr_TH ',
313 (PID.TID 0000.0001) > 'DFxE_TH ','DFyE_TH ','DFrE_TH ',
314 (PID.TID 0000.0001) > 'DFrI_TH ',
315 (PID.TID 0000.0001) ># 'ADVx_SLT',
316 (PID.TID 0000.0001) ># fileName(4) = 'flxDiag',
317 (PID.TID 0000.0001) > frequency(4) = 31104000.,
318 (PID.TID 0000.0001) > /
319 (PID.TID 0000.0001) >
320 (PID.TID 0000.0001) >#--------------------
321 (PID.TID 0000.0001) ># Parameter for Diagnostics of per level statistics:
322 (PID.TID 0000.0001) >#--------------------
323 (PID.TID 0000.0001) ># diagSt_mnc (logical): write stat-diags to NetCDF files (default=diag_mnc)
324 (PID.TID 0000.0001) ># diagSt_regMaskFile : file containing the region-mask to read-in
325 (PID.TID 0000.0001) ># nSetRegMskFile : number of region-mask sets within the region-mask file
326 (PID.TID 0000.0001) ># set_regMask(i) : region-mask set-index that identifies the region "i"
327 (PID.TID 0000.0001) ># val_regMask(i) : region "i" identifier value in the region mask
328 (PID.TID 0000.0001) >#--for each output-stream:
329 (PID.TID 0000.0001) ># stat_fName(n) : prefix of the output file name (max 80c long) for outp.stream n
330 (PID.TID 0000.0001) ># stat_freq(n):< 0 : write snap-shot output every |stat_freq| seconds
331 (PID.TID 0000.0001) ># > 0 : write time-average output every stat_freq seconds
332 (PID.TID 0000.0001) ># stat_phase(n) : write at time = stat_phase + multiple of |stat_freq|
333 (PID.TID 0000.0001) ># stat_region(:,n) : list of "regions" (default: 1 region only=global)
334 (PID.TID 0000.0001) ># stat_fields(:,n) : list of selected diagnostics fields (8.c) in outp.stream n
335 (PID.TID 0000.0001) ># (see "available_diagnostics.log" file for the full list of diags)
336 (PID.TID 0000.0001) >#--------------------
337 (PID.TID 0000.0001) > &DIAG_STATIS_PARMS
338 (PID.TID 0000.0001) > stat_fields(1:16,1) = 'ETAN ','DETADT2 ','THETA ','SALT ','CONVADJ ',
339 (PID.TID 0000.0001) > 'DRHODR ','UE_VEL_C','VN_VEL_C','WVEL ',
340 (PID.TID 0000.0001) > 'oceTAUX ','oceTAUY ','oceFWflx','oceQnet ',
341 (PID.TID 0000.0001) > 'SRELAX ','oceSflux','sIceLoad',
342 (PID.TID 0000.0001) ># 'TRELAX ','oceFreez','oceQsw ',
343 (PID.TID 0000.0001) > stat_fName(1) = 'dynStDiag',
344 (PID.TID 0000.0001) > stat_freq(1) = 864000.,
345 (PID.TID 0000.0001) > stat_freq(1) = 18000.,
346 (PID.TID 0000.0001) ># stat_phase(1) = 0.,
347 (PID.TID 0000.0001) > /
348 (PID.TID 0000.0001) >
349 (PID.TID 0000.0001)
350 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "diagnostics_list": start
351 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "diagnostics_list": OK
352 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "DIAG_STATIS_PARMS": start
353 (PID.TID 0000.0001) S/R DIAGNOSTICS_READPARMS, read namelist "DIAG_STATIS_PARMS": OK
354 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: global parameter summary:
355 (PID.TID 0000.0001) dumpAtLast = /* always write time-ave diags at the end */
356 (PID.TID 0000.0001) F
357 (PID.TID 0000.0001) ;
358 (PID.TID 0000.0001) diag_mnc = /* write NetCDF output files */
359 (PID.TID 0000.0001) F
360 (PID.TID 0000.0001) ;
361 (PID.TID 0000.0001) useMissingValue = /* put MissingValue where mask = 0 */
362 (PID.TID 0000.0001) F
363 (PID.TID 0000.0001) ;
364 (PID.TID 0000.0001) diagCG_maxIters = /* max number of iters in diag_cg2d */
365 (PID.TID 0000.0001) 200
366 (PID.TID 0000.0001) ;
367 (PID.TID 0000.0001) diagCG_resTarget = /* residual target for diag_cg2d */
368 (PID.TID 0000.0001) 1.000000000000000E-09
369 (PID.TID 0000.0001) ;
370 (PID.TID 0000.0001) -----------------------------------------------------
371 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: active diagnostics summary:
372 (PID.TID 0000.0001) -----------------------------------------------------
373 (PID.TID 0000.0001) Creating Output Stream: surfDiag
374 (PID.TID 0000.0001) Output Frequency: 31104000.000000 ; Phase: 0.000000
375 (PID.TID 0000.0001) Averaging Freq.: 31104000.000000 , Phase: 0.000000 , Cycle: 1
376 (PID.TID 0000.0001) missing value: -9.990000000000E+02
377 (PID.TID 0000.0001) Levels: will be set later
378 (PID.TID 0000.0001) Fields: ETAN ETANSQ DETADT2 PHIBOT PHIBOTSQ oceTAUX oceTAUY TFLUX SFLUX SRELAX
379 (PID.TID 0000.0001) Creating Output Stream: dynDiag
380 (PID.TID 0000.0001) Output Frequency: 31104000.000000 ; Phase: 0.000000
381 (PID.TID 0000.0001) Averaging Freq.: 31104000.000000 , Phase: 0.000000 , Cycle: 1
382 (PID.TID 0000.0001) missing value: -9.990000000000E+02
383 (PID.TID 0000.0001) Levels: will be set later
384 (PID.TID 0000.0001) Fields: UVEL VVEL WVEL PHIHYD VVELMASS UVELMASS WVELSQ THETA UTHMASS VTHMASS
385 (PID.TID 0000.0001) Fields: WTHMASS SALT USLTMASS VSLTMASS WSLTMASS
386 (PID.TID 0000.0001) -----------------------------------------------------
387 (PID.TID 0000.0001) DIAGNOSTICS_READPARMS: statistics diags. summary:
388 (PID.TID 0000.0001) Creating Stats. Output Stream: dynStDiag
389 (PID.TID 0000.0001) Output Frequency: 18000.000000 ; Phase: 0.000000
390 (PID.TID 0000.0001) Regions: 0
391 (PID.TID 0000.0001) Fields: ETAN DETADT2 THETA SALT CONVADJ DRHODR UE_VEL_C VN_VEL_C WVEL oceTAUX
392 (PID.TID 0000.0001) Fields: oceTAUY oceFWflx oceQnet SRELAX oceSflux sIceLoad
393 (PID.TID 0000.0001) -----------------------------------------------------
394 (PID.TID 0000.0001)
395 (PID.TID 0000.0001) CPL_READPARMS: opening data.cpl
396 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.cpl
397 (PID.TID 0000.0001) // =======================================================
398 (PID.TID 0000.0001) // Parameter file "data.cpl"
399 (PID.TID 0000.0001) // =======================================================
400 (PID.TID 0000.0001) ># Coupling package parameters, OCN component:
401 (PID.TID 0000.0001) ># useImportHFlx :: True => use the Imported HeatFlux from couler
402 (PID.TID 0000.0001) ># useImportFW :: True => use the Imported Fresh Water flux fr cpl
403 (PID.TID 0000.0001) ># useImportTau :: True => use the Imported Wind-Stress from couler
404 (PID.TID 0000.0001) ># useImportSLP :: True => use the Imported Sea-level Atmos. Pressure
405 (PID.TID 0000.0001) ># useImportSIce :: True => use the Imported Sea-Ice loading
406 (PID.TID 0000.0001) ># cpl_taveFreq :: Frequency^-1 for time-Aver. output (s)
407 (PID.TID 0000.0001) > &CPL_OCN_PARAM
408 (PID.TID 0000.0001) ># useImportHFlx=.FALSE.,
409 (PID.TID 0000.0001) ># useImportFW =.FALSE.,
410 (PID.TID 0000.0001) ># useImportTau =.FALSE.,
411 (PID.TID 0000.0001) > useImportSLP =.FALSE.,
412 (PID.TID 0000.0001) ># useImportSIce=.FALSE.,
413 (PID.TID 0000.0001) ># cpl_taveFreq=2592000.,
414 (PID.TID 0000.0001) > cpl_taveFreq=18000.,
415 (PID.TID 0000.0001) > /
416 (PID.TID 0000.0001)
417 (PID.TID 0000.0001) CPL_READPARMS: finished reading data.cpl
418 (PID.TID 0000.0001)
419 (PID.TID 0000.0001) // ===================================
420 (PID.TID 0000.0001) // Coupling package parameters :
421 (PID.TID 0000.0001) // ===================================
422 (PID.TID 0000.0001) useImportHFlx= /* use Imported Heat-Flx fr Coupler on/off flag */
423 (PID.TID 0000.0001) T
424 (PID.TID 0000.0001) ;
425 (PID.TID 0000.0001) useImportFW = /* use Imported Fresh-Water fr Cpl. on/off flag */
426 (PID.TID 0000.0001) T
427 (PID.TID 0000.0001) ;
428 (PID.TID 0000.0001) useImportTau = /* use Imported Wind-Stress fr Cpl. on/off flag */
429 (PID.TID 0000.0001) T
430 (PID.TID 0000.0001) ;
431 (PID.TID 0000.0001) useImportSLP = /* use Imported Sea-level Atm Press on/off flag */
432 (PID.TID 0000.0001) F
433 (PID.TID 0000.0001) ;
434 (PID.TID 0000.0001) useImportSIce= /* use Imported Sea-Ice loading on/off flag */
435 (PID.TID 0000.0001) T
436 (PID.TID 0000.0001) ;
437 (PID.TID 0000.0001) useImportFIce= /* use Imported Sea-Ice Fract fr Cpl. on/off flag */
438 (PID.TID 0000.0001) F
439 (PID.TID 0000.0001) ;
440 (PID.TID 0000.0001) useImportCO2 = /* use Imported Atmos. CO2 fr Cpl. on/off flag */
441 (PID.TID 0000.0001) F
442 (PID.TID 0000.0001) ;
443 (PID.TID 0000.0001) useImportWSpd = /* use Imported Windspeed fr Cpl. on/off flag */
444 (PID.TID 0000.0001) F
445 (PID.TID 0000.0001) ;
446 (PID.TID 0000.0001) cpl_taveFreq = /* Frequency^-1 for time-Aver. output (s) */
447 (PID.TID 0000.0001) 1.800000000000000E+04
448 (PID.TID 0000.0001) ;
449 (PID.TID 0000.0001) cpl_timeave_mnc = /* write TimeAv to MNC file on/off flag */
450 (PID.TID 0000.0001) F
451 (PID.TID 0000.0001) ;
452 (PID.TID 0000.0001) cpl_timeave_mdsio = /* write TimeAv to MDSIO file on/off flag */
453 (PID.TID 0000.0001) T
454 (PID.TID 0000.0001) ;
455 (PID.TID 0000.0001) SET_PARMS: done
456 (PID.TID 0000.0001) Enter INI_VERTICAL_GRID: setInterFDr= T ; setCenterDr= F
457 (PID.TID 0000.0001) tile: 1 ; Read from file grid_cs32.face001.bin
458 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
459 (PID.TID 0000.0001) tile: 2 ; Read from file grid_cs32.face002.bin
460 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
461 (PID.TID 0000.0001) tile: 3 ; Read from file grid_cs32.face003.bin
462 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
463 (PID.TID 0000.0001) tile: 4 ; Read from file grid_cs32.face004.bin
464 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
465 (PID.TID 0000.0001) tile: 5 ; Read from file grid_cs32.face005.bin
466 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
467 (PID.TID 0000.0001) tile: 6 ; Read from file grid_cs32.face006.bin
468 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
469 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
470 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
471 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
472 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
473 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
474 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
475 (PID.TID 0000.0001) %MON XG_mean = 1.8603515625000E+00
476 (PID.TID 0000.0001) %MON XG_sd = 1.0357130300504E+02
477 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
478 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
479 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
480 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
481 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
482 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
483 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
484 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
485 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
486 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
487 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
488 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
489 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
490 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
491 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
492 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
493 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
494 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
495 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
496 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
497 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
498 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
499 (PID.TID 0000.0001) %MON YG_mean = -1.1842378929335E-15
500 (PID.TID 0000.0001) %MON YG_sd = 3.8676895860710E+01
501 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
502 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
503 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
504 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
505 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
506 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
507 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
508 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
509 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
510 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
511 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
512 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
513 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
514 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
515 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
516 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
517 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
518 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
519 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
520 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
521 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
522 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
523 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
524 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
525 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
526 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
527 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
528 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
529 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
530 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
531 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
532 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
533 (PID.TID 0000.0001) %MON AngleCS_max = 9.9999994756719E-01
534 (PID.TID 0000.0001) %MON AngleCS_min = -9.9968286884824E-01
535 (PID.TID 0000.0001) %MON AngleCS_mean = 3.3078922539000E-01
536 (PID.TID 0000.0001) %MON AngleCS_sd = 6.2496278958502E-01
537 (PID.TID 0000.0001) %MON AngleSN_max = 9.9968286884824E-01
538 (PID.TID 0000.0001) %MON AngleSN_min = -9.9999994756719E-01
539 (PID.TID 0000.0001) %MON AngleSN_mean = -3.3078922539000E-01
540 (PID.TID 0000.0001) %MON AngleSN_sd = 6.2496278958502E-01
541 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: bathy_Hmin50.bin
542 (PID.TID 0000.0001) // =======================================================
543 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc)
544 (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
545 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
546 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
547 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
548 (PID.TID 0000.0001) // 0.0: .
549 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
550 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
551 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
552 (PID.TID 0000.0001) // =======================================================
553 (PID.TID 0000.0001) K = 1
554 (PID.TID 0000.0001) // I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
555 (PID.TID 0000.0001) // |--J--|101234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
556 (PID.TID 0000.0001) // 34 -ba-abcehjnldcclz+........spps...................................vkqn+xnbbcbba--aabfu+..............hcbaaaaaaaaaccdccbaaabbddddccdffffghfeeeeedeffefilhfcaaaacgceei.......zomggfcaeccaecbbccddefilihecbaacbaajfega-aesfe
557 (PID.TID 0000.0001) // 33 abbbccceiomkfdbbc+.......+s......................................xsrxzz+cddb-----adu+...............hcbaa--aa--accddba--bbbddddccdfffhhgfeeddcceeddfgikhfffdfgccffw........zohhgebbaebbaaaaaccdfhlhfefdcccaabjefbaaafoos
558 (PID.TID 0000.0001) // 32 bddefhhkqqlgfaakqz..v.+..+.....................................++..u+...fdba----adu+................kdcaaa-aaa-accdcb---bbbcdddddefffggfeeedccccbbdcdfgghhiihcbeiw.........+ynjgebaaebaaaa-aacccfikkhecccbbbaaabaadfklnq
559 (PID.TID 0000.0001) // 31 bcffijnpnqneaaat..umrr+s.z.....................................+++++.ztsfeb--dfdfu+................+lkdca--aa--abcccb---bbbbddddeffflhfeeeecbbbb-abbacbcdceffbbfw+..........++ujfbaafbaaa----aacffiljgfffcca--adfikkiihh
560 (PID.TID 0000.0001) // 30 adgillkkkifcadcx.ymmqzqikvnnps.................................+++++wmegifcacdlqx+++...............mligea---a---abbbb---abaaddddeedkmeddefdbbbaa---b--aaaaabaabm..............+viba-iba-------acdefinmlgiieb-chnnnmlmlgf
561 (PID.TID 0000.0001) // 29 cfiljigfjd--efdozy...+ximpnnuz..................................+++yqddhjhcbbchz+......++.........+mmhffc---c----aaba------acdddcbcineddgdbaaa--d--a------aa-bfz...............+qe--qe---aa---aedeegknmlgiigcdfhpokkimlf
562 (PID.TID 0000.0001) // 28 bgkhfcccea-bdei........t........................................++zwgfcfnhccbbhwwy.....+++........+njfeed---d-----aa-------abddcabcnfddegcaaa---f------------dk+................+ja-+ja------bffdddehfd--bedaacfhpnligii
563 (PID.TID 0000.0001) // 27 cghfbaaaa-achmy..........................+++....................++vnbbbcpkeeecflmqxy....++........+lhfeecc--cc------------aaadcbabcfhddccba-----d-----------irw.................++e-++e-----mhmijddda--------ahhfiokhede
564 (PID.TID 0000.0001) // 26 dhfca-----bfiv...........................++sy...................+tq-fdbbnqiheddefhiksz++++........zkhfdccb--cb------------aabdcaaaacfddbca------fa-abb-----vvv...................+wa.+wa---mlmkijhc----------cjjffiheb-a
565 (PID.TID 0000.0001) // 25 chfa------ch+..................w...........njo+................+x-----bcqqojfefiiiijmy.++.........zkhfdbaa--aa-------daa---acccaaaacccca--------udaabbb----tei...................++q.++qdeqnghiljcaaaaidaa----beedeeca--
566 (PID.TID 0000.0001) // 24 eifa--acbcei...................w...........likn+.....++.....++znpa----bbnlmnjhinlksssw............qhfeca------------addc--aeffaaaaaaccb-a----a--+udbbaba---ven....................++..++xywnfgllcbbabegkecba----ddddcaac
567 (PID.TID 0000.0001) // 23 fida-aabchjk...................zz...z.....nhhijz....tqq.....+ujgzgd---abegklkkknols..xuu..........zgfdba------------bcd---affaaadffabbb-----aa-b.+ufb-----l.gx...........s.........+...++zzkfilfccccoz..ulkcd---bccnfddd
568 (PID.TID 0000.0001) // 22 fhfaa---bfgi....................zz..zz..rnjffggm...nlmn+....+sffzya--aabaffdfhimrmp...yuu.++.......zudba------------adc---dda-adffe-aa--------aa..+ufc-baaqvhh..........dcfeeh..........++zggqvifefhz......zobbaccfwuffe
569 (PID.TID 0000.0001) // 21 bcgca----abe.....................yss.ysstlgeeeeoz..ijklt+....lfjzzf---adaadcehllotq....yy+++zzs.....+zcba---a-------cdd--aaa----df------------aa...+upjdcy.vohq.......+idcdfeeefwz..wz....+hhn.vklox.........gdccfjwrigf
570 (PID.TID 0000.0001) // 20 bbcgfcaa-aae+...........................lcgfdddhq.+hiilnz++.+oquxyz--adgaabcfmtooyxz......+yuiiy....++gb------------ddcca-a-----acbaa------bbaaa......ywxy.lulo.lv...kcdgddffefffilyfilyx+fffk.+xyyy.........mgeimvskjkl
571 (PID.TID 0000.0001) // 19 feccdghfeegcbt..........................aafifccgnrzgghjry.+++sr+lq.--edftkblwnnsp.vv......skhggt...+++t-------------bdaf---------edd-------adlaa.........vnhzy.tllqiedccdhggfggffiigfiiggfcbdgy..yz..........xigqophijkk
572 (PID.TID 0000.0001) // 18 wifedfkhfegbbcivlqfoz..............j...jaacfihggokeeffgt..++++..hhlfdedd.qcz+.zwxtsttz..ysrkhot++++++zig------------b--f---------egqqqaa----frb-.......+kkrhw.vqmlnieddcdehgggffgigegigedbaaceiy.............zilrddefikk
573 (PID.TID 0000.0001) // 17 +wfeefikhgcbbccaaacgn.............ic..icaaccfihfoedddeedy..++...nnqwgfee.z++..+zsjjllllljllpjos+++.+zhhi---------e-----ea--------foqqoqqo--hlwge.......+nk+..xiioonhfefddegihhghigfdigfdbaaabdgx..............nheddefikl
574 (PID.TID 0000.0001) // 16 ..wiheddeccdfhfbabdfl............jdb.jdbaddddgifkccccdccd+.++..++ynvz.tku....++zyslllllkhggkmpy++...ihhi---------ea---feb-----a-acnoohfghknvmwnu........qhu..hhhkojgffgeefghihhiieedieedbaaabcdy..............ygddeghilj
575 (PID.TID 0000.0001) // 15 ....ylea--acfihebcbbes..........sfcbsfcbbngfffigcaaabdbcac+.+++++zgmpx..m....++..zslwz.yhhhhnz+++...rhgc--------ab----ige----acaaalllkddfiy..ysw........thk.xgghiligfghfefhhhhiiheedheedcdbbabdmz.............zfdeghikki
576 (PID.TID 0000.0001) // 14 ......c---acgkhdcc--di..........ofddofddchohffikaaaaabaaa-aw+.+ysnggox++rv..........yzzzzrjil+++....qhgd---------a-----i---cccdeabkklldinqssy..x.........+y.uhghikihgfghefgihhhgeeeeeeeeeddbaadhw.............nedeghjjhf
577 (PID.TID 0000.0001) // 13 .....+b----cfkhec---afz.........nhfdnhfdffholghkaaaaaba-a---flkkuswyy+++r...........zzzzz++ry++......yd------------------aeecdeidfkkqnqlmqquukqq............iihiijjhfefgefhjihiffgggfgggffecaabelx...........zjecehijhfe
578 (PID.TID 0000.0001) // 12 .....ec----chjhec---ag..........skiqskiqddeiiiifaaabae--a---dd--iu+++.++++..........+z+++++.+++....++.s----------------a-ceccdejhlllkqlkklssiccd...........wjkkkjjjigeefffgjiiighiiihiiihhhdaabdffghtxx......mfccehjiffd
579 (PID.TID 0000.0001) // 11 ....pdca--achlheba--ai..........nkn.nkn.fdemijidaaaabi-------a--q+....++s...........+++++..........+yyza--------b-----a--ccccddkhieekkossssfbbbb..........njjijhhihijhgggggjjjjijkkkjkkkkjjhcaacddeegpy.....xfdccdhjgfdd
580 (PID.TID 0000.0001) // 10 ....wfdb--achlhea---an.........uos..os..dcemikkfdcaabi-------equ+..................................zyvuq--------cc----a---dcfhkopqjeissrnpfbbccc........zslihhigghgijjihhhhkllkkkkkkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddc
581 (PID.TID 0000.0001) // 9 ....vgec---bfikca--cjl+.......+nnv.+nv.+ccffhkkiddaadha-----as++........z++........................zxuuk----------a---a----djmqrrnlllsoiddcccccd.......+zjijhfgfggffhjkkkiillljihhghhhghgihighdeeffgghimnnjgecbbcdgfeccb
582 (PID.TID 0000.0001) // 8 ...zleca---afjfca--hdfz.......vkky.jky.jceddefijffdddhb--a-afv............ss.........................+yku---u--------------ejnpqqnninnritqdccchk......wihgghgeffffeefhijkjkljiigeeffeeffefffhjhhikkklljklmhffeeeggfdcbaa
583 (PID.TID 0000.0001) // 7 .+zohec--abcfkhecbchbdx.......qiht.fht.faaaabdgijgfededcdcb-f+.............pz.........................+zu---u--------------edefqgqddsz+......+yu+....tiggfggfeeeefeeefiiiijkiihhedddeddddddddjjllliijhfkmmkkjjhijgdcba--
584 (PID.TID 0000.0001) // 6 +yomfddcaabefkifdchaadt......uqdeisceisc----dfefgifffkklldc--v.............pp.........................v.x---x---------a----fbbpqgzenx+........zdlkhhfffffffgfeeeeeeeefhhhhijihhffddcfddcbbbbdhhiihedddb-cfhhhjjjieca----
585 (PID.TID 0000.0001) // 5 +nhgffkghccfhkhffgdaackz....uoibcimlcimlaaacfbddfjjhijeehf-a-c.............su.........................qk.yi-.yi-------gha-fjddqs+xkrz.........q-kdccdeeeeeeedddedddddgghhhhjhhgffcbbfcbbaaaaddfegecca----dfeefhfgdb-----
586 (PID.TID 0000.0001) // 4 ujhgfllfhdffhkfffca-aady...llnabdopfdopfcbdgdbcdehlihgfddc--ms........................................okn.zdn.zd---eciiiicfkeeqy.ysz..........n-dcbbdeddedcdcccdddcddffggghiggfffdbafdbaa---acdcccba--abvfedeffdcca----b
587 (PID.TID 0000.0001) // 3 jggfcceeffffjlkjgaa---bfvheeln-aesphesphfdhgabddeflihhgfecbaaayq+++++.................................kqnz.vnz.vtpkllgdccfkkkkk..++..........+g-caaadcdddcbbbbcdddcccdffffghgffffdcafdcaa----abcaaaa-acxxmecdjmdbba----r
588 (PID.TID 0000.0001) // 2 feecbbccddefilihecbaacbaajfega-aesqhesqhffiea-cdeflkkljifeddcba---bry+...............................vkqn+.sn+.sghfcbcbbbdgfdek.++++.........+l-aaaaccdccbaaabbddddccdffffghfeeeeecbeecba------baaaa-euwxqdbcdkud-----sy
589 (PID.TID 0000.0001) // 1 bbbaaaaaccdfhlhfefdcccaabjefbaaafonhfonhglid--adfgkkkklkhffddca-----s+++.............................xsrxz.txz.tedcbbbbaaadddet.++++.........+l--a-accddba--bbbddddccdfffhhgfeeddccbdccba-------aaaabgns.qcbcchyzqngll++
590 (PID.TID 0000.0001) // 0 aaaaaa-aacccfikkhecccbbbaaabaadfkllikllilmgebaadfijjiiikjhffdcba-----lll...........................++..u+..z+..zmdfbd---a-aeef.xx+..........+++s---accdcb---bbbcdddddefffggfeeedcccbcccbba----aa--alrwwy.kcbccc+...++++.
591 (PID.TID 0000.0001) // -1 aaaaa----aacffiljgfffcca--adfikkiikiiikimiiheccfurkiffhijjigfecb-----l--...........................+++++.z+..z+.wqgbf-------dgzpoy+........+ys+yaa-abcccb---bbbbddddeffflhfeeeecbbcbbbcbbaa----a--bdflm.yuibbcc.......+.
592 (PID.TID 0000.0001) // =======================================================
593 (PID.TID 0000.0001) // END OF FIELD =
594 (PID.TID 0000.0001) // =======================================================
595 (PID.TID 0000.0001)
596 (PID.TID 0000.0001) // =======================================================
597 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc)
598 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
599 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
600 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
601 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
602 (PID.TID 0000.0001) // 0.0: .
603 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
604 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
605 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
606 (PID.TID 0000.0001) // =======================================================
607 (PID.TID 0000.0001) // =======================================================
608 (PID.TID 0000.0001) // END OF FIELD =
609 (PID.TID 0000.0001) // =======================================================
610 (PID.TID 0000.0001)
611 (PID.TID 0000.0001) // =======================================================
612 (PID.TID 0000.0001) // Field hFacC at iteration 0
613 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
614 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
615 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
616 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
617 (PID.TID 0000.0001) // 0.0: .
618 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
619 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
620 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
621 (PID.TID 0000.0001) // =======================================================
622 (PID.TID 0000.0001) // =======================================================
623 (PID.TID 0000.0001) // END OF FIELD =
624 (PID.TID 0000.0001) // =======================================================
625 (PID.TID 0000.0001)
626 (PID.TID 0000.0001) // =======================================================
627 (PID.TID 0000.0001) // Field hFacW at iteration 0
628 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
629 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
630 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
631 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
632 (PID.TID 0000.0001) // 0.0: .
633 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
634 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
635 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
636 (PID.TID 0000.0001) // =======================================================
637 (PID.TID 0000.0001) // =======================================================
638 (PID.TID 0000.0001) // END OF FIELD =
639 (PID.TID 0000.0001) // =======================================================
640 (PID.TID 0000.0001)
641 (PID.TID 0000.0001) // =======================================================
642 (PID.TID 0000.0001) // Field hFacS at iteration 0
643 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
644 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
645 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
646 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
647 (PID.TID 0000.0001) // 0.0: .
648 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
649 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
650 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
651 (PID.TID 0000.0001) // =======================================================
652 (PID.TID 0000.0001) // =======================================================
653 (PID.TID 0000.0001) // END OF FIELD =
654 (PID.TID 0000.0001) // =======================================================
655 (PID.TID 0000.0001)
656 (PID.TID 0000.0001) GAD_INIT_FIXED: GAD_OlMinSize= 1 0 1
657 (PID.TID 0000.0001)
658 (PID.TID 0000.0001) // ===================================
659 (PID.TID 0000.0001) // GAD parameters :
660 (PID.TID 0000.0001) // ===================================
661 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
662 (PID.TID 0000.0001) 2
663 (PID.TID 0000.0001) ;
664 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
665 (PID.TID 0000.0001) 2
666 (PID.TID 0000.0001) ;
667 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
668 (PID.TID 0000.0001) F
669 (PID.TID 0000.0001) ;
670 (PID.TID 0000.0001) tempSOM_Advection = /* use 2nd Order Moment Advection for Temp */
671 (PID.TID 0000.0001) F
672 (PID.TID 0000.0001) ;
673 (PID.TID 0000.0001) AdamsBashforthGt = /* apply Adams-Bashforth extrapolation on Gt */
674 (PID.TID 0000.0001) T
675 (PID.TID 0000.0001) ;
676 (PID.TID 0000.0001) AdamsBashforth_T = /* apply Adams-Bashforth extrapolation on Temp */
677 (PID.TID 0000.0001) F
678 (PID.TID 0000.0001) ;
679 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
680 (PID.TID 0000.0001) 2
681 (PID.TID 0000.0001) ;
682 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
683 (PID.TID 0000.0001) 2
684 (PID.TID 0000.0001) ;
685 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
686 (PID.TID 0000.0001) F
687 (PID.TID 0000.0001) ;
688 (PID.TID 0000.0001) saltSOM_Advection = /* use 2nd Order Moment Advection for Salt */
689 (PID.TID 0000.0001) F
690 (PID.TID 0000.0001) ;
691 (PID.TID 0000.0001) AdamsBashforthGs = /* apply Adams-Bashforth extrapolation on Gs */
692 (PID.TID 0000.0001) T
693 (PID.TID 0000.0001) ;
694 (PID.TID 0000.0001) AdamsBashforth_S = /* apply Adams-Bashforth extrapolation on Salt */
695 (PID.TID 0000.0001) F
696 (PID.TID 0000.0001) ;
697 (PID.TID 0000.0001) // ===================================
698 (PID.TID 0000.0001) ------------------------------------------------------------
699 (PID.TID 0000.0001) DIAGNOSTICS_SET_LEVELS: done
700 (PID.TID 0000.0001) Total Nb of available Diagnostics: ndiagt= 207
701 (PID.TID 0000.0001) write list of available Diagnostics to file: available_diagnostics.log
702 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 23 ETAN
703 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 24 ETANSQ
704 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 25 DETADT2
705 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 73 PHIBOT
706 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 74 PHIBOTSQ
707 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 79 oceTAUX
708 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 80 oceTAUY
709 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 92 TFLUX
710 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 93 SFLUX
711 (PID.TID 0000.0001) SETDIAG: Allocate 1 x 1 Levels for Diagnostic # 89 SRELAX
712 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 30 UVEL
713 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 31 VVEL
714 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 32 WVEL
715 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 71 PHIHYD
716 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 46 VVELMASS
717 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 45 UVELMASS
718 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 38 WVELSQ
719 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 26 THETA
720 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 50 UTHMASS
721 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 51 VTHMASS
722 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 52 WTHMASS
723 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 27 SALT
724 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 53 USLTMASS
725 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 54 VSLTMASS
726 (PID.TID 0000.0001) SETDIAG: Allocate 15 x 1 Levels for Diagnostic # 55 WSLTMASS
727 (PID.TID 0000.0001) space allocated for all diagnostics: 235 levels
728 (PID.TID 0000.0001) set mate pointer for diag # 79 oceTAUX , Parms: UU U1 , mate: 80
729 (PID.TID 0000.0001) set mate pointer for diag # 80 oceTAUY , Parms: VV U1 , mate: 79
730 (PID.TID 0000.0001) set mate pointer for diag # 30 UVEL , Parms: UUR MR , mate: 31
731 (PID.TID 0000.0001) set mate pointer for diag # 31 VVEL , Parms: VVR MR , mate: 30
732 (PID.TID 0000.0001) set mate pointer for diag # 46 VVELMASS , Parms: VVr MR , mate: 45
733 (PID.TID 0000.0001) set mate pointer for diag # 45 UVELMASS , Parms: UUr MR , mate: 46
734 (PID.TID 0000.0001) set mate pointer for diag # 50 UTHMASS , Parms: UUr MR , mate: 51
735 (PID.TID 0000.0001) set mate pointer for diag # 51 VTHMASS , Parms: VVr MR , mate: 50
736 (PID.TID 0000.0001) set mate pointer for diag # 53 USLTMASS , Parms: UUr MR , mate: 54
737 (PID.TID 0000.0001) set mate pointer for diag # 54 VSLTMASS , Parms: VVr MR , mate: 53
738 (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: Set levels for Outp.Stream: surfDiag
739 (PID.TID 0000.0001) Levels: 1.
740 (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: Set levels for Outp.Stream: dynDiag
741 (PID.TID 0000.0001) Levels: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15.
742 (PID.TID 0000.0001) DIAGNOSTICS_SET_POINTERS: done
743 (PID.TID 0000.0001) ------------------------------------------------------------
744 (PID.TID 0000.0001) DIAGSTATS_SET_REGIONS: define no region
745 (PID.TID 0000.0001) ------------------------------------------------------------
746 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 23 ETAN
747 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 25 DETADT2
748 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 26 THETA
749 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 27 SALT
750 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 78 CONVADJ
751 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 77 DRHODR
752 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 39 UE_VEL_C
753 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 40 VN_VEL_C
754 (PID.TID 0000.0001) SETDIAG: Allocate 15 Levels for Stats-Diag # 32 WVEL
755 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 79 oceTAUX
756 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 80 oceTAUY
757 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 83 oceFWflx
758 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 85 oceQnet
759 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 89 SRELAX
760 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 84 oceSflux
761 (PID.TID 0000.0001) SETDIAG: Allocate 1 Levels for Stats-Diag # 82 sIceLoad
762 (PID.TID 0000.0001) space allocated for all stats-diags: 114 levels
763 (PID.TID 0000.0001) DIAGSTATS_SET_POINTERS: done
764 (PID.TID 0000.0001) ------------------------------------------------------------
765 (PID.TID 0000.0001) DIAGSTATS_INI_IO: open file: dynStDiag.0000000000.txt , unit= 9
766 (PID.TID 0000.0001) INI_GLOBAL_DOMAIN: Found 19 CS-corner Pts in the domain
767 (PID.TID 0000.0001) %MON fCori_max = 1.4574827780704E-04
768 (PID.TID 0000.0001) %MON fCori_min = -1.4574827780704E-04
769 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
770 (PID.TID 0000.0001) %MON fCori_sd = 8.4202189509968E-05
771 (PID.TID 0000.0001) %MON fCoriG_max = 1.4584247033981E-04
772 (PID.TID 0000.0001) %MON fCoriG_min = -1.4584247033981E-04
773 (PID.TID 0000.0001) %MON fCoriG_mean = 2.2587545260115E-21
774 (PID.TID 0000.0001) %MON fCoriG_sd = 8.4202189509968E-05
775 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4580166994612E-04
776 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2407700865903E-06
777 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1514045869113E-04
778 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0375849106513E-05
779 (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
780 (PID.TID 0000.0001)
781 (PID.TID 0000.0001) // =======================================================
782 (PID.TID 0000.0001) // Model configuration
783 (PID.TID 0000.0001) // =======================================================
784 (PID.TID 0000.0001) //
785 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
786 (PID.TID 0000.0001) //
787 (PID.TID 0000.0001) buoyancyRelation = /* Type of relation to get Buoyancy */
788 (PID.TID 0000.0001) 'OCEANIC'
789 (PID.TID 0000.0001) ;
790 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
791 (PID.TID 0000.0001) F
792 (PID.TID 0000.0001) ;
793 (PID.TID 0000.0001) fluidIsWater = /* fluid major constituent is Water */
794 (PID.TID 0000.0001) T
795 (PID.TID 0000.0001) ;
796 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
797 (PID.TID 0000.0001) F
798 (PID.TID 0000.0001) ;
799 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
800 (PID.TID 0000.0001) T
801 (PID.TID 0000.0001) ;
802 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or K ) */
803 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
804 (PID.TID 0000.0001) ;
805 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( psu ) */
806 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
807 (PID.TID 0000.0001) ;
808 (PID.TID 0000.0001) useStrainTensionVisc= /* Use StrainTension Form of Viscous Operator */
809 (PID.TID 0000.0001) F
810 (PID.TID 0000.0001) ;
811 (PID.TID 0000.0001) useVariableVisc = /* Use variable horizontal viscosity */
812 (PID.TID 0000.0001) F
813 (PID.TID 0000.0001) ;
814 (PID.TID 0000.0001) useHarmonicVisc = /* Use harmonic horizontal viscosity */
815 (PID.TID 0000.0001) T
816 (PID.TID 0000.0001) ;
817 (PID.TID 0000.0001) useBiharmonicVisc= /* Use biharmonic horiz. viscosity */
818 (PID.TID 0000.0001) F
819 (PID.TID 0000.0001) ;
820 (PID.TID 0000.0001) useSmag3D = /* Use isotropic 3-D Smagorinsky viscosity */
821 (PID.TID 0000.0001) F
822 (PID.TID 0000.0001) ;
823 (PID.TID 0000.0001) viscAh = /* Lateral harmonic viscosity ( m^2/s ) */
824 (PID.TID 0000.0001) 3.000000000000000E+05
825 (PID.TID 0000.0001) ;
826 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
827 (PID.TID 0000.0001) 0.000000000000000E+00
828 (PID.TID 0000.0001) ;
829 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
830 (PID.TID 0000.0001) T
831 (PID.TID 0000.0001) ;
832 (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
833 (PID.TID 0000.0001) 2.000000000000000E+00
834 (PID.TID 0000.0001) ;
835 (PID.TID 0000.0001) viscArNr = /* vertical profile of vertical viscosity ( m^2/s )*/
836 (PID.TID 0000.0001) 15 @ 1.000000000000000E-03 /* K = 1: 15 */
837 (PID.TID 0000.0001) ;
838 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
839 (PID.TID 0000.0001) T
840 (PID.TID 0000.0001) ;
841 (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( m/s ) */
842 (PID.TID 0000.0001) 0.000000000000000E+00
843 (PID.TID 0000.0001) ;
844 (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coefficient (-) */
845 (PID.TID 0000.0001) 0.000000000000000E+00
846 (PID.TID 0000.0001) ;
847 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
848 (PID.TID 0000.0001) 0.000000000000000E+00
849 (PID.TID 0000.0001) ;
850 (PID.TID 0000.0001) diffK4T = /* Biharmonic diffusion of heat laterally ( m^4/s ) */
851 (PID.TID 0000.0001) 0.000000000000000E+00
852 (PID.TID 0000.0001) ;
853 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
854 (PID.TID 0000.0001) 0.000000000000000E+00
855 (PID.TID 0000.0001) ;
856 (PID.TID 0000.0001) diffK4S = /* Biharmonic diffusion of salt laterally ( m^4/s ) */
857 (PID.TID 0000.0001) 0.000000000000000E+00
858 (PID.TID 0000.0001) ;
859 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
860 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
861 (PID.TID 0000.0001) ;
862 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
863 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
864 (PID.TID 0000.0001) ;
865 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 79 ( m^2/s ) */
866 (PID.TID 0000.0001) 0.000000000000000E+00
867 (PID.TID 0000.0001) ;
868 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
869 (PID.TID 0000.0001) 0.000000000000000E+00
870 (PID.TID 0000.0001) ;
871 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
872 (PID.TID 0000.0001) 2.000000000000000E+02
873 (PID.TID 0000.0001) ;
874 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
875 (PID.TID 0000.0001) -2.000000000000000E+03
876 (PID.TID 0000.0001) ;
877 (PID.TID 0000.0001) ivdc_kappa = /* Implicit Vertical Diffusivity for Convection ( m^2/s) */
878 (PID.TID 0000.0001) 1.000000000000000E+01
879 (PID.TID 0000.0001) ;
880 (PID.TID 0000.0001) hMixCriteria= /* Criteria for mixed-layer diagnostic */
881 (PID.TID 0000.0001) -8.000000000000000E-01
882 (PID.TID 0000.0001) ;
883 (PID.TID 0000.0001) dRhoSmall = /* Parameter for mixed-layer diagnostic */
884 (PID.TID 0000.0001) 1.000000000000000E-06
885 (PID.TID 0000.0001) ;
886 (PID.TID 0000.0001) hMixSmooth= /* Smoothing parameter for mixed-layer diagnostic */
887 (PID.TID 0000.0001) 0.000000000000000E+00
888 (PID.TID 0000.0001) ;
889 (PID.TID 0000.0001) eosType = /* Type of Equation of State */
890 (PID.TID 0000.0001) 'JMD95Z'
891 (PID.TID 0000.0001) ;
892 (PID.TID 0000.0001) HeatCapacity_Cp = /* Specific heat capacity ( J/kg/K ) */
893 (PID.TID 0000.0001) 3.994000000000000E+03
894 (PID.TID 0000.0001) ;
895 (PID.TID 0000.0001) celsius2K = /* 0 degree Celsius converted to Kelvin ( K ) */
896 (PID.TID 0000.0001) 2.731500000000000E+02
897 (PID.TID 0000.0001) ;
898 (PID.TID 0000.0001) rhoConst = /* Reference density (Boussinesq) ( kg/m^3 ) */
899 (PID.TID 0000.0001) 1.030000000000000E+03
900 (PID.TID 0000.0001) ;
901 (PID.TID 0000.0001) rhoFacC = /* normalized Reference density @ cell-Center (-) */
902 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
903 (PID.TID 0000.0001) ;
904 (PID.TID 0000.0001) rhoFacF = /* normalized Reference density @ W-Interface (-) */
905 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
906 (PID.TID 0000.0001) ;
907 (PID.TID 0000.0001) rhoConstFresh = /* Fresh-water reference density ( kg/m^3 ) */
908 (PID.TID 0000.0001) 1.000000000000000E+03
909 (PID.TID 0000.0001) ;
910 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
911 (PID.TID 0000.0001) 9.810000000000000E+00
912 (PID.TID 0000.0001) ;
913 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
914 (PID.TID 0000.0001) 9.810000000000000E+00
915 (PID.TID 0000.0001) ;
916 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
917 (PID.TID 0000.0001) 8.616400000000000E+04
918 (PID.TID 0000.0001) ;
919 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
920 (PID.TID 0000.0001) 7.292123516990375E-05
921 (PID.TID 0000.0001) ;
922 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
923 (PID.TID 0000.0001) 1.000000000000000E-04
924 (PID.TID 0000.0001) ;
925 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
926 (PID.TID 0000.0001) 9.999999999999999E-12
927 (PID.TID 0000.0001) ;
928 (PID.TID 0000.0001) fPrime = /* Second coriolis parameter ( 1/s ) */
929 (PID.TID 0000.0001) 0.000000000000000E+00
930 (PID.TID 0000.0001) ;
931 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
932 (PID.TID 0000.0001) F
933 (PID.TID 0000.0001) ;
934 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
935 (PID.TID 0000.0001) T
936 (PID.TID 0000.0001) ;
937 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
938 (PID.TID 0000.0001) 1.000000000000000E+00
939 (PID.TID 0000.0001) ;
940 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
941 (PID.TID 0000.0001) 1.000000000000000E+00
942 (PID.TID 0000.0001) ;
943 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
944 (PID.TID 0000.0001) 1.000000000000000E+00
945 (PID.TID 0000.0001) ;
946 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
947 (PID.TID 0000.0001) T
948 (PID.TID 0000.0001) ;
949 (PID.TID 0000.0001) uniformFreeSurfLev = /* free-surface level-index is uniform */
950 (PID.TID 0000.0001) T
951 (PID.TID 0000.0001) ;
952 (PID.TID 0000.0001) hFacMin = /* minimum partial cell factor (hFac) */
953 (PID.TID 0000.0001) 1.000000000000000E-01
954 (PID.TID 0000.0001) ;
955 (PID.TID 0000.0001) hFacMinDr = /* minimum partial cell thickness ( m) */
956 (PID.TID 0000.0001) 2.000000000000000E+01
957 (PID.TID 0000.0001) ;
958 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
959 (PID.TID 0000.0001) T
960 (PID.TID 0000.0001) ;
961 (PID.TID 0000.0001) linFSConserveTr = /* Tracer correction for Lin Free Surface on/off flag*/
962 (PID.TID 0000.0001) F
963 (PID.TID 0000.0001) ;
964 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
965 (PID.TID 0000.0001) 4
966 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
967 (PID.TID 0000.0001) ;
968 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
969 (PID.TID 0000.0001) 2.000000000000000E-01
970 (PID.TID 0000.0001) ;
971 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
972 (PID.TID 0000.0001) 2.000000000000000E+00
973 (PID.TID 0000.0001) ;
974 (PID.TID 0000.0001) select_rStar = /* r* Vertical coord. options (=0 r coord.; >0 uses r*)*/
975 (PID.TID 0000.0001) 2
976 (PID.TID 0000.0001) ;
977 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
978 (PID.TID 0000.0001) T
979 (PID.TID 0000.0001) ;
980 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
981 (PID.TID 0000.0001) 0.000000000000000E+00
982 (PID.TID 0000.0001) ;
983 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(psu)*/
984 (PID.TID 0000.0001) 0.000000000000000E+00
985 (PID.TID 0000.0001) ;
986 (PID.TID 0000.0001) selectAddFluid = /* option for mass source/sink of fluid (=0: off) */
987 (PID.TID 0000.0001) 0
988 (PID.TID 0000.0001) ;
989 (PID.TID 0000.0001) temp_addMass = /* Temp. of addMass array (UNSET=use local T)(oC)*/
990 (PID.TID 0000.0001) 0.000000000000000E+00
991 (PID.TID 0000.0001) ;
992 (PID.TID 0000.0001) salt_addMass = /* Salin. of addMass array (UNSET=use local S)(psu)*/
993 (PID.TID 0000.0001) 0.000000000000000E+00
994 (PID.TID 0000.0001) ;
995 (PID.TID 0000.0001) use3Dsolver = /* use 3-D pressure solver on/off flag */
996 (PID.TID 0000.0001) F
997 (PID.TID 0000.0001) ;
998 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
999 (PID.TID 0000.0001) F
1000 (PID.TID 0000.0001) ;
1001 (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
1002 (PID.TID 0000.0001) 1.000000000000000E+00
1003 (PID.TID 0000.0001) ;
1004 (PID.TID 0000.0001) implicitNHPress = /* Non-Hyd Pressure implicit factor (0-1)*/
1005 (PID.TID 0000.0001) 1.000000000000000E+00
1006 (PID.TID 0000.0001) ;
1007 (PID.TID 0000.0001) selectNHfreeSurf = /* Non-Hyd (free-)Surface option */
1008 (PID.TID 0000.0001) 0
1009 (PID.TID 0000.0001) ;
1010 (PID.TID 0000.0001) quasiHydrostatic = /* Quasi-Hydrostatic on/off flag */
1011 (PID.TID 0000.0001) F
1012 (PID.TID 0000.0001) ;
1013 (PID.TID 0000.0001) calc_wVelocity = /* vertical velocity calculation on/off flag */
1014 (PID.TID 0000.0001) T
1015 (PID.TID 0000.0001) ;
1016 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
1017 (PID.TID 0000.0001) T
1018 (PID.TID 0000.0001) ;
1019 (PID.TID 0000.0001) vectorInvariantMomentum= /* Vector-Invariant Momentum on/off */
1020 (PID.TID 0000.0001) T
1021 (PID.TID 0000.0001) ;
1022 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
1023 (PID.TID 0000.0001) T
1024 (PID.TID 0000.0001) ;
1025 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
1026 (PID.TID 0000.0001) T
1027 (PID.TID 0000.0001) ;
1028 (PID.TID 0000.0001) momImplVertAdv= /* Momentum implicit vert. advection on/off*/
1029 (PID.TID 0000.0001) F
1030 (PID.TID 0000.0001) ;
1031 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
1032 (PID.TID 0000.0001) F
1033 (PID.TID 0000.0001) ;
1034 (PID.TID 0000.0001) metricTerms = /* metric-Terms on/off flag */
1035 (PID.TID 0000.0001) F
1036 (PID.TID 0000.0001) ;
1037 (PID.TID 0000.0001) useNHMTerms = /* Non-Hydrostatic Metric-Terms on/off */
1038 (PID.TID 0000.0001) F
1039 (PID.TID 0000.0001) ;
1040 (PID.TID 0000.0001) selectCoriMap = /* Coriolis Map options (0,1,2,3)*/
1041 (PID.TID 0000.0001) 2
1042 (PID.TID 0000.0001) 0= f-Plane ; 1= Beta-Plane ; 2= Spherical ; 3= read from file
1043 (PID.TID 0000.0001) ;
1044 (PID.TID 0000.0001) use3dCoriolis = /* 3-D Coriolis on/off flag */
1045 (PID.TID 0000.0001) F
1046 (PID.TID 0000.0001) ;
1047 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
1048 (PID.TID 0000.0001) T
1049 (PID.TID 0000.0001) ;
1050 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
1051 (PID.TID 0000.0001) F
1052 (PID.TID 0000.0001) ;
1053 (PID.TID 0000.0001) useEnergyConservingCoriolis= /* Flx-Form Coriolis scheme flag */
1054 (PID.TID 0000.0001) F
1055 (PID.TID 0000.0001) ;
1056 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
1057 (PID.TID 0000.0001) F
1058 (PID.TID 0000.0001) ;
1059 (PID.TID 0000.0001) useJamartMomAdv= /* V.I Non-linear terms Jamart flag */
1060 (PID.TID 0000.0001) F
1061 (PID.TID 0000.0001) ;
1062 (PID.TID 0000.0001) useAbsVorticity= /* V.I Works with f+zeta in Coriolis */
1063 (PID.TID 0000.0001) F
1064 (PID.TID 0000.0001) ;
1065 (PID.TID 0000.0001) selectVortScheme= /* V.I Scheme selector for Vorticity-Term */
1066 (PID.TID 0000.0001) 1
1067 (PID.TID 0000.0001) = 0 : enstrophy (Shallow-Water Eq.) conserving scheme by Sadourny, JAS 75
1068 (PID.TID 0000.0001) = 1 : same as 0 with modified hFac
1069 (PID.TID 0000.0001) = 2 : energy conserving scheme (used by Sadourny in JAS 75 paper)
1070 (PID.TID 0000.0001) = 3 : energy (general) and enstrophy (2D, nonDiv.) conserving scheme
1071 (PID.TID 0000.0001) from Sadourny (Burridge & Haseler, ECMWF Rep.4, 1977)
1072 (PID.TID 0000.0001) ;
1073 (PID.TID 0000.0001) upwindVorticity= /* V.I Upwind bias vorticity flag */
1074 (PID.TID 0000.0001) F
1075 (PID.TID 0000.0001) ;
1076 (PID.TID 0000.0001) highOrderVorticity= /* V.I High order vort. advect. flag */
1077 (PID.TID 0000.0001) F
1078 (PID.TID 0000.0001) ;
1079 (PID.TID 0000.0001) upwindShear= /* V.I Upwind vertical Shear advection flag */
1080 (PID.TID 0000.0001) F
1081 (PID.TID 0000.0001) ;
1082 (PID.TID 0000.0001) selectKEscheme= /* V.I Kinetic Energy scheme selector */
1083 (PID.TID 0000.0001) 0
1084 (PID.TID 0000.0001) ;
1085 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
1086 (PID.TID 0000.0001) T
1087 (PID.TID 0000.0001) ;
1088 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
1089 (PID.TID 0000.0001) T
1090 (PID.TID 0000.0001) ;
1091 (PID.TID 0000.0001) implicitIntGravWave= /* Implicit Internal Gravity Wave flag */
1092 (PID.TID 0000.0001) F
1093 (PID.TID 0000.0001) ;
1094 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
1095 (PID.TID 0000.0001) T
1096 (PID.TID 0000.0001) ;
1097 (PID.TID 0000.0001) doResetHFactors = /* reset thickness factors @ each time-step */
1098 (PID.TID 0000.0001) F
1099 (PID.TID 0000.0001) ;
1100 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
1101 (PID.TID 0000.0001) T
1102 (PID.TID 0000.0001) ;
1103 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
1104 (PID.TID 0000.0001) F
1105 (PID.TID 0000.0001) ;
1106 (PID.TID 0000.0001) implicitDiffusion = /* Implicit Diffusion on/off flag */
1107 (PID.TID 0000.0001) T
1108 (PID.TID 0000.0001) ;
1109 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
1110 (PID.TID 0000.0001) T
1111 (PID.TID 0000.0001) ;
1112 (PID.TID 0000.0001) tempAdvection = /* Temperature advection on/off flag */
1113 (PID.TID 0000.0001) T
1114 (PID.TID 0000.0001) ;
1115 (PID.TID 0000.0001) tempImplVertAdv = /* Temp. implicit vert. advection on/off */
1116 (PID.TID 0000.0001) F
1117 (PID.TID 0000.0001) ;
1118 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
1119 (PID.TID 0000.0001) T
1120 (PID.TID 0000.0001) ;
1121 (PID.TID 0000.0001) doThetaClimRelax = /* apply SST relaxation on/off flag */
1122 (PID.TID 0000.0001) F
1123 (PID.TID 0000.0001) ;
1124 (PID.TID 0000.0001) tempIsActiveTr = /* Temp. is a dynamically Active Tracer */
1125 (PID.TID 0000.0001) T
1126 (PID.TID 0000.0001) ;
1127 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
1128 (PID.TID 0000.0001) T
1129 (PID.TID 0000.0001) ;
1130 (PID.TID 0000.0001) saltAdvection = /* Salinity advection on/off flag */
1131 (PID.TID 0000.0001) T
1132 (PID.TID 0000.0001) ;
1133 (PID.TID 0000.0001) saltImplVertAdv = /* Sali. implicit vert. advection on/off */
1134 (PID.TID 0000.0001) F
1135 (PID.TID 0000.0001) ;
1136 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
1137 (PID.TID 0000.0001) T
1138 (PID.TID 0000.0001) ;
1139 (PID.TID 0000.0001) doSaltClimRelax = /* apply SSS relaxation on/off flag */
1140 (PID.TID 0000.0001) T
1141 (PID.TID 0000.0001) ;
1142 (PID.TID 0000.0001) saltIsActiveTr = /* Salt is a dynamically Active Tracer */
1143 (PID.TID 0000.0001) T
1144 (PID.TID 0000.0001) ;
1145 (PID.TID 0000.0001) readBinaryPrec = /* Precision used for reading binary files */
1146 (PID.TID 0000.0001) 64
1147 (PID.TID 0000.0001) ;
1148 (PID.TID 0000.0001) writeBinaryPrec = /* Precision used for writing binary files */
1149 (PID.TID 0000.0001) 64
1150 (PID.TID 0000.0001) ;
1151 (PID.TID 0000.0001) globalFiles = /* write "global" (=not per tile) files */
1152 (PID.TID 0000.0001) F
1153 (PID.TID 0000.0001) ;
1154 (PID.TID 0000.0001) useSingleCpuIO = /* only master MPI process does I/O */
1155 (PID.TID 0000.0001) F
1156 (PID.TID 0000.0001) ;
1157 (PID.TID 0000.0001) useSingleCpuInput = /* only master process reads input */
1158 (PID.TID 0000.0001) F
1159 (PID.TID 0000.0001) ;
1160 (PID.TID 0000.0001) /* debLev[*] : level of debug & auxiliary message printing */
1161 (PID.TID 0000.0001) debLevZero = 0 ; /* level of disabled aux. msg printing */
1162 (PID.TID 0000.0001) debLevA = 1 ; /* level of minimum aux. msg printing */
1163 (PID.TID 0000.0001) debLevB = 2 ; /* level of low aux. print (report read-file opening)*/
1164 (PID.TID 0000.0001) debLevC = 3 ; /* level of moderate debug prt (most pkgs debug msg) */
1165 (PID.TID 0000.0001) debLevD = 4 ; /* level of enhanced debug prt (add DEBUG_STATS prt) */
1166 (PID.TID 0000.0001) debLevE = 5 ; /* level of extensive debug printing */
1167 (PID.TID 0000.0001) debugLevel = /* select debug printing level */
1168 (PID.TID 0000.0001) 2
1169 (PID.TID 0000.0001) ;
1170 (PID.TID 0000.0001) //
1171 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
1172 (PID.TID 0000.0001) //
1173 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
1174 (PID.TID 0000.0001) 200
1175 (PID.TID 0000.0001) ;
1176 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
1177 (PID.TID 0000.0001) 1
1178 (PID.TID 0000.0001) ;
1179 (PID.TID 0000.0001) cg2dUseMinResSol= /* use cg2d last-iter(=0) / min-resid.(=1) solution */
1180 (PID.TID 0000.0001) 0
1181 (PID.TID 0000.0001) ;
1182 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
1183 (PID.TID 0000.0001) 1.000000000000000E-09
1184 (PID.TID 0000.0001) ;
1185 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
1186 (PID.TID 0000.0001) -1.000000000000000E+00
1187 (PID.TID 0000.0001) ;
1188 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
1189 (PID.TID 0000.0001) 1
1190 (PID.TID 0000.0001) ;
1191 (PID.TID 0000.0001) useSRCGSolver = /* use single reduction CG solver(s) */
1192 (PID.TID 0000.0001) F
1193 (PID.TID 0000.0001) ;
1194 (PID.TID 0000.0001) printResidualFreq = /* Freq. for printing CG residual */
1195 (PID.TID 0000.0001) 0
1196 (PID.TID 0000.0001) ;
1197 (PID.TID 0000.0001) //
1198 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
1199 (PID.TID 0000.0001) //
1200 (PID.TID 0000.0001) deltaTMom = /* Momentum equation timestep ( s ) */
1201 (PID.TID 0000.0001) 3.600000000000000E+03
1202 (PID.TID 0000.0001) ;
1203 (PID.TID 0000.0001) deltaTFreeSurf = /* FreeSurface equation timestep ( s ) */
1204 (PID.TID 0000.0001) 3.600000000000000E+03
1205 (PID.TID 0000.0001) ;
1206 (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
1207 (PID.TID 0000.0001) 15 @ 3.600000000000000E+03 /* K = 1: 15 */
1208 (PID.TID 0000.0001) ;
1209 (PID.TID 0000.0001) deltaTClock = /* Model clock timestep ( s ) */
1210 (PID.TID 0000.0001) 3.600000000000000E+03
1211 (PID.TID 0000.0001) ;
1212 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1213 (PID.TID 0000.0001) 0.000000000000000E+00
1214 (PID.TID 0000.0001) ;
1215 (PID.TID 0000.0001) momForcingOutAB = /* =1: take Momentum Forcing out of Adams-Bash. stepping */
1216 (PID.TID 0000.0001) 1
1217 (PID.TID 0000.0001) ;
1218 (PID.TID 0000.0001) tracForcingOutAB = /* =1: take T,S,pTr Forcing out of Adams-Bash. stepping */
1219 (PID.TID 0000.0001) 1
1220 (PID.TID 0000.0001) ;
1221 (PID.TID 0000.0001) momDissip_In_AB = /* put Dissipation Tendency in Adams-Bash. stepping */
1222 (PID.TID 0000.0001) T
1223 (PID.TID 0000.0001) ;
1224 (PID.TID 0000.0001) doAB_onGtGs = /* apply AB on Tendencies (rather than on T,S)*/
1225 (PID.TID 0000.0001) T
1226 (PID.TID 0000.0001) ;
1227 (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
1228 (PID.TID 0000.0001) 1.000000000000000E-01
1229 (PID.TID 0000.0001) ;
1230 (PID.TID 0000.0001) pickupStrictlyMatch= /* stop if pickup do not strictly match */
1231 (PID.TID 0000.0001) T
1232 (PID.TID 0000.0001) ;
1233 (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
1234 (PID.TID 0000.0001) 0
1235 (PID.TID 0000.0001) ;
1236 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
1237 (PID.TID 0000.0001) 5
1238 (PID.TID 0000.0001) ;
1239 (PID.TID 0000.0001) nEndIter = /* Run ending timestep number */
1240 (PID.TID 0000.0001) 5
1241 (PID.TID 0000.0001) ;
1242 (PID.TID 0000.0001) baseTime = /* Model base time ( s ) */
1243 (PID.TID 0000.0001) 0.000000000000000E+00
1244 (PID.TID 0000.0001) ;
1245 (PID.TID 0000.0001) startTime = /* Run start time ( s ) */
1246 (PID.TID 0000.0001) 0.000000000000000E+00
1247 (PID.TID 0000.0001) ;
1248 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ) */
1249 (PID.TID 0000.0001) 1.800000000000000E+04
1250 (PID.TID 0000.0001) ;
1251 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/pickup file interval ( s ) */
1252 (PID.TID 0000.0001) 2.592000000000000E+06
1253 (PID.TID 0000.0001) ;
1254 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/pickup file interval ( s ) */
1255 (PID.TID 0000.0001) 0.000000000000000E+00
1256 (PID.TID 0000.0001) ;
1257 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1258 (PID.TID 0000.0001) T
1259 (PID.TID 0000.0001) ;
1260 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1261 (PID.TID 0000.0001) T
1262 (PID.TID 0000.0001) ;
1263 (PID.TID 0000.0001) pickup_write_mnc = /* Model IO flag. */
1264 (PID.TID 0000.0001) F
1265 (PID.TID 0000.0001) ;
1266 (PID.TID 0000.0001) pickup_read_mnc = /* Model IO flag. */
1267 (PID.TID 0000.0001) F
1268 (PID.TID 0000.0001) ;
1269 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1270 (PID.TID 0000.0001) F
1271 (PID.TID 0000.0001) ;
1272 (PID.TID 0000.0001) writePickupAtEnd = /* Model IO flag. */
1273 (PID.TID 0000.0001) T
1274 (PID.TID 0000.0001) ;
1275 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1276 (PID.TID 0000.0001) 8.640000000000000E+05
1277 (PID.TID 0000.0001) ;
1278 (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1279 (PID.TID 0000.0001) T
1280 (PID.TID 0000.0001) ;
1281 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1282 (PID.TID 0000.0001) T
1283 (PID.TID 0000.0001) ;
1284 (PID.TID 0000.0001) snapshot_mnc = /* Model IO flag. */
1285 (PID.TID 0000.0001) F
1286 (PID.TID 0000.0001) ;
1287 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1288 (PID.TID 0000.0001) 1.000000000000000E+00
1289 (PID.TID 0000.0001) ;
1290 (PID.TID 0000.0001) monitorSelect = /* select group of variables to monitor */
1291 (PID.TID 0000.0001) 3
1292 (PID.TID 0000.0001) ;
1293 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1294 (PID.TID 0000.0001) T
1295 (PID.TID 0000.0001) ;
1296 (PID.TID 0000.0001) monitor_mnc = /* Model IO flag. */
1297 (PID.TID 0000.0001) F
1298 (PID.TID 0000.0001) ;
1299 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1300 (PID.TID 0000.0001) 2.592000000000000E+06
1301 (PID.TID 0000.0001) ;
1302 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1303 (PID.TID 0000.0001) 3.110400000000000E+07
1304 (PID.TID 0000.0001) ;
1305 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1306 (PID.TID 0000.0001) 0.000000000000000E+00
1307 (PID.TID 0000.0001) ;
1308 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1309 (PID.TID 0000.0001) 6.220800000000000E+08
1310 (PID.TID 0000.0001) ;
1311 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1312 (PID.TID 0000.0001) 1.800000000000000E+02
1313 (PID.TID 0000.0001) ;
1314 (PID.TID 0000.0001) //
1315 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1316 (PID.TID 0000.0001) //
1317 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True/False ) */
1318 (PID.TID 0000.0001) F
1319 (PID.TID 0000.0001) ;
1320 (PID.TID 0000.0001) usingCylindricalGrid = /* Cylindrical coordinates flag ( True/False ) */
1321 (PID.TID 0000.0001) F
1322 (PID.TID 0000.0001) ;
1323 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True/False ) */
1324 (PID.TID 0000.0001) F
1325 (PID.TID 0000.0001) ;
1326 (PID.TID 0000.0001) usingCurvilinearGrid = /* Curvilinear coordinates flag ( True/False ) */
1327 (PID.TID 0000.0001) T
1328 (PID.TID 0000.0001) ;
1329 (PID.TID 0000.0001) selectSigmaCoord = /* Hybrid-Sigma Vert. Coordinate option */
1330 (PID.TID 0000.0001) 0
1331 (PID.TID 0000.0001) ;
1332 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r == m ) */
1333 (PID.TID 0000.0001) 0.000000000000000E+00
1334 (PID.TID 0000.0001) ;
1335 (PID.TID 0000.0001) rSigmaBnd = /* r/sigma transition ( units of r == m ) */
1336 (PID.TID 0000.0001) 1.234567000000000E+05
1337 (PID.TID 0000.0001) ;
1338 (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1339 (PID.TID 0000.0001) -1.000000000000000E+00
1340 (PID.TID 0000.0001) ;
1341 (PID.TID 0000.0001) gravitySign = /* gravity orientation relative to vertical coordinate */
1342 (PID.TID 0000.0001) -1.000000000000000E+00
1343 (PID.TID 0000.0001) ;
1344 (PID.TID 0000.0001) mass2rUnit = /* convert mass per unit area [kg/m2] to r-units [m] */
1345 (PID.TID 0000.0001) 9.708737864077669E-04
1346 (PID.TID 0000.0001) ;
1347 (PID.TID 0000.0001) rUnit2mass = /* convert r-units [m] to mass per unit area [kg/m2] */
1348 (PID.TID 0000.0001) 1.030000000000000E+03
1349 (PID.TID 0000.0001) ;
1350 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1351 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1352 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1353 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1354 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1355 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1356 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1357 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1358 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1359 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1360 (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1361 (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1362 (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1363 (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1364 (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1365 (PID.TID 0000.0001) 6.650000000000000E+02, /* K = 15 */
1366 (PID.TID 0000.0001) 3.450000000000000E+02 /* K = 16 */
1367 (PID.TID 0000.0001) ;
1368 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1369 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1370 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1371 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1372 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1373 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1374 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1375 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1376 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1377 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1378 (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1379 (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1380 (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1381 (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1382 (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1383 (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1384 (PID.TID 0000.0001) ;
1385 (PID.TID 0000.0001) radius_fromHorizGrid = /* sphere Radius of input horiz. grid */
1386 (PID.TID 0000.0001) 6.370000000000000E+06
1387 (PID.TID 0000.0001) ;
1388 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1389 (PID.TID 0000.0001) 6.370000000000000E+06
1390 (PID.TID 0000.0001) ;
1391 (PID.TID 0000.0001) deepAtmosphere = /* Deep/Shallow Atmosphere flag (True/False) */
1392 (PID.TID 0000.0001) F
1393 (PID.TID 0000.0001) ;
1394 (PID.TID 0000.0001) xC = /* xC(:,1,:,1) : P-point X coord ( deg. or m if cartesian) */
1395 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1396 (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1397 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1398 (PID.TID 0000.0001) . . .
1399 (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1400 (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1401 (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1402 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1403 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1404 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1405 (PID.TID 0000.0001) . . .
1406 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1407 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1408 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1409 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1410 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1411 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1412 (PID.TID 0000.0001) . . .
1413 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1414 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1415 (PID.TID 0000.0001) -1.336449032499283E+02, /* I =144 */
1416 (PID.TID 0000.0001) -1.336449032499283E+02, /* I =145 */
1417 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1418 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1419 (PID.TID 0000.0001) . . .
1420 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1421 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1422 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1423 (PID.TID 0000.0001) ;
1424 (PID.TID 0000.0001) yC = /* yC(1,:,1,:) : P-point Y coord ( deg. or m if cartesian) */
1425 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1426 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1427 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1428 (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1429 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1430 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1431 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1432 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1433 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1434 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1435 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1436 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1437 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1438 (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1439 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1440 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1441 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1442 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1443 (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1444 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1445 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1446 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1447 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1448 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1449 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1450 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1451 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1452 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1453 (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1454 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1455 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1456 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1457 (PID.TID 0000.0001) ;
1458 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1459 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1460 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1461 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1462 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1463 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1464 (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1465 (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1466 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1467 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1468 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1469 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1470 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1471 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1472 (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1473 (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1474 (PID.TID 0000.0001) ;
1475 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1476 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1477 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1478 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1479 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1480 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1481 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1482 (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1483 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1484 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1485 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1486 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1487 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1488 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1489 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1490 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1491 (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1492 (PID.TID 0000.0001) ;
1493 (PID.TID 0000.0001) deepFacC = /* deep-model grid factor @ cell-Center (-) */
1494 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1495 (PID.TID 0000.0001) ;
1496 (PID.TID 0000.0001) deepFacF = /* deep-model grid factor @ W-Interface (-) */
1497 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1498 (PID.TID 0000.0001) ;
1499 (PID.TID 0000.0001) rVel2wUnit = /* convert units: rVel -> wSpeed (=1 if z-coord)*/
1500 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1501 (PID.TID 0000.0001) ;
1502 (PID.TID 0000.0001) wUnit2rVel = /* convert units: wSpeed -> rVel (=1 if z-coord)*/
1503 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1504 (PID.TID 0000.0001) ;
1505 (PID.TID 0000.0001) dBdrRef = /* Vertical grad. of reference buoyancy [(m/s/r)^2] */
1506 (PID.TID 0000.0001) 15 @ 0.000000000000000E+00 /* K = 1: 15 */
1507 (PID.TID 0000.0001) ;
1508 (PID.TID 0000.0001) rotateGrid = /* use rotated grid ( True/False ) */
1509 (PID.TID 0000.0001) F
1510 (PID.TID 0000.0001) ;
1511 (PID.TID 0000.0001) phiEuler = /* Euler angle, rotation about original z-coordinate [rad] */
1512 (PID.TID 0000.0001) 0.000000000000000E+00
1513 (PID.TID 0000.0001) ;
1514 (PID.TID 0000.0001) thetaEuler = /* Euler angle, rotation about new x-coordinate [rad] */
1515 (PID.TID 0000.0001) 0.000000000000000E+00
1516 (PID.TID 0000.0001) ;
1517 (PID.TID 0000.0001) psiEuler = /* Euler angle, rotation about new z-coordinate [rad] */
1518 (PID.TID 0000.0001) 0.000000000000000E+00
1519 (PID.TID 0000.0001) ;
1520 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( units: m ) */
1521 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1522 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1523 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1524 (PID.TID 0000.0001) . . .
1525 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1526 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1527 (PID.TID 0000.0001) 3.012190981969055E+05, /* I = 48 */
1528 (PID.TID 0000.0001) 3.012190981969055E+05, /* I = 49 */
1529 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1530 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1531 (PID.TID 0000.0001) . . .
1532 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1533 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1534 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 96 */
1535 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 97 */
1536 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1537 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1538 (PID.TID 0000.0001) . . .
1539 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
1540 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
1541 (PID.TID 0000.0001) 3.012190981969055E+05, /* I =144 */
1542 (PID.TID 0000.0001) 3.012190981969055E+05, /* I =145 */
1543 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
1544 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
1545 (PID.TID 0000.0001) . . .
1546 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
1547 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
1548 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1549 (PID.TID 0000.0001) ;
1550 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( units: m ) */
1551 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1552 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
1553 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
1554 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
1555 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
1556 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
1557 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
1558 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
1559 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
1560 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
1561 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
1562 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
1563 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
1564 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
1565 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
1566 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
1567 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
1568 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
1569 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
1570 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
1571 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
1572 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
1573 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
1574 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
1575 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
1576 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
1577 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
1578 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
1579 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
1580 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
1581 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1582 (PID.TID 0000.0001) ;
1583 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( units: m ) */
1584 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1585 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
1586 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
1587 (PID.TID 0000.0001) . . .
1588 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
1589 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
1590 (PID.TID 0000.0001) 3.012844832048790E+05, /* I = 48 */
1591 (PID.TID 0000.0001) 3.012844832048790E+05, /* I = 49 */
1592 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
1593 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
1594 (PID.TID 0000.0001) . . .
1595 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
1596 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
1597 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 96 */
1598 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 97 */
1599 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
1600 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
1601 (PID.TID 0000.0001) . . .
1602 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
1603 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
1604 (PID.TID 0000.0001) 3.012844832048790E+05, /* I =144 */
1605 (PID.TID 0000.0001) 3.012844832048790E+05, /* I =145 */
1606 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
1607 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
1608 (PID.TID 0000.0001) . . .
1609 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
1610 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
1611 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1612 (PID.TID 0000.0001) ;
1613 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( units: m ) */
1614 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1615 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
1616 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
1617 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
1618 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
1619 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
1620 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
1621 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
1622 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
1623 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
1624 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
1625 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
1626 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
1627 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
1628 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
1629 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
1630 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
1631 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
1632 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
1633 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
1634 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
1635 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
1636 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
1637 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
1638 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
1639 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
1640 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
1641 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
1642 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
1643 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
1644 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1645 (PID.TID 0000.0001) ;
1646 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( units: m ) */
1647 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1648 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
1649 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
1650 (PID.TID 0000.0001) . . .
1651 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
1652 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
1653 (PID.TID 0000.0001) 3.011625828699101E+05, /* I = 48 */
1654 (PID.TID 0000.0001) 3.011625828699101E+05, /* I = 49 */
1655 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
1656 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
1657 (PID.TID 0000.0001) . . .
1658 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
1659 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
1660 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 96 */
1661 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
1662 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
1663 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
1664 (PID.TID 0000.0001) . . .
1665 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
1666 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
1667 (PID.TID 0000.0001) 3.011625828699101E+05, /* I =144 */
1668 (PID.TID 0000.0001) 3.011625828699101E+05, /* I =145 */
1669 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
1670 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
1671 (PID.TID 0000.0001) . . .
1672 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
1673 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
1674 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
1675 (PID.TID 0000.0001) ;
1676 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( units: m ) */
1677 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
1678 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
1679 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
1680 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
1681 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
1682 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
1683 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
1684 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
1685 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
1686 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
1687 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
1688 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
1689 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
1690 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
1691 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
1692 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
1693 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
1694 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
1695 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
1696 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
1697 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
1698 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
1699 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
1700 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
1701 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
1702 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
1703 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
1704 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
1705 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
1706 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
1707 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
1708 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
1709 (PID.TID 0000.0001) ;
1710 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( units: m ) */
1711 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1712 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
1713 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
1714 (PID.TID 0000.0001) . . .
1715 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
1716 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
1717 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
1718 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
1719 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
1720 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
1721 (PID.TID 0000.0001) . . .
1722 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
1723 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
1724 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
1725 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
1726 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
1727 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
1728 (PID.TID 0000.0001) . . .
1729 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
1730 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
1731 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
1732 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
1733 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
1734 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
1735 (PID.TID 0000.0001) . . .
1736 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
1737 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
1738 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
1739 (PID.TID 0000.0001) ;
1740 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( units: m ) */
1741 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
1742 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
1743 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
1744 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
1745 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
1746 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
1747 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
1748 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
1749 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
1750 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
1751 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
1752 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
1753 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
1754 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
1755 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
1756 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
1757 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
1758 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
1759 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
1760 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
1761 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
1762 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
1763 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
1764 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
1765 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
1766 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
1767 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
1768 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
1769 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
1770 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
1771 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
1772 (PID.TID 0000.0001) ;
1773 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( units: m ) */
1774 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
1775 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
1776 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
1777 (PID.TID 0000.0001) . . .
1778 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
1779 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
1780 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
1781 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
1782 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
1783 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
1784 (PID.TID 0000.0001) . . .
1785 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
1786 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
1787 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
1788 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
1789 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
1790 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
1791 (PID.TID 0000.0001) . . .
1792 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
1793 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
1794 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
1795 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
1796 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
1797 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
1798 (PID.TID 0000.0001) . . .
1799 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
1800 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
1801 (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
1802 (PID.TID 0000.0001) ;
1803 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( units: m ) */
1804 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
1805 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
1806 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
1807 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
1808 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
1809 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
1810 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
1811 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
1812 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
1813 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
1814 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
1815 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
1816 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
1817 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
1818 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
1819 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
1820 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
1821 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
1822 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
1823 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
1824 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
1825 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
1826 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
1827 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
1828 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
1829 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
1830 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
1831 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
1832 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
1833 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
1834 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
1835 (PID.TID 0000.0001) ;
1836 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( units: m ) */
1837 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
1838 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
1839 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
1840 (PID.TID 0000.0001) . . .
1841 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
1842 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
1843 (PID.TID 0000.0001) 3.012281885409289E+05, /* I = 48 */
1844 (PID.TID 0000.0001) 3.012281885409289E+05, /* I = 49 */
1845 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
1846 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
1847 (PID.TID 0000.0001) . . .
1848 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
1849 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
1850 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 96 */
1851 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
1852 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
1853 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
1854 (PID.TID 0000.0001) . . .
1855 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
1856 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
1857 (PID.TID 0000.0001) 3.012281885409289E+05, /* I =144 */
1858 (PID.TID 0000.0001) 3.012281885409289E+05, /* I =145 */
1859 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
1860 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
1861 (PID.TID 0000.0001) . . .
1862 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
1863 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
1864 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
1865 (PID.TID 0000.0001) ;
1866 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( units: m ) */
1867 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
1868 (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
1869 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
1870 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
1871 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
1872 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
1873 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
1874 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
1875 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
1876 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
1877 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
1878 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
1879 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
1880 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
1881 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
1882 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
1883 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
1884 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
1885 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
1886 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
1887 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
1888 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
1889 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
1890 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
1891 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
1892 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
1893 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
1894 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
1895 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
1896 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
1897 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
1898 (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
1899 (PID.TID 0000.0001) ;
1900 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( units: m ) */
1901 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
1902 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
1903 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
1904 (PID.TID 0000.0001) . . .
1905 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
1906 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
1907 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
1908 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
1909 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
1910 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
1911 (PID.TID 0000.0001) . . .
1912 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
1913 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
1914 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
1915 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
1916 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
1917 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
1918 (PID.TID 0000.0001) . . .
1919 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
1920 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
1921 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
1922 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
1923 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
1924 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
1925 (PID.TID 0000.0001) . . .
1926 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
1927 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
1928 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
1929 (PID.TID 0000.0001) ;
1930 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( units: m ) */
1931 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
1932 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
1933 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
1934 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
1935 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
1936 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
1937 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
1938 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
1939 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
1940 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
1941 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
1942 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
1943 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
1944 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
1945 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
1946 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
1947 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
1948 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
1949 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
1950 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
1951 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
1952 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
1953 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
1954 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
1955 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
1956 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
1957 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
1958 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
1959 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
1960 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
1961 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
1962 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
1963 (PID.TID 0000.0001) ;
1964 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( units: m ) */
1965 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
1966 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
1967 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
1968 (PID.TID 0000.0001) . . .
1969 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
1970 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
1971 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
1972 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
1973 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
1974 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
1975 (PID.TID 0000.0001) . . .
1976 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
1977 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
1978 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
1979 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
1980 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
1981 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
1982 (PID.TID 0000.0001) . . .
1983 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
1984 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
1985 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
1986 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
1987 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
1988 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
1989 (PID.TID 0000.0001) . . .
1990 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
1991 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
1992 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
1993 (PID.TID 0000.0001) ;
1994 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( units: m ) */
1995 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
1996 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
1997 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
1998 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 4 */
1999 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
2000 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
2001 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 7 */
2002 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
2003 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
2004 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 10 */
2005 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
2006 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
2007 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
2008 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
2009 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
2010 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
2011 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
2012 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
2013 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
2014 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
2015 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
2016 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
2017 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
2018 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 24 */
2019 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
2020 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
2021 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 27 */
2022 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
2023 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
2024 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 30 */
2025 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
2026 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
2027 (PID.TID 0000.0001) ;
2028 (PID.TID 0000.0001) rA = /* rA (:,1,:,1) ( units: m^2 ) */
2029 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
2030 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
2031 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
2032 (PID.TID 0000.0001) . . .
2033 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 46 */
2034 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 47 */
2035 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 48 */
2036 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 49 */
2037 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
2038 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 51 */
2039 (PID.TID 0000.0001) . . .
2040 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
2041 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
2042 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
2043 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
2044 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
2045 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
2046 (PID.TID 0000.0001) . . .
2047 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =142 */
2048 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =143 */
2049 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =144 */
2050 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =145 */
2051 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
2052 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =147 */
2053 (PID.TID 0000.0001) . . .
2054 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
2055 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
2056 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
2057 (PID.TID 0000.0001) ;
2058 (PID.TID 0000.0001) rA = /* rA (1,:,1,:) ( units: m^2 ) */
2059 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
2060 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
2061 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
2062 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
2063 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
2064 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 6 */
2065 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
2066 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
2067 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
2068 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
2069 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 11 */
2070 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 12 */
2071 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
2072 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 14 */
2073 (PID.TID 0000.0001) 9.008620045350865E+10, /* J = 15 */
2074 (PID.TID 0000.0001) 9.076111290418457E+10, /* J = 16 */
2075 (PID.TID 0000.0001) 9.076111290422060E+10, /* J = 17 */
2076 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
2077 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 19 */
2078 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
2079 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 21 */
2080 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 22 */
2081 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
2082 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
2083 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
2084 (PID.TID 0000.0001) 6.203683527772523E+10, /* J = 26 */
2085 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 27 */
2086 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
2087 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
2088 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
2089 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
2090 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
2091 (PID.TID 0000.0001) ;
2092 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( units: m^2 ) */
2093 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
2094 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
2095 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
2096 (PID.TID 0000.0001) . . .
2097 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
2098 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 47 */
2099 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
2100 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
2101 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 50 */
2102 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
2103 (PID.TID 0000.0001) . . .
2104 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
2105 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
2106 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
2107 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
2108 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
2109 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
2110 (PID.TID 0000.0001) . . .
2111 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
2112 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =143 */
2113 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
2114 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
2115 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =146 */
2116 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
2117 (PID.TID 0000.0001) . . .
2118 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
2119 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
2120 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
2121 (PID.TID 0000.0001) ;
2122 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( units: m^2 ) */
2123 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
2124 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
2125 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
2126 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
2127 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 5 */
2128 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 6 */
2129 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 7 */
2130 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
2131 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 9 */
2132 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
2133 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 11 */
2134 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
2135 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 13 */
2136 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 14 */
2137 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
2138 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* J = 16: 17 */
2139 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
2140 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 19 */
2141 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 20 */
2142 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
2143 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 22 */
2144 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
2145 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 24 */
2146 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
2147 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 26 */
2148 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 27 */
2149 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 28 */
2150 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
2151 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
2152 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
2153 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
2154 (PID.TID 0000.0001) ;
2155 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( units: m^2 ) */
2156 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
2157 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
2158 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
2159 (PID.TID 0000.0001) . . .
2160 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 46 */
2161 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
2162 (PID.TID 0000.0001) 9.071447638299399E+10, /* I = 48 */
2163 (PID.TID 0000.0001) 9.071447638299399E+10, /* I = 49 */
2164 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
2165 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 51 */
2166 (PID.TID 0000.0001) . . .
2167 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
2168 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
2169 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 96 */
2170 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
2171 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
2172 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
2173 (PID.TID 0000.0001) . . .
2174 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =142 */
2175 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
2176 (PID.TID 0000.0001) 9.071447638299399E+10, /* I =144 */
2177 (PID.TID 0000.0001) 9.071447638299399E+10, /* I =145 */
2178 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
2179 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =147 */
2180 (PID.TID 0000.0001) . . .
2181 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
2182 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
2183 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
2184 (PID.TID 0000.0001) ;
2185 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( units: m^2 ) */
2186 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
2187 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
2188 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
2189 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
2190 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
2191 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
2192 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 7 */
2193 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 8 */
2194 (PID.TID 0000.0001) 7.014205907741882E+10, /* J = 9 */
2195 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
2196 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
2197 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
2198 (PID.TID 0000.0001) 8.549360686473492E+10, /* J = 13 */
2199 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
2200 (PID.TID 0000.0001) 8.948571540392021E+10, /* J = 15 */
2201 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
2202 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
2203 (PID.TID 0000.0001) 9.049530583087070E+10, /* J = 18 */
2204 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
2205 (PID.TID 0000.0001) 8.781353403174185E+10, /* J = 20 */
2206 (PID.TID 0000.0001) 8.549360686467184E+10, /* J = 21 */
2207 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
2208 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
2209 (PID.TID 0000.0001) 7.484854821844795E+10, /* J = 24 */
2210 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
2211 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 26 */
2212 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 27 */
2213 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
2214 (PID.TID 0000.0001) 4.571243814190767E+10, /* J = 29 */
2215 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
2216 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
2217 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
2218 (PID.TID 0000.0001) ;
2219 (PID.TID 0000.0001) globalArea = /* Integrated horizontal Area (m^2) */
2220 (PID.TID 0000.0001) 3.638867375081598E+14
2221 (PID.TID 0000.0001) ;
2222 (PID.TID 0000.0001) hasWetCSCorners = /* Domain contains CS corners (True/False) */
2223 (PID.TID 0000.0001) T
2224 (PID.TID 0000.0001) ;
2225 (PID.TID 0000.0001) // =======================================================
2226 (PID.TID 0000.0001) // End of Model config. summary
2227 (PID.TID 0000.0001) // =======================================================
2228 (PID.TID 0000.0001)
2229 (PID.TID 0000.0001) == Packages configuration : Check & print summary ==
2230 (PID.TID 0000.0001)
2231 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
2232 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
2233 (PID.TID 0000.0001) F
2234 (PID.TID 0000.0001) ;
2235 (PID.TID 0000.0001) GM_InMomAsStress = /* if TRUE => apply as Eddy Stress */
2236 (PID.TID 0000.0001) F
2237 (PID.TID 0000.0001) ;
2238 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
2239 (PID.TID 0000.0001) F
2240 (PID.TID 0000.0001) ;
2241 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
2242 (PID.TID 0000.0001) F
2243 (PID.TID 0000.0001) ;
2244 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity [m^2/s] */
2245 (PID.TID 0000.0001) 8.000000000000000E+02
2246 (PID.TID 0000.0001) ;
2247 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity [m^2/s] */
2248 (PID.TID 0000.0001) 8.000000000000000E+02
2249 (PID.TID 0000.0001) ;
2250 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity [m^2/s]*/
2251 (PID.TID 0000.0001) 0.000000000000000E+00
2252 (PID.TID 0000.0001) ;
2253 (PID.TID 0000.0001) GM_Kmin_horiz = /* Minimum Horizontal Diffusivity [m^2/s] */
2254 (PID.TID 0000.0001) 5.000000000000000E+01
2255 (PID.TID 0000.0001) ;
2256 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. [-] */
2257 (PID.TID 0000.0001) 0.000000000000000E+00
2258 (PID.TID 0000.0001) ;
2259 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
2260 (PID.TID 0000.0001) 9.999999999999999E-21
2261 (PID.TID 0000.0001) ;
2262 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
2263 (PID.TID 0000.0001) 1.000000000000000E+48
2264 (PID.TID 0000.0001) ;
2265 (PID.TID 0000.0001) GM_taper_scheme = /* Type of Tapering/Clipping scheme */
2266 (PID.TID 0000.0001) 'gkw91 '
2267 (PID.TID 0000.0001) ;
2268 (PID.TID 0000.0001) GM_maxSlope = /* Maximum Slope (Tapering/Clipping) */
2269 (PID.TID 0000.0001) 1.000000000000000E-02
2270 (PID.TID 0000.0001) ;
2271 (PID.TID 0000.0001) GM_facTrL2dz = /* Minimum Trans.Layer Thick. (factor of dz) */
2272 (PID.TID 0000.0001) 1.000000000000000E+00
2273 (PID.TID 0000.0001) ;
2274 (PID.TID 0000.0001) GM_facTrL2ML = /* Max.Trans.Layer Thick. (factor of MxL Depth)*/
2275 (PID.TID 0000.0001) 5.000000000000000E+00
2276 (PID.TID 0000.0001) ;
2277 (PID.TID 0000.0001) GM_maxTransLay = /* Maximum Transition Layer Thickness [m] */
2278 (PID.TID 0000.0001) 5.000000000000000E+02
2279 (PID.TID 0000.0001) ;
2280 (PID.TID 0000.0001) GM_UseBVP = /* if TRUE => use bvp a la Ferrari et al. (2010) */
2281 (PID.TID 0000.0001) F
2282 (PID.TID 0000.0001) ;
2283 (PID.TID 0000.0001) GM_BVP_ModeNumber = /* Vertical mode number for BVP wave speed */
2284 (PID.TID 0000.0001) 1
2285 (PID.TID 0000.0001) ;
2286 (PID.TID 0000.0001) GM_BVP_cMin = /* Minimum wave speed for BVP [m/s] */
2287 (PID.TID 0000.0001) 1.000000000000000E-01
2288 (PID.TID 0000.0001) ;
2289 (PID.TID 0000.0001) GM_useSubMeso = /* if TRUE => use Sub-Meso param. (B.Fox-Kemper) */
2290 (PID.TID 0000.0001) F
2291 (PID.TID 0000.0001) ;
2292 (PID.TID 0000.0001) subMeso_Ceff = /* efficiency coeff. of Mixed-Layer Eddies [-] */
2293 (PID.TID 0000.0001) 7.000000000000001E-02
2294 (PID.TID 0000.0001) ;
2295 (PID.TID 0000.0001) subMeso_invTau = /* inverse of Sub-Meso mixing time-scale [/s] */
2296 (PID.TID 0000.0001) 2.000000000000000E-06
2297 (PID.TID 0000.0001) ;
2298 (PID.TID 0000.0001) subMeso_LfMin = /* minimum length-scale "Lf" [m] */
2299 (PID.TID 0000.0001) 1.000000000000000E+03
2300 (PID.TID 0000.0001) ;
2301 (PID.TID 0000.0001) subMeso_Lmax = /* maximum grid-scale length [m] */
2302 (PID.TID 0000.0001) 1.100000000000000E+05
2303 (PID.TID 0000.0001) ;
2304 (PID.TID 0000.0001) GAD_CHECK: #define ALLOW_GENERIC_ADVDIFF
2305 (PID.TID 0000.0001) // =======================================================
2306 (PID.TID 0000.0001) // Check Model config. (CONFIG_CHECK):
2307 (PID.TID 0000.0001) // CONFIG_CHECK : Normal End
2308 (PID.TID 0000.0001) // =======================================================
2309 (PID.TID 0000.0001)
2310 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_T_cs_15k.bin
2311 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_S_cs_15k.bin
2312 (PID.TID 0000.0001) Start initial hydrostatic pressure computation
2313 (PID.TID 0000.0001) Pressure is predetermined for buoyancyRelation OCEANIC
2314 (PID.TID 0000.0001)
2315 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
2316 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
2317 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
2318 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
2319 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
2320 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
2321 (PID.TID 0000.0001) write diagnostics summary to file ioUnit: 6
2322 Iter.Nb: 0 ; Time(s): 0.0000000000000E+00
2323 ------------------------------------------------------------------------
2324 2D/3D diagnostics: Number of lists: 2
2325 ------------------------------------------------------------------------
2326 listId= 1 ; file name: surfDiag
2327 nFlds, nActive, freq & phase , nLev
2328 10 | 10 | 31104000.000000 0.000000 | 1
2329 levels: 1
2330 diag# | name | ipt | iMate | kLev| count | mate.C|
2331 23 |ETAN | 1 | 0 | 1 | 0 |
2332 24 |ETANSQ | 2 | 0 | 1 | 0 |
2333 25 |DETADT2 | 3 | 0 | 1 | 0 |
2334 73 |PHIBOT | 4 | 0 | 1 | 0 |
2335 74 |PHIBOTSQ| 5 | 0 | 1 | 0 |
2336 79 |oceTAUX | 6 | 7 | 1 | 0 | 0 |
2337 80 |oceTAUY | 7 | 6 | 1 | 0 | 0 |
2338 92 |TFLUX | 8 | 0 | 1 | 0 |
2339 93 |SFLUX | 9 | 0 | 1 | 0 |
2340 89 |SRELAX | 10 | 0 | 1 | 0 |
2341 ------------------------------------------------------------------------
2342 listId= 2 ; file name: dynDiag
2343 nFlds, nActive, freq & phase , nLev
2344 15 | 15 | 31104000.000000 0.000000 | 15
2345 levels: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
2346 diag# | name | ipt | iMate | kLev| count | mate.C|
2347 30 |UVEL | 11 | 26 | 15 | 0 | 0 |
2348 31 |VVEL | 26 | 11 | 15 | 0 | 0 |
2349 32 |WVEL | 41 | 0 | 15 | 0 |
2350 71 |PHIHYD | 56 | 0 | 15 | 0 |
2351 46 |VVELMASS| 71 | 86 | 15 | 0 | 0 |
2352 45 |UVELMASS| 86 | 71 | 15 | 0 | 0 |
2353 38 |WVELSQ | 101 | 0 | 15 | 0 |
2354 26 |THETA | 116 | 0 | 15 | 0 |
2355 50 |UTHMASS | 131 | 146 | 15 | 0 | 0 |
2356 51 |VTHMASS | 146 | 131 | 15 | 0 | 0 |
2357 52 |WTHMASS | 161 | 0 | 15 | 0 |
2358 27 |SALT | 176 | 0 | 15 | 0 |
2359 53 |USLTMASS| 191 | 206 | 15 | 0 | 0 |
2360 54 |VSLTMASS| 206 | 191 | 15 | 0 | 0 |
2361 55 |WSLTMASS| 221 | 0 | 15 | 0 |
2362 ------------------------------------------------------------------------
2363 Global & Regional Statistics diagnostics: Number of lists: 1
2364 ------------------------------------------------------------------------
2365 listId= 1 ; file name: dynStDiag
2366 nFlds, nActive, freq & phase |
2367 16 | 16 | 18000.000000 0.000000 |
2368 Regions: 0
2369 diag# | name | ipt | iMate | Volume | mate-Vol. |
2370 23 |ETAN | 1 | 0 | 0.00000E+00 |
2371 25 |DETADT2 | 2 | 0 | 0.00000E+00 |
2372 26 |THETA | 3 | 0 | 0.00000E+00 |
2373 27 |SALT | 18 | 0 | 0.00000E+00 |
2374 78 |CONVADJ | 33 | 0 | 0.00000E+00 |
2375 77 |DRHODR | 48 | 0 | 0.00000E+00 |
2376 39 |UE_VEL_C| 63 | 0 | 0.00000E+00 |
2377 40 |VN_VEL_C| 78 | 0 | 0.00000E+00 |
2378 32 |WVEL | 93 | 0 | 0.00000E+00 |
2379 79 |oceTAUX | 108 | 0 | 0.00000E+00 |
2380 80 |oceTAUY | 109 | 0 | 0.00000E+00 |
2381 83 |oceFWflx| 110 | 0 | 0.00000E+00 |
2382 85 |oceQnet | 111 | 0 | 0.00000E+00 |
2383 89 |SRELAX | 112 | 0 | 0.00000E+00 |
2384 84 |oceSflux| 113 | 0 | 0.00000E+00 |
2385 82 |sIceLoad| 114 | 0 | 0.00000E+00 |
2386 ------------------------------------------------------------------------
2387 (PID.TID 0000.0001) // =======================================================
2388 (PID.TID 0000.0001) // Model current state
2389 (PID.TID 0000.0001) // =======================================================
2390 (PID.TID 0000.0001)
2391 (PID.TID 0000.0001) // =======================================================
2392 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2393 (PID.TID 0000.0001) // =======================================================
2394 (PID.TID 0000.0001) %MON time_tsnumber = 0
2395 (PID.TID 0000.0001) %MON time_secondsf = 0.0000000000000E+00
2396 (PID.TID 0000.0001) %MON dynstat_eta_max = 0.0000000000000E+00
2397 (PID.TID 0000.0001) %MON dynstat_eta_min = 0.0000000000000E+00
2398 (PID.TID 0000.0001) %MON dynstat_eta_mean = 0.0000000000000E+00
2399 (PID.TID 0000.0001) %MON dynstat_eta_sd = 0.0000000000000E+00
2400 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 0.0000000000000E+00
2401 (PID.TID 0000.0001) %MON dynstat_uvel_max = 0.0000000000000E+00
2402 (PID.TID 0000.0001) %MON dynstat_uvel_min = 0.0000000000000E+00
2403 (PID.TID 0000.0001) %MON dynstat_uvel_mean = 0.0000000000000E+00
2404 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 0.0000000000000E+00
2405 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 0.0000000000000E+00
2406 (PID.TID 0000.0001) %MON dynstat_vvel_max = 0.0000000000000E+00
2407 (PID.TID 0000.0001) %MON dynstat_vvel_min = 0.0000000000000E+00
2408 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 0.0000000000000E+00
2409 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 0.0000000000000E+00
2410 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 0.0000000000000E+00
2411 (PID.TID 0000.0001) %MON dynstat_wvel_max = 0.0000000000000E+00
2412 (PID.TID 0000.0001) %MON dynstat_wvel_min = 0.0000000000000E+00
2413 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 0.0000000000000E+00
2414 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 0.0000000000000E+00
2415 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 0.0000000000000E+00
2416 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382676376985E+01
2417 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8552983134796E+00
2418 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030349459887E+00
2419 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406771433446E+00
2420 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1326598561892E-03
2421 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715748807407E+01
2422 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144841495627E+01
2423 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721451128586E+01
2424 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858744433685E-01
2425 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1558447735922E-04
2426 (PID.TID 0000.0001) %MON forcing_qnet_max = 4.6211611868841E+02
2427 (PID.TID 0000.0001) %MON forcing_qnet_min = -2.0410376912710E+02
2428 (PID.TID 0000.0001) %MON forcing_qnet_mean = -1.2329247921290E+01
2429 (PID.TID 0000.0001) %MON forcing_qnet_sd = 1.1327998988989E+02
2430 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 4.4323506322358E-01
2431 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2432 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2433 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2434 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2435 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2436 (PID.TID 0000.0001) %MON forcing_empmr_max = 7.6494447208479E-05
2437 (PID.TID 0000.0001) %MON forcing_empmr_min = -1.5362614137596E-04
2438 (PID.TID 0000.0001) %MON forcing_empmr_mean = 4.1932798010144E-22
2439 (PID.TID 0000.0001) %MON forcing_empmr_sd = 2.4051723601802E-05
2440 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 1.2276157049243E-07
2441 (PID.TID 0000.0001) %MON forcing_fu_max = 2.4892781143428E-01
2442 (PID.TID 0000.0001) %MON forcing_fu_min = -2.5159107438040E-01
2443 (PID.TID 0000.0001) %MON forcing_fu_mean = -3.8956966288612E-03
2444 (PID.TID 0000.0001) %MON forcing_fu_sd = 6.5480383395885E-02
2445 (PID.TID 0000.0001) %MON forcing_fu_del2 = 2.3114393556995E-04
2446 (PID.TID 0000.0001) %MON forcing_fv_max = 2.9305960402537E-01
2447 (PID.TID 0000.0001) %MON forcing_fv_min = -3.3950131228473E-01
2448 (PID.TID 0000.0001) %MON forcing_fv_mean = -1.3743384707768E-02
2449 (PID.TID 0000.0001) %MON forcing_fv_sd = 7.6816469815204E-02
2450 (PID.TID 0000.0001) %MON forcing_fv_del2 = 2.5671701728584E-04
2451 (PID.TID 0000.0001) %MON advcfl_uvel_max = 0.0000000000000E+00
2452 (PID.TID 0000.0001) %MON advcfl_vvel_max = 0.0000000000000E+00
2453 (PID.TID 0000.0001) %MON advcfl_wvel_max = 0.0000000000000E+00
2454 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 0.0000000000000E+00
2455 (PID.TID 0000.0001) %MON pe_b_mean = 0.0000000000000E+00
2456 (PID.TID 0000.0001) %MON ke_max = 0.0000000000000E+00
2457 (PID.TID 0000.0001) %MON ke_mean = 0.0000000000000E+00
2458 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
2459 (PID.TID 0000.0001) %MON vort_r_min = 0.0000000000000E+00
2460 (PID.TID 0000.0001) %MON vort_r_max = 0.0000000000000E+00
2461 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2462 (PID.TID 0000.0001) %MON vort_a_sd = 7.5259258474424E-05
2463 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783522345033E-05
2464 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810783121880E-04
2465 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 0.0000000000000E+00
2466 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 0.0000000000000E+00
2467 (PID.TID 0000.0001) // =======================================================
2468 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2469 (PID.TID 0000.0001) // =======================================================
2470 EXTERNAL_FIELDS_LOAD, 0 : iP,iLd,i0,i1= 12 0 12 1 ; Wght= 0.5000000000 0.5000000000
2471 EXTERNAL_FIELDS_LOAD, it= 0 : Reading new data, i0,i1= 12 1 (prev= 12 0 )
2472 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
2473 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
2474 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
2475 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
2476 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
2477 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
2478 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
2479 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
2480 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
2481 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
2482 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
2483 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
2484 (PID.TID 0000.0001) SOLVE_FOR_PRESSURE: putPmEinXvector = F
2485 cg2d: Sum(rhs),rhsMax = -2.30926389122033E-14 6.10578609137189E+00
2486 (PID.TID 0000.0001) cg2d_init_res = 5.53904960585195E+00
2487 (PID.TID 0000.0001) cg2d_iters(min,last) = -1 49
2488 (PID.TID 0000.0001) cg2d_last_res = 7.50693820073779E-10
2489 (PID.TID 0000.0001) // =======================================================
2490 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2491 (PID.TID 0000.0001) // =======================================================
2492 (PID.TID 0000.0001) %MON time_tsnumber = 1
2493 (PID.TID 0000.0001) %MON time_secondsf = 3.6000000000000E+03
2494 (PID.TID 0000.0001) %MON dynstat_eta_max = 4.7883499216017E-01
2495 (PID.TID 0000.0001) %MON dynstat_eta_min = -3.4030863985822E-01
2496 (PID.TID 0000.0001) %MON dynstat_eta_mean = 6.8702696259820E-18
2497 (PID.TID 0000.0001) %MON dynstat_eta_sd = 8.3879658809608E-02
2498 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.2017759617008E-04
2499 (PID.TID 0000.0001) %MON dynstat_uvel_max = 4.9942617082279E-02
2500 (PID.TID 0000.0001) %MON dynstat_uvel_min = -7.3755561882739E-02
2501 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.1083483540148E-04
2502 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 6.0448690470875E-03
2503 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 2.0606684704258E-05
2504 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.0818638846528E-01
2505 (PID.TID 0000.0001) %MON dynstat_vvel_min = -7.3090007143658E-02
2506 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 1.1283735080746E-04
2507 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 5.9247513959043E-03
2508 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 2.0664328554329E-05
2509 (PID.TID 0000.0001) %MON dynstat_wvel_max = 4.5007128250868E-04
2510 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.7660682820929E-04
2511 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.4769036829205E-07
2512 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 1.7448214030023E-05
2513 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.3593460510062E-07
2514 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382560243082E+01
2515 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8553134119342E+00
2516 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030167263574E+00
2517 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406497626779E+00
2518 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1312433196598E-03
2519 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715747176519E+01
2520 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144946329875E+01
2521 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721450527859E+01
2522 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858318091182E-01
2523 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1559405151845E-04
2524 (PID.TID 0000.0001) %MON forcing_qnet_max = 0.0000000000000E+00
2525 (PID.TID 0000.0001) %MON forcing_qnet_min = 0.0000000000000E+00
2526 (PID.TID 0000.0001) %MON forcing_qnet_mean = 0.0000000000000E+00
2527 (PID.TID 0000.0001) %MON forcing_qnet_sd = 0.0000000000000E+00
2528 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 0.0000000000000E+00
2529 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2530 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2531 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2532 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2533 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2534 (PID.TID 0000.0001) %MON forcing_empmr_max = 0.0000000000000E+00
2535 (PID.TID 0000.0001) %MON forcing_empmr_min = 0.0000000000000E+00
2536 (PID.TID 0000.0001) %MON forcing_empmr_mean = 0.0000000000000E+00
2537 (PID.TID 0000.0001) %MON forcing_empmr_sd = 0.0000000000000E+00
2538 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 0.0000000000000E+00
2539 (PID.TID 0000.0001) %MON forcing_fu_max = 0.0000000000000E+00
2540 (PID.TID 0000.0001) %MON forcing_fu_min = 0.0000000000000E+00
2541 (PID.TID 0000.0001) %MON forcing_fu_mean = 0.0000000000000E+00
2542 (PID.TID 0000.0001) %MON forcing_fu_sd = 0.0000000000000E+00
2543 (PID.TID 0000.0001) %MON forcing_fu_del2 = 0.0000000000000E+00
2544 (PID.TID 0000.0001) %MON forcing_fv_max = 0.0000000000000E+00
2545 (PID.TID 0000.0001) %MON forcing_fv_min = 0.0000000000000E+00
2546 (PID.TID 0000.0001) %MON forcing_fv_mean = 0.0000000000000E+00
2547 (PID.TID 0000.0001) %MON forcing_fv_sd = 0.0000000000000E+00
2548 (PID.TID 0000.0001) %MON forcing_fv_del2 = 0.0000000000000E+00
2549 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.8067110054872E-04
2550 (PID.TID 0000.0001) %MON advcfl_vvel_max = 1.2743531301164E-03
2551 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.4347868463013E-03
2552 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 6.0009104761243E-03
2553 (PID.TID 0000.0001) %MON pe_b_mean = 9.3729820076168E-06
2554 (PID.TID 0000.0001) %MON ke_max = 2.9553400625943E-03
2555 (PID.TID 0000.0001) %MON ke_mean = 3.3082111858406E-05
2556 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
2557 (PID.TID 0000.0001) %MON vort_r_min = -3.9597249380080E-07
2558 (PID.TID 0000.0001) %MON vort_r_max = 3.5145614217471E-07
2559 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2560 (PID.TID 0000.0001) %MON vort_a_sd = 7.5259122244102E-05
2561 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783522345033E-05
2562 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810870562703E-04
2563 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 1.8634237353357E-05
2564 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 6.0726603853623E-07
2565 (PID.TID 0000.0001) // =======================================================
2566 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2567 (PID.TID 0000.0001) // =======================================================
2568 EXTERNAL_FIELDS_LOAD, 1 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4986111111 0.5013888889
2569 cg2d: Sum(rhs),rhsMax = 2.83552438913603E-01 7.39320905463223E+00
2570 (PID.TID 0000.0001) cg2d_init_res = 1.84795241502334E+00
2571 (PID.TID 0000.0001) cg2d_iters(min,last) = -1 48
2572 (PID.TID 0000.0001) cg2d_last_res = 7.82542995760071E-10
2573 (PID.TID 0000.0001) // =======================================================
2574 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2575 (PID.TID 0000.0001) // =======================================================
2576 (PID.TID 0000.0001) %MON time_tsnumber = 2
2577 (PID.TID 0000.0001) %MON time_secondsf = 7.2000000000000E+03
2578 (PID.TID 0000.0001) %MON dynstat_eta_max = 6.9525408082440E-01
2579 (PID.TID 0000.0001) %MON dynstat_eta_min = -6.2456563790490E-01
2580 (PID.TID 0000.0001) %MON dynstat_eta_mean = -3.8975126168825E-04
2581 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.7543086243454E-01
2582 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1138972290465E-03
2583 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.0400032093994E-01
2584 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.3148826161698E-01
2585 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.4311167115400E-04
2586 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.0603114295919E-02
2587 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 4.0047941894166E-05
2588 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.8758179260175E-01
2589 (PID.TID 0000.0001) %MON dynstat_vvel_min = -1.5545549313677E-01
2590 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -2.5007690726306E-04
2591 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.0967806398516E-02
2592 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 4.0889851243834E-05
2593 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.6834846286149E-04
2594 (PID.TID 0000.0001) %MON dynstat_wvel_min = -5.3118106800188E-04
2595 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.7630554442840E-07
2596 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.1580059297127E-05
2597 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 2.3800312251656E-07
2598 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9372783831876E+01
2599 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8554547577108E+00
2600 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6029376291819E+00
2601 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4403097381167E+00
2602 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1287859852397E-03
2603 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746931154E+01
2604 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145181217188E+01
2605 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721453405205E+01
2606 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858278926754E-01
2607 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1563079324499E-04
2608 (PID.TID 0000.0001) %MON forcing_qnet_max = 6.7734887971975E+02
2609 (PID.TID 0000.0001) %MON forcing_qnet_min = -1.8270097648928E+03
2610 (PID.TID 0000.0001) %MON forcing_qnet_mean = 2.5819743582082E+02
2611 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.8467409974078E+02
2612 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 2.4491904276022E+00
2613 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2614 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2615 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2616 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2617 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2618 (PID.TID 0000.0001) %MON forcing_empmr_max = 6.0200556633128E-03
2619 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.2418386911162E-06
2620 (PID.TID 0000.0001) %MON forcing_empmr_mean = 1.1151216653857E-04
2621 (PID.TID 0000.0001) %MON forcing_empmr_sd = 2.0327355245111E-04
2622 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 7.1472069361839E-06
2623 (PID.TID 0000.0001) %MON forcing_fu_max = 9.7552503672184E-03
2624 (PID.TID 0000.0001) %MON forcing_fu_min = -1.0344283872299E-02
2625 (PID.TID 0000.0001) %MON forcing_fu_mean = -2.5812492750734E-05
2626 (PID.TID 0000.0001) %MON forcing_fu_sd = 9.1285628061943E-04
2627 (PID.TID 0000.0001) %MON forcing_fu_del2 = 4.4516520090468E-06
2628 (PID.TID 0000.0001) %MON forcing_fv_max = 8.3963768819550E-03
2629 (PID.TID 0000.0001) %MON forcing_fv_min = -1.2641021351168E-02
2630 (PID.TID 0000.0001) %MON forcing_fv_mean = -1.7176116969320E-05
2631 (PID.TID 0000.0001) %MON forcing_fv_sd = 8.7466177732808E-04
2632 (PID.TID 0000.0001) %MON forcing_fv_del2 = 3.9423790762982E-06
2633 (PID.TID 0000.0001) %MON advcfl_uvel_max = 1.5591642394957E-03
2634 (PID.TID 0000.0001) %MON advcfl_vvel_max = 2.2095704269822E-03
2635 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.0464142158076E-02
2636 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1552300086208E-02
2637 (PID.TID 0000.0001) %MON pe_b_mean = 4.1005192234678E-05
2638 (PID.TID 0000.0001) %MON ke_max = 1.2600229217936E-02
2639 (PID.TID 0000.0001) %MON ke_mean = 1.0761678932799E-04
2640 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
2641 (PID.TID 0000.0001) %MON vort_r_min = -6.8428345453810E-07
2642 (PID.TID 0000.0001) %MON vort_r_max = 6.0938140282949E-07
2643 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2644 (PID.TID 0000.0001) %MON vort_a_sd = 7.5258593050823E-05
2645 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783519155748E-05
2646 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810802995201E-04
2647 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.1506861408714E-05
2648 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.1023654067386E-06
2649 (PID.TID 0000.0001) // =======================================================
2650 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2651 (PID.TID 0000.0001) // =======================================================
2652 EXTERNAL_FIELDS_LOAD, 2 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4972222222 0.5027777778
2653 cg2d: Sum(rhs),rhsMax = 5.75357418104346E-01 7.19621622849190E+00
2654 (PID.TID 0000.0001) cg2d_init_res = 1.39868655543617E+00
2655 (PID.TID 0000.0001) cg2d_iters(min,last) = -1 48
2656 (PID.TID 0000.0001) cg2d_last_res = 8.54801891014572E-10
2657 (PID.TID 0000.0001) // =======================================================
2658 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2659 (PID.TID 0000.0001) // =======================================================
2660 (PID.TID 0000.0001) %MON time_tsnumber = 3
2661 (PID.TID 0000.0001) %MON time_secondsf = 1.0800000000000E+04
2662 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1441227912273E-01
2663 (PID.TID 0000.0001) %MON dynstat_eta_min = -8.1961236881510E-01
2664 (PID.TID 0000.0001) %MON dynstat_eta_mean = -7.6977371438465E-04
2665 (PID.TID 0000.0001) %MON dynstat_eta_sd = 2.5273275970444E-01
2666 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0697630427170E-03
2667 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.5259153241688E-01
2668 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.8823359408789E-01
2669 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.2029489710630E-03
2670 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.3651047094708E-02
2671 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 5.5694766489139E-05
2672 (PID.TID 0000.0001) %MON dynstat_vvel_max = 2.6296605697438E-01
2673 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.3199066735008E-01
2674 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -8.1248378980918E-04
2675 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.4624704003822E-02
2676 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 5.7764296851479E-05
2677 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.2503803510116E-03
2678 (PID.TID 0000.0001) %MON dynstat_wvel_min = -7.6794022669579E-04
2679 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.1973905037040E-07
2680 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.1390332564678E-05
2681 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 3.1342331486777E-07
2682 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9363907960077E+01
2683 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556090041296E+00
2684 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028843784828E+00
2685 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4400206529090E+00
2686 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1257138516997E-03
2687 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746901674E+01
2688 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145482033887E+01
2689 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721456637278E+01
2690 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858332212080E-01
2691 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1566537732101E-04
2692 (PID.TID 0000.0001) %MON forcing_qnet_max = 6.2118518953268E+02
2693 (PID.TID 0000.0001) %MON forcing_qnet_min = -1.8645830596691E+03
2694 (PID.TID 0000.0001) %MON forcing_qnet_mean = 2.1712795633427E+02
2695 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.6990784928035E+02
2696 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 2.4805823863405E+00
2697 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2698 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2699 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2700 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2701 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2702 (PID.TID 0000.0001) %MON forcing_empmr_max = 5.9729928902213E-03
2703 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.2248614771470E-06
2704 (PID.TID 0000.0001) %MON forcing_empmr_mean = 1.0872864618817E-04
2705 (PID.TID 0000.0001) %MON forcing_empmr_sd = 2.0122095099352E-04
2706 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 7.0914351126459E-06
2707 (PID.TID 0000.0001) %MON forcing_fu_max = 2.2360323004424E-02
2708 (PID.TID 0000.0001) %MON forcing_fu_min = -2.1195380238656E-02
2709 (PID.TID 0000.0001) %MON forcing_fu_mean = -9.4595767236801E-05
2710 (PID.TID 0000.0001) %MON forcing_fu_sd = 2.4767826802477E-03
2711 (PID.TID 0000.0001) %MON forcing_fu_del2 = 8.5659587836851E-06
2712 (PID.TID 0000.0001) %MON forcing_fv_max = 3.0506540507472E-02
2713 (PID.TID 0000.0001) %MON forcing_fv_min = -2.1636288989785E-02
2714 (PID.TID 0000.0001) %MON forcing_fv_mean = -4.7962802422740E-05
2715 (PID.TID 0000.0001) %MON forcing_fv_sd = 2.6021212112297E-03
2716 (PID.TID 0000.0001) %MON forcing_fv_del2 = 7.0800873874684E-06
2717 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.2320402214191E-03
2718 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.0975395571803E-03
2719 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.5028719678669E-02
2720 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.6590709194146E-02
2721 (PID.TID 0000.0001) %MON pe_b_mean = 8.5100445190013E-05
2722 (PID.TID 0000.0001) %MON ke_max = 2.6304970993193E-02
2723 (PID.TID 0000.0001) %MON ke_mean = 1.8580218652424E-04
2724 (PID.TID 0000.0001) %MON ke_vol = 1.3398023035374E+18
2725 (PID.TID 0000.0001) %MON vort_r_min = -9.5463984314772E-07
2726 (PID.TID 0000.0001) %MON vort_r_max = 8.5427600660478E-07
2727 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2728 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257995667372E-05
2729 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783516351327E-05
2730 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810708822301E-04
2731 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.2758513905159E-05
2732 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.3026225236464E-06
2733 (PID.TID 0000.0001) // =======================================================
2734 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2735 (PID.TID 0000.0001) // =======================================================
2736 EXTERNAL_FIELDS_LOAD, 3 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4958333333 0.5041666667
2737 cg2d: Sum(rhs),rhsMax = 8.62907447480445E-01 6.97143420668806E+00
2738 (PID.TID 0000.0001) cg2d_init_res = 1.13006138172063E+00
2739 (PID.TID 0000.0001) cg2d_iters(min,last) = -1 48
2740 (PID.TID 0000.0001) cg2d_last_res = 7.09259962472405E-10
2741 (PID.TID 0000.0001) // =======================================================
2742 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2743 (PID.TID 0000.0001) // =======================================================
2744 (PID.TID 0000.0001) %MON time_tsnumber = 4
2745 (PID.TID 0000.0001) %MON time_secondsf = 1.4400000000000E+04
2746 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0448184026089E+00
2747 (PID.TID 0000.0001) %MON dynstat_eta_min = -9.3826808681270E-01
2748 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.1184266480701E-03
2749 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.0825699282385E-01
2750 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0263755149120E-03
2751 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.9675818705050E-01
2752 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.4218865399863E-01
2753 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.8824107373961E-03
2754 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.5906710939401E-02
2755 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 6.8993390072278E-05
2756 (PID.TID 0000.0001) %MON dynstat_vvel_max = 3.3469615675170E-01
2757 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.0237589418773E-01
2758 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.3983045200943E-03
2759 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.7150508172216E-02
2760 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 7.2250175850567E-05
2761 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.6041726462731E-03
2762 (PID.TID 0000.0001) %MON dynstat_wvel_min = -9.8917591067417E-04
2763 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -1.9985922624620E-07
2764 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.7889649490681E-05
2765 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 3.7041537059390E-07
2766 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9355335103987E+01
2767 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556819389933E+00
2768 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028431154474E+00
2769 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4397491648567E+00
2770 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1220942209523E-03
2771 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746804662E+01
2772 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145844295610E+01
2773 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721460031432E+01
2774 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858550514371E-01
2775 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1571920062483E-04
2776 (PID.TID 0000.0001) %MON forcing_qnet_max = 6.0012525022550E+02
2777 (PID.TID 0000.0001) %MON forcing_qnet_min = -2.3659245760098E+02
2778 (PID.TID 0000.0001) %MON forcing_qnet_mean = 2.0532269210628E+02
2779 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.5927650993641E+02
2780 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 5.3373431969304E-01
2781 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2782 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2783 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2784 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2785 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2786 (PID.TID 0000.0001) %MON forcing_empmr_max = 6.6693736483742E-04
2787 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.1978549474832E-06
2788 (PID.TID 0000.0001) %MON forcing_empmr_mean = 9.9753478248925E-05
2789 (PID.TID 0000.0001) %MON forcing_empmr_sd = 7.4064946078714E-05
2790 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 9.9598372432070E-07
2791 (PID.TID 0000.0001) %MON forcing_fu_max = 1.5307357929287E-02
2792 (PID.TID 0000.0001) %MON forcing_fu_min = -1.5855814689368E-02
2793 (PID.TID 0000.0001) %MON forcing_fu_mean = -5.6143048274273E-05
2794 (PID.TID 0000.0001) %MON forcing_fu_sd = 2.9330164831994E-03
2795 (PID.TID 0000.0001) %MON forcing_fu_del2 = 9.1413913465093E-06
2796 (PID.TID 0000.0001) %MON forcing_fv_max = 1.6780896557897E-02
2797 (PID.TID 0000.0001) %MON forcing_fv_min = -1.7918508543798E-02
2798 (PID.TID 0000.0001) %MON forcing_fv_mean = -5.1848380552297E-05
2799 (PID.TID 0000.0001) %MON forcing_fv_sd = 3.1202975371858E-03
2800 (PID.TID 0000.0001) %MON forcing_fv_del2 = 7.8570325028283E-06
2801 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.8718296514272E-03
2802 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.9424654158906E-03
2803 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.9246746561539E-02
2804 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.1247068990661E-02
2805 (PID.TID 0000.0001) %MON pe_b_mean = 1.2659721128157E-04
2806 (PID.TID 0000.0001) %MON ke_max = 4.2176637987956E-02
2807 (PID.TID 0000.0001) %MON ke_mean = 2.5523008029367E-04
2808 (PID.TID 0000.0001) %MON ke_vol = 1.3398021652523E+18
2809 (PID.TID 0000.0001) %MON vort_r_min = -1.2138681008792E-06
2810 (PID.TID 0000.0001) %MON vort_r_max = 1.0872996291064E-06
2811 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2812 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257527583120E-05
2813 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783512799556E-05
2814 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810633114872E-04
2815 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.8145630367741E-05
2816 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.2415085752132E-06
2817 (PID.TID 0000.0001) // =======================================================
2818 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2819 (PID.TID 0000.0001) // =======================================================
2820 EXTERNAL_FIELDS_LOAD, 4 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4944444444 0.5055555556
2821 cg2d: Sum(rhs),rhsMax = 1.13981904160082E+00 6.87397422636255E+00
2822 (PID.TID 0000.0001) cg2d_init_res = 9.39278312743994E-01
2823 (PID.TID 0000.0001) cg2d_iters(min,last) = -1 47
2824 (PID.TID 0000.0001) cg2d_last_res = 9.74608750281573E-10
2825 (PID.TID 0000.0001) // =======================================================
2826 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2827 (PID.TID 0000.0001) // =======================================================
2828 (PID.TID 0000.0001) %MON time_tsnumber = 5
2829 (PID.TID 0000.0001) %MON time_secondsf = 1.8000000000000E+04
2830 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0999458330305E+00
2831 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.0575001216117E+00
2832 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.4566827027492E-03
2833 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.4221108912184E-01
2834 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0109367565711E-03
2835 (PID.TID 0000.0001) %MON dynstat_uvel_max = 2.3755668850770E-01
2836 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.9216146262504E-01
2837 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -2.3679851986745E-03
2838 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.7686241539880E-02
2839 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 8.0777463180583E-05
2840 (PID.TID 0000.0001) %MON dynstat_vvel_max = 4.0197802677541E-01
2841 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.6776256628816E-01
2842 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.9012781589760E-03
2843 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.8877594259928E-02
2844 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 8.5213689672039E-05
2845 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.9358756534198E-03
2846 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.1954526365034E-03
2847 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -4.7646049380702E-08
2848 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 5.1975613747079E-05
2849 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 4.1430348831020E-07
2850 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9347082378597E+01
2851 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556380065751E+00
2852 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028078183117E+00
2853 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4394916944589E+00
2854 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1180456235107E-03
2855 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746700921E+01
2856 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8146260886263E+01
2857 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721463664166E+01
2858 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858778645467E-01
2859 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1575378827878E-04
2860 (PID.TID 0000.0001) %MON forcing_qnet_max = 5.7918655224921E+02
2861 (PID.TID 0000.0001) %MON forcing_qnet_min = -2.4507824402714E+02
2862 (PID.TID 0000.0001) %MON forcing_qnet_mean = 1.9414752716168E+02
2863 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.5568137917470E+02
2864 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 4.5451466954202E-01
2865 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2866 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2867 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2868 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2869 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2870 (PID.TID 0000.0001) %MON forcing_empmr_max = 9.2235645408234E-04
2871 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.1662250343486E-06
2872 (PID.TID 0000.0001) %MON forcing_empmr_mean = 9.6778815644265E-05
2873 (PID.TID 0000.0001) %MON forcing_empmr_sd = 6.9309815875955E-05
2874 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 7.4307490862215E-07
2875 (PID.TID 0000.0001) %MON forcing_fu_max = 1.5660421431449E-02
2876 (PID.TID 0000.0001) %MON forcing_fu_min = -1.6486261497679E-02
2877 (PID.TID 0000.0001) %MON forcing_fu_mean = 1.4597309836223E-04
2878 (PID.TID 0000.0001) %MON forcing_fu_sd = 3.0329435431688E-03
2879 (PID.TID 0000.0001) %MON forcing_fu_del2 = 9.8009821312490E-06
2880 (PID.TID 0000.0001) %MON forcing_fv_max = 1.4964699991719E-02
2881 (PID.TID 0000.0001) %MON forcing_fv_min = -1.4901211613322E-02
2882 (PID.TID 0000.0001) %MON forcing_fv_mean = -9.5269834669968E-05
2883 (PID.TID 0000.0001) %MON forcing_fv_sd = 3.1267458841690E-03
2884 (PID.TID 0000.0001) %MON forcing_fv_del2 = 8.5303553966661E-06
2885 (PID.TID 0000.0001) %MON advcfl_uvel_max = 3.4643982594480E-03
2886 (PID.TID 0000.0001) %MON advcfl_vvel_max = 4.7349945212716E-03
2887 (PID.TID 0000.0001) %MON advcfl_wvel_max = 2.3205921425908E-02
2888 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.5617770492283E-02
2889 (PID.TID 0000.0001) %MON pe_b_mean = 1.5602353606315E-04
2890 (PID.TID 0000.0001) %MON ke_max = 5.9581821135654E-02
2891 (PID.TID 0000.0001) %MON ke_mean = 3.1327973513974E-04
2892 (PID.TID 0000.0001) %MON ke_vol = 1.3398020383821E+18
2893 (PID.TID 0000.0001) %MON vort_r_min = -1.4599021831969E-06
2894 (PID.TID 0000.0001) %MON vort_r_max = 1.3058726567513E-06
2895 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2896 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257267265657E-05
2897 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783510592552E-05
2898 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810582701726E-04
2899 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.1394742681667E-05
2900 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 9.5343949995558E-07
2901 (PID.TID 0000.0001) // =======================================================
2902 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2903 (PID.TID 0000.0001) // =======================================================
2904 Compute Stats, Diag. # 23 ETAN vol( 0 ): 1.819E+15 Parms: SM M1
2905 Compute Stats, Diag. # 25 DETADT2 vol( 0 ): 1.819E+15 Parms: SM M1
2906 Compute Stats, Diag. # 26 THETA vol( 0 ): 6.699E+18 Parms: SMR MR
2907 Compute Stats, Diag. # 27 SALT vol( 0 ): 6.699E+18 Parms: SMR MR
2908 Compute Stats, Diag. # 78 CONVADJ vol( 0 ): 6.575E+18 Parms: SMR LR
2909 Compute Stats, Diag. # 77 DRHODR vol( 0 ): 6.575E+18 Parms: SM LR
2910 Compute Stats, Diag. # 39 UE_VEL_C vol( 0 ): 6.699E+18 Parms: UMR MR
2911 Compute Stats, Diag. # 40 VN_VEL_C vol( 0 ): 6.699E+18 Parms: VMR MR
2912 Compute Stats, Diag. # 32 WVEL vol( 0 ): 6.575E+18 Parms: WM LR
2913 Compute Stats, Diag. # 79 oceTAUX vol( 0 ): 1.728E+15 Parms: UU U1
2914 Compute Stats, Diag. # 80 oceTAUY vol( 0 ): 1.739E+15 Parms: VV U1
2915 Compute Stats, Diag. # 83 oceFWflx vol( 0 ): 1.819E+15 Parms: SM U1
2916 Compute Stats, Diag. # 85 oceQnet vol( 0 ): 1.819E+15 Parms: SM U1
2917 Compute Stats, Diag. # 89 SRELAX vol( 0 ): 1.819E+15 Parms: SM U1
2918 Compute Stats, Diag. # 84 oceSflux vol( 0 ): 1.819E+15 Parms: SM U1
2919 Compute Stats, Diag. # 82 sIceLoad vol( 0 ): 1.819E+15 Parms: SM U1
2920 (PID.TID 0000.0001) DIAGSTATS_CLOSE_IO: close file: dynStDiag.0000000000.txt , unit= 9
2921 (PID.TID 0000.0001) %CHECKPOINT 5 ckptA
2922 (PID.TID 0000.0001) Seconds in section "ALL [THE_MODEL_MAIN]":
2923 (PID.TID 0000.0001) User time: 21.500000000000000
2924 (PID.TID 0000.0001) System time: 0.75000000000000000
2925 (PID.TID 0000.0001) Wall clock time: 22.499193906784058
2926 (PID.TID 0000.0001) No. starts: 1
2927 (PID.TID 0000.0001) No. stops: 1
2928 (PID.TID 0000.0001) Seconds in section "INITIALISE_FIXED [THE_MODEL_MAIN]":
2929 (PID.TID 0000.0001) User time: 0.19000000000000000
2930 (PID.TID 0000.0001) System time: 2.00000000000000004E-002
2931 (PID.TID 0000.0001) Wall clock time: 0.34956502914428711
2932 (PID.TID 0000.0001) No. starts: 1
2933 (PID.TID 0000.0001) No. stops: 1
2934 (PID.TID 0000.0001) Seconds in section "THE_MAIN_LOOP [THE_MODEL_MAIN]":
2935 (PID.TID 0000.0001) User time: 21.309999999999999
2936 (PID.TID 0000.0001) System time: 0.72999999999999998
2937 (PID.TID 0000.0001) Wall clock time: 22.149594068527222
2938 (PID.TID 0000.0001) No. starts: 1
2939 (PID.TID 0000.0001) No. stops: 1
2940 (PID.TID 0000.0001) Seconds in section "INITIALISE_VARIA [THE_MAIN_LOOP]":
2941 (PID.TID 0000.0001) User time: 0.45000000000000001
2942 (PID.TID 0000.0001) System time: 3.00000000000000024E-002
2943 (PID.TID 0000.0001) Wall clock time: 0.54001283645629883
2944 (PID.TID 0000.0001) No. starts: 1
2945 (PID.TID 0000.0001) No. stops: 1
2946 (PID.TID 0000.0001) Seconds in section "MAIN LOOP [THE_MAIN_LOOP]":
2947 (PID.TID 0000.0001) User time: 20.859999999999999
2948 (PID.TID 0000.0001) System time: 0.69999999999999996
2949 (PID.TID 0000.0001) Wall clock time: 21.609548091888428
2950 (PID.TID 0000.0001) No. starts: 1
2951 (PID.TID 0000.0001) No. stops: 1
2952 (PID.TID 0000.0001) Seconds in section "MAIN_DO_LOOP [THE_MAIN_LOOP]":
2953 (PID.TID 0000.0001) User time: 20.860000000000003
2954 (PID.TID 0000.0001) System time: 0.69999999999999996
2955 (PID.TID 0000.0001) Wall clock time: 21.609487771987915
2956 (PID.TID 0000.0001) No. starts: 5
2957 (PID.TID 0000.0001) No. stops: 5
2958 (PID.TID 0000.0001) Seconds in section "FORWARD_STEP [MAIN_DO_LOOP]":
2959 (PID.TID 0000.0001) User time: 20.860000000000003
2960 (PID.TID 0000.0001) System time: 0.69999999999999996
2961 (PID.TID 0000.0001) Wall clock time: 21.609390735626221
2962 (PID.TID 0000.0001) No. starts: 5
2963 (PID.TID 0000.0001) No. stops: 5
2964 (PID.TID 0000.0001) Seconds in section "DO_STATEVARS_DIAGS [FORWARD_STEP]":
2965 (PID.TID 0000.0001) User time: 0.50000000000000000
2966 (PID.TID 0000.0001) System time: 0.0000000000000000
2967 (PID.TID 0000.0001) Wall clock time: 0.50577402114868164
2968 (PID.TID 0000.0001) No. starts: 15
2969 (PID.TID 0000.0001) No. stops: 15
2970 (PID.TID 0000.0001) Seconds in section "LOAD_FIELDS_DRIVER [FORWARD_STEP]":
2971 (PID.TID 0000.0001) User time: 2.99999999999975842E-002
2972 (PID.TID 0000.0001) System time: 0.0000000000000000
2973 (PID.TID 0000.0001) Wall clock time: 3.10971736907958984E-002
2974 (PID.TID 0000.0001) No. starts: 5
2975 (PID.TID 0000.0001) No. stops: 5
2976 (PID.TID 0000.0001) Seconds in section "EXTERNAL_FLDS_LOAD [LOAD_FLDS_DRIVER]":
2977 (PID.TID 0000.0001) User time: 2.99999999999975842E-002
2978 (PID.TID 0000.0001) System time: 0.0000000000000000
2979 (PID.TID 0000.0001) Wall clock time: 3.09982299804687500E-002
2980 (PID.TID 0000.0001) No. starts: 5
2981 (PID.TID 0000.0001) No. stops: 5
2982 (PID.TID 0000.0001) Seconds in section "CPL_EXPORT-IMPORT [FORWARD_STEP]":
2983 (PID.TID 0000.0001) User time: 13.059999999999999
2984 (PID.TID 0000.0001) System time: 0.67999999999999994
2985 (PID.TID 0000.0001) Wall clock time: 13.771152973175049
2986 (PID.TID 0000.0001) No. starts: 5
2987 (PID.TID 0000.0001) No. stops: 5
2988 (PID.TID 0000.0001) Seconds in section "DO_ATMOSPHERIC_PHYS [FORWARD_STEP]":
2989 (PID.TID 0000.0001) User time: 0.0000000000000000
2990 (PID.TID 0000.0001) System time: 0.0000000000000000
2991 (PID.TID 0000.0001) Wall clock time: 5.10215759277343750E-005
2992 (PID.TID 0000.0001) No. starts: 5
2993 (PID.TID 0000.0001) No. stops: 5
2994 (PID.TID 0000.0001) Seconds in section "DO_OCEANIC_PHYS [FORWARD_STEP]":
2995 (PID.TID 0000.0001) User time: 0.87999999999999901
2996 (PID.TID 0000.0001) System time: 0.0000000000000000
2997 (PID.TID 0000.0001) Wall clock time: 0.88869857788085938
2998 (PID.TID 0000.0001) No. starts: 5
2999 (PID.TID 0000.0001) No. stops: 5
3000 (PID.TID 0000.0001) Seconds in section "DYNAMICS [FORWARD_STEP]":
3001 (PID.TID 0000.0001) User time: 2.0999999999999979
3002 (PID.TID 0000.0001) System time: 1.00000000000000089E-002
3003 (PID.TID 0000.0001) Wall clock time: 2.1032881736755371
3004 (PID.TID 0000.0001) No. starts: 5
3005 (PID.TID 0000.0001) No. stops: 5
3006 (PID.TID 0000.0001) Seconds in section "UPDATE_R_STAR [FORWARD_STEP]":
3007 (PID.TID 0000.0001) User time: 0.10999999999999943
3008 (PID.TID 0000.0001) System time: 0.0000000000000000
3009 (PID.TID 0000.0001) Wall clock time: 0.10568571090698242
3010 (PID.TID 0000.0001) No. starts: 5
3011 (PID.TID 0000.0001) No. stops: 5
3012 (PID.TID 0000.0001) Seconds in section "UPDATE_CG2D [FORWARD_STEP]":
3013 (PID.TID 0000.0001) User time: 5.99999999999987210E-002
3014 (PID.TID 0000.0001) System time: 0.0000000000000000
3015 (PID.TID 0000.0001) Wall clock time: 6.02278709411621094E-002
3016 (PID.TID 0000.0001) No. starts: 5
3017 (PID.TID 0000.0001) No. stops: 5
3018 (PID.TID 0000.0001) Seconds in section "SOLVE_FOR_PRESSURE [FORWARD_STEP]":
3019 (PID.TID 0000.0001) User time: 0.71000000000000085
3020 (PID.TID 0000.0001) System time: 0.0000000000000000
3021 (PID.TID 0000.0001) Wall clock time: 0.71252393722534180
3022 (PID.TID 0000.0001) No. starts: 5
3023 (PID.TID 0000.0001) No. stops: 5
3024 (PID.TID 0000.0001) Seconds in section "MOM_CORRECTION_STEP [FORWARD_STEP]":
3025 (PID.TID 0000.0001) User time: 6.00000000000022737E-002
3026 (PID.TID 0000.0001) System time: 0.0000000000000000
3027 (PID.TID 0000.0001) Wall clock time: 5.54525852203369141E-002
3028 (PID.TID 0000.0001) No. starts: 5
3029 (PID.TID 0000.0001) No. stops: 5
3030 (PID.TID 0000.0001) Seconds in section "INTEGR_CONTINUITY [FORWARD_STEP]":
3031 (PID.TID 0000.0001) User time: 0.17999999999999972
3032 (PID.TID 0000.0001) System time: 0.0000000000000000
3033 (PID.TID 0000.0001) Wall clock time: 0.18011140823364258
3034 (PID.TID 0000.0001) No. starts: 5
3035 (PID.TID 0000.0001) No. stops: 5
3036 (PID.TID 0000.0001) Seconds in section "CALC_R_STAR [FORWARD_STEP]":
3037 (PID.TID 0000.0001) User time: 2.00000000000031264E-002
3038 (PID.TID 0000.0001) System time: 0.0000000000000000
3039 (PID.TID 0000.0001) Wall clock time: 2.20637321472167969E-002
3040 (PID.TID 0000.0001) No. starts: 5
3041 (PID.TID 0000.0001) No. stops: 5
3042 (PID.TID 0000.0001) Seconds in section "BLOCKING_EXCHANGES [FORWARD_STEP]":
3043 (PID.TID 0000.0001) User time: 6.00000000000022737E-002
3044 (PID.TID 0000.0001) System time: 0.0000000000000000
3045 (PID.TID 0000.0001) Wall clock time: 5.95469474792480469E-002
3046 (PID.TID 0000.0001) No. starts: 10
3047 (PID.TID 0000.0001) No. stops: 10
3048 (PID.TID 0000.0001) Seconds in section "THERMODYNAMICS [FORWARD_STEP]":
3049 (PID.TID 0000.0001) User time: 2.1200000000000045
3050 (PID.TID 0000.0001) System time: 0.0000000000000000
3051 (PID.TID 0000.0001) Wall clock time: 2.1350708007812500
3052 (PID.TID 0000.0001) No. starts: 5
3053 (PID.TID 0000.0001) No. stops: 5
3054 (PID.TID 0000.0001) Seconds in section "TRC_CORRECTION_STEP [FORWARD_STEP]":
3055 (PID.TID 0000.0001) User time: 2.99999999999975842E-002
3056 (PID.TID 0000.0001) System time: 0.0000000000000000
3057 (PID.TID 0000.0001) Wall clock time: 2.92232036590576172E-002
3058 (PID.TID 0000.0001) No. starts: 5
3059 (PID.TID 0000.0001) No. stops: 5
3060 (PID.TID 0000.0001) Seconds in section "DO_STATEVARS_TAVE [FORWARD_STEP]":
3061 (PID.TID 0000.0001) User time: 0.0000000000000000
3062 (PID.TID 0000.0001) System time: 0.0000000000000000
3063 (PID.TID 0000.0001) Wall clock time: 5.19752502441406250E-005
3064 (PID.TID 0000.0001) No. starts: 5
3065 (PID.TID 0000.0001) No. stops: 5
3066 (PID.TID 0000.0001) Seconds in section "MONITOR [FORWARD_STEP]":
3067 (PID.TID 0000.0001) User time: 0.82999999999999829
3068 (PID.TID 0000.0001) System time: 0.0000000000000000
3069 (PID.TID 0000.0001) Wall clock time: 0.83091592788696289
3070 (PID.TID 0000.0001) No. starts: 5
3071 (PID.TID 0000.0001) No. stops: 5
3072 (PID.TID 0000.0001) Seconds in section "DO_THE_MODEL_IO [FORWARD_STEP]":
3073 (PID.TID 0000.0001) User time: 5.00000000000007105E-002
3074 (PID.TID 0000.0001) System time: 0.0000000000000000
3075 (PID.TID 0000.0001) Wall clock time: 6.01902008056640625E-002
3076 (PID.TID 0000.0001) No. starts: 5
3077 (PID.TID 0000.0001) No. stops: 5
3078 (PID.TID 0000.0001) Seconds in section "DO_WRITE_PICKUP [FORWARD_STEP]":
3079 (PID.TID 0000.0001) User time: 5.99999999999987210E-002
3080 (PID.TID 0000.0001) System time: 1.00000000000000089E-002
3081 (PID.TID 0000.0001) Wall clock time: 5.70549964904785156E-002
3082 (PID.TID 0000.0001) No. starts: 5
3083 (PID.TID 0000.0001) No. stops: 5
3084 (PID.TID 0000.0001) // ======================================================
3085 (PID.TID 0000.0001) // Tile <-> Tile communication statistics
3086 (PID.TID 0000.0001) // ======================================================
3087 (PID.TID 0000.0001) // o Tile number: 000001
3088 (PID.TID 0000.0001) // No. X exchanges = 0
3089 (PID.TID 0000.0001) // Max. X spins = 0
3090 (PID.TID 0000.0001) // Min. X spins = 1000000000
3091 (PID.TID 0000.0001) // Total. X spins = 0
3092 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
3093 (PID.TID 0000.0001) // No. Y exchanges = 0
3094 (PID.TID 0000.0001) // Max. Y spins = 0
3095 (PID.TID 0000.0001) // Min. Y spins = 1000000000
3096 (PID.TID 0000.0001) // Total. Y spins = 0
3097 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
3098 (PID.TID 0000.0001) // o Tile number: 000002
3099 (PID.TID 0000.0001) // No. X exchanges = 0
3100 (PID.TID 0000.0001) // Max. X spins = 0
3101 (PID.TID 0000.0001) // Min. X spins = 1000000000
3102 (PID.TID 0000.0001) // Total. X spins = 0
3103 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
3104 (PID.TID 0000.0001) // No. Y exchanges = 0
3105 (PID.TID 0000.0001) // Max. Y spins = 0
3106 (PID.TID 0000.0001) // Min. Y spins = 1000000000
3107 (PID.TID 0000.0001) // Total. Y spins = 0
3108 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
3109 (PID.TID 0000.0001) // o Tile number: 000003
3110 (PID.TID 0000.0001) // No. X exchanges = 0
3111 (PID.TID 0000.0001) // Max. X spins = 0
3112 (PID.TID 0000.0001) // Min. X spins = 1000000000
3113 (PID.TID 0000.0001) // Total. X spins = 0
3114 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
3115 (PID.TID 0000.0001) // No. Y exchanges = 0
3116 (PID.TID 0000.0001) // Max. Y spins = 0
3117 (PID.TID 0000.0001) // Min. Y spins = 1000000000
3118 (PID.TID 0000.0001) // Total. Y spins = 0
3119 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
3120 (PID.TID 0000.0001) // o Tile number: 000004
3121 (PID.TID 0000.0001) // No. X exchanges = 0
3122 (PID.TID 0000.0001) // Max. X spins = 0
3123 (PID.TID 0000.0001) // Min. X spins = 1000000000
3124 (PID.TID 0000.0001) // Total. X spins = 0
3125 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
3126 (PID.TID 0000.0001) // No. Y exchanges = 0
3127 (PID.TID 0000.0001) // Max. Y spins = 0
3128 (PID.TID 0000.0001) // Min. Y spins = 1000000000
3129 (PID.TID 0000.0001) // Total. Y spins = 0
3130 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
3131 (PID.TID 0000.0001) // o Tile number: 000005
3132 (PID.TID 0000.0001) // No. X exchanges = 0
3133 (PID.TID 0000.0001) // Max. X spins = 0
3134 (PID.TID 0000.0001) // Min. X spins = 1000000000
3135 (PID.TID 0000.0001) // Total. X spins = 0
3136 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
3137 (PID.TID 0000.0001) // No. Y exchanges = 0
3138 (PID.TID 0000.0001) // Max. Y spins = 0
3139 (PID.TID 0000.0001) // Min. Y spins = 1000000000
3140 (PID.TID 0000.0001) // Total. Y spins = 0
3141 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
3142 (PID.TID 0000.0001) // o Tile number: 000006
3143 (PID.TID 0000.0001) // No. X exchanges = 0
3144 (PID.TID 0000.0001) // Max. X spins = 0
3145 (PID.TID 0000.0001) // Min. X spins = 1000000000
3146 (PID.TID 0000.0001) // Total. X spins = 0
3147 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
3148 (PID.TID 0000.0001) // No. Y exchanges = 0
3149 (PID.TID 0000.0001) // Max. Y spins = 0
3150 (PID.TID 0000.0001) // Min. Y spins = 1000000000
3151 (PID.TID 0000.0001) // Total. Y spins = 0
3152 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
3153 (PID.TID 0000.0001) // o Thread number: 000001
3154 (PID.TID 0000.0001) // No. barriers = 6390
3155 (PID.TID 0000.0001) // Max. barrier spins = 1
3156 (PID.TID 0000.0001) // Min. barrier spins = 1
3157 (PID.TID 0000.0001) // Total barrier spins = 6390
3158 (PID.TID 0000.0001) // Avg. barrier spins = 1.00E+00
3159 PROGRAM MAIN: Execution ended Normally

  ViewVC Help
Powered by ViewVC 1.1.22