ViewVC logotype

Contents of /MITgcm/verification/cpl_aim+ocn/results/ocnSTDOUT.0000

Parent Directory Parent Directory | Revision Log Revision Log | View Revision Graph Revision Graph

Revision 1.12 - (show annotations) (download)
Tue Nov 8 23:05:24 2011 UTC (10 years, 9 months ago) by jmc
Branch: MAIN
CVS Tags: checkpoint63f
Changes since 1.11: +279 -226 lines
new output generated on baudelaire with gfortran & mpich2 (hydra)

1 (PID.TID 0000.0001)
2 (PID.TID 0000.0001) // ======================================================
3 (PID.TID 0000.0001) // MITgcm UV
4 (PID.TID 0000.0001) // =========
5 (PID.TID 0000.0001) // ======================================================
6 (PID.TID 0000.0001) // execution environment starting up...
7 (PID.TID 0000.0001)
8 (PID.TID 0000.0001) // MITgcmUV version: checkpoint63e
9 (PID.TID 0000.0001) // Build user: jmc
10 (PID.TID 0000.0001) // Build host: baudelaire
11 (PID.TID 0000.0001) // Build date: Tue Nov 8 17:13:21 EST 2011
12 (PID.TID 0000.0001)
13 (PID.TID 0000.0001) // =======================================================
14 (PID.TID 0000.0001) // Execution Environment parameter file "eedata"
15 (PID.TID 0000.0001) // =======================================================
16 (PID.TID 0000.0001) ># Example "eedata" file
17 (PID.TID 0000.0001) ># Lines beginning "#" are comments
18 (PID.TID 0000.0001) ># nTx - No. threads per process in X
19 (PID.TID 0000.0001) ># nTy - No. threads per process in Y
20 (PID.TID 0000.0001) > &EEPARMS
21 (PID.TID 0000.0001) > useCoupler=.TRUE.,
22 (PID.TID 0000.0001) > useCubedSphereExchange=.TRUE.,
23 (PID.TID 0000.0001) ># Activate one line below to support 2, 3 or 6 way multi-threading
24 (PID.TID 0000.0001) > nTx=1,
25 (PID.TID 0000.0001) >#nTx=2,
26 (PID.TID 0000.0001) >#nTx=3,
27 (PID.TID 0000.0001) >#nTx=6,
28 (PID.TID 0000.0001) > /
29 (PID.TID 0000.0001) ># Note: Some systems use & as the namelist terminator (as shown here).
30 (PID.TID 0000.0001) ># Other systems use a / character.
31 (PID.TID 0000.0001)
32 (PID.TID 0000.0001) // =======================================================
33 (PID.TID 0000.0001) // Computational Grid Specification ( see files "SIZE.h" )
34 (PID.TID 0000.0001) // ( and "eedata" )
35 (PID.TID 0000.0001) // =======================================================
36 (PID.TID 0000.0001) nPx = 1 ; /* No. processes in X */
37 (PID.TID 0000.0001) nPy = 1 ; /* No. processes in Y */
38 (PID.TID 0000.0001) nSx = 6 ; /* No. tiles in X per process */
39 (PID.TID 0000.0001) nSy = 1 ; /* No. tiles in Y per process */
40 (PID.TID 0000.0001) sNx = 32 ; /* Tile size in X */
41 (PID.TID 0000.0001) sNy = 32 ; /* Tile size in Y */
42 (PID.TID 0000.0001) OLx = 2 ; /* Tile overlap distance in X */
43 (PID.TID 0000.0001) OLy = 2 ; /* Tile overlap distance in Y */
44 (PID.TID 0000.0001) nTx = 1 ; /* No. threads in X per process */
45 (PID.TID 0000.0001) nTy = 1 ; /* No. threads in Y per process */
46 (PID.TID 0000.0001) Nr = 15 ; /* No. levels in the vertical */
47 (PID.TID 0000.0001) Nx = 192 ; /* Total domain size in X ( = nPx*nSx*sNx ) */
48 (PID.TID 0000.0001) Ny = 32 ; /* Total domain size in Y ( = nPy*nSy*sNy ) */
49 (PID.TID 0000.0001) nTiles = 6 ; /* Total no. tiles per process ( = nSx*nSy ) */
50 (PID.TID 0000.0001) nProcs = 1 ; /* Total no. processes ( = nPx*nPy ) */
51 (PID.TID 0000.0001) nThreads = 1 ; /* Total no. threads per process ( = nTx*nTy ) */
52 (PID.TID 0000.0001) usingMPI = F ; /* Flag used to control whether MPI is in use */
53 (PID.TID 0000.0001) /* note: To execute a program with MPI calls */
54 (PID.TID 0000.0001) /* it must be launched appropriately e.g */
55 (PID.TID 0000.0001) /* "mpirun -np 64 ......" */
56 (PID.TID 0000.0001) useCoupler= T ;/* Flag used to control communications with */
57 (PID.TID 0000.0001) /* other model components, through a coupler */
58 (PID.TID 0000.0001) debugMode = F ; /* print debug msg. (sequence of S/R calls) */
59 (PID.TID 0000.0001) printMapIncludesZeros= F ; /* print zeros in Std.Output maps */
60 (PID.TID 0000.0001) maxLengthPrt1D= 65 /* maxLength of 1D array printed to StdOut */
61 (PID.TID 0000.0001)
62 (PID.TID 0000.0001) ======= Starting MPI parallel Run =========
63 (PID.TID 0000.0001) My Processor Name (len: 10 ) = baudelaire
64 (PID.TID 0000.0001) Located at ( 0, 0) on processor grid (0: 0,0: 0)
65 (PID.TID 0000.0001) Origin at ( 1, 1) on global grid (1: 192,1: 32)
66 (PID.TID 0000.0001) North neighbor = processor 0000
67 (PID.TID 0000.0001) South neighbor = processor 0000
68 (PID.TID 0000.0001) East neighbor = processor 0000
69 (PID.TID 0000.0001) West neighbor = processor 0000
70 (PID.TID 0000.0001) // ======================================================
71 (PID.TID 0000.0001) // Mapping of tiles to threads
72 (PID.TID 0000.0001) // ======================================================
73 (PID.TID 0000.0001) // -o- Thread 1, tiles ( 1: 6, 1: 1)
74 (PID.TID 0000.0001)
75 (PID.TID 0000.0001) W2_READPARMS: file data.exch2 not found
76 (PID.TID 0000.0001) => use W2_EXCH2 default: regular 6-facets Cube
77 (PID.TID 0000.0001) W2_useE2ioLayOut= T ;/* T: use Exch2 glob IO map; F: use model default */
78 (PID.TID 0000.0001) W2_mapIO = -1 ; /* select option for Exch2 global-IO map */
79 (PID.TID 0000.0001) W2_printMsg = -1 ; /* select option for printing information */
80 (PID.TID 0000.0001) ===== Start setting W2 TOPOLOGY:
81 (PID.TID 0000.0001) write to log-file: w2_tile_topology.0000.log
82 (PID.TID 0000.0001) ===== setting W2 TOPOLOGY: Done
83 (PID.TID 0000.0001)
84 (PID.TID 0000.0001) INI_PARMS: opening model parameter file "data"
85 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data
86 (PID.TID 0000.0001) // =======================================================
87 (PID.TID 0000.0001) // Parameter file "data"
88 (PID.TID 0000.0001) // =======================================================
89 (PID.TID 0000.0001) ># ====================
90 (PID.TID 0000.0001) ># | Model parameters |
91 (PID.TID 0000.0001) ># ====================
92 (PID.TID 0000.0001) >#
93 (PID.TID 0000.0001) ># Continuous equation parameters
94 (PID.TID 0000.0001) > &PARM01
95 (PID.TID 0000.0001) > tRef=15*20.,
96 (PID.TID 0000.0001) > sRef=15*35.,
97 (PID.TID 0000.0001) > viscAh =3.E5,
98 (PID.TID 0000.0001) > viscAr =1.E-3,
99 (PID.TID 0000.0001) > diffKhT=0.,
100 (PID.TID 0000.0001) > diffK4T=0.,
101 (PID.TID 0000.0001) > diffKrT=3.E-5,
102 (PID.TID 0000.0001) > diffKhS=0.,
103 (PID.TID 0000.0001) > diffK4S=0.,
104 (PID.TID 0000.0001) > diffKrS=3.E-5,
105 (PID.TID 0000.0001) > gravity=9.81,
106 (PID.TID 0000.0001) > rhoConst=1030.,
107 (PID.TID 0000.0001) > rhoConstFresh=1000.,
108 (PID.TID 0000.0001) > eosType='JMD95Z',
109 (PID.TID 0000.0001) >#allowFreezing=.TRUE.,
110 (PID.TID 0000.0001) > ivdc_kappa=10.,
111 (PID.TID 0000.0001) > implicitDiffusion=.TRUE.,
112 (PID.TID 0000.0001) > implicitFreeSurface=.TRUE.,
113 (PID.TID 0000.0001) > exactConserv=.TRUE.,
114 (PID.TID 0000.0001) > select_rStar=2,
115 (PID.TID 0000.0001) > nonlinFreeSurf=4,
116 (PID.TID 0000.0001) > hFacInf=0.2,
117 (PID.TID 0000.0001) > hFacSup=2.0,
118 (PID.TID 0000.0001) > useRealFreshWaterFlux=.TRUE.,
119 (PID.TID 0000.0001) > temp_EvPrRn=0.,
120 (PID.TID 0000.0001) > hFacMin=.1,
121 (PID.TID 0000.0001) > hFacMinDr=20.,
122 (PID.TID 0000.0001) > vectorInvariantMomentum=.TRUE.,
123 (PID.TID 0000.0001) > staggerTimeStep=.TRUE.,
124 (PID.TID 0000.0001) > readBinaryPrec=64,
125 (PID.TID 0000.0001) > writeBinaryPrec=64,
126 (PID.TID 0000.0001) >#debugLevel=0,
127 (PID.TID 0000.0001) > /
128 (PID.TID 0000.0001) >
129 (PID.TID 0000.0001) ># Elliptic solver parameters
130 (PID.TID 0000.0001) > &PARM02
131 (PID.TID 0000.0001) > cg2dMaxIters=200,
132 (PID.TID 0000.0001) > cg2dTargetResidual=1.E-9,
133 (PID.TID 0000.0001) >#cg2dTargetResWunit=1.E-14,
134 (PID.TID 0000.0001) > /
135 (PID.TID 0000.0001) >
136 (PID.TID 0000.0001) ># Time stepping parameters
137 (PID.TID 0000.0001) > &PARM03
138 (PID.TID 0000.0001) > nIter0=0,
139 (PID.TID 0000.0001) > nTimeSteps=5,
140 (PID.TID 0000.0001) > deltaTmom =3600.,
141 (PID.TID 0000.0001) > deltaTtracer=3600.,
142 (PID.TID 0000.0001) > deltaTClock =3600.,
143 (PID.TID 0000.0001) > abEps = 0.1,
144 (PID.TID 0000.0001) > pChkptFreq =2592000.,
145 (PID.TID 0000.0001) > taveFreq =2592000.,
146 (PID.TID 0000.0001) > dumpFreq =864000.,
147 (PID.TID 0000.0001) > monitorFreq =86400.,
148 (PID.TID 0000.0001) > monitorFreq =1.,
149 (PID.TID 0000.0001) >#forcing_In_AB=.FALSE.,
150 (PID.TID 0000.0001) > tracForcingOutAB=1,
151 (PID.TID 0000.0001) > periodicExternalForcing=.TRUE.,
152 (PID.TID 0000.0001) > externForcingPeriod=2592000.,
153 (PID.TID 0000.0001) > externForcingCycle=31104000.,
154 (PID.TID 0000.0001) ># 2 months restoring timescale for temperature
155 (PID.TID 0000.0001) >#tauThetaClimRelax= 5184000.,
156 (PID.TID 0000.0001) ># restoring timescale for salinity: 2yrs, 20 yrs
157 (PID.TID 0000.0001) >#tauSaltClimRelax = 62208000.,
158 (PID.TID 0000.0001) > tauSaltClimRelax = 622080000.,
159 (PID.TID 0000.0001) > /
160 (PID.TID 0000.0001) >
161 (PID.TID 0000.0001) ># Gridding parameters
162 (PID.TID 0000.0001) > &PARM04
163 (PID.TID 0000.0001) > usingCurvilinearGrid=.TRUE.,
164 (PID.TID 0000.0001) > horizGridFile='grid_cs32',
165 (PID.TID 0000.0001) > radius_fromHorizGrid=6370.E3,
166 (PID.TID 0000.0001) > delR= 50., 70., 100., 140., 190.,
167 (PID.TID 0000.0001) > 240., 290., 340., 390., 440.,
168 (PID.TID 0000.0001) > 490., 540., 590., 640., 690.,
169 (PID.TID 0000.0001) > /
170 (PID.TID 0000.0001) >
171 (PID.TID 0000.0001) ># Input datasets
172 (PID.TID 0000.0001) > &PARM05
173 (PID.TID 0000.0001) > bathyFile ='bathy_Hmin50.bin',
174 (PID.TID 0000.0001) > hydrogThetaFile='lev_T_cs_15k.bin',
175 (PID.TID 0000.0001) > hydrogSaltFile ='lev_S_cs_15k.bin',
176 (PID.TID 0000.0001) > zonalWindFile ='trenberth_taux.bin',
177 (PID.TID 0000.0001) > meridWindFile ='trenberth_tauy.bin',
178 (PID.TID 0000.0001) > thetaClimFile ='lev_surfT_cs_12m.bin',
179 (PID.TID 0000.0001) > saltClimFile ='lev_surfS_cs_12m.bin',
180 (PID.TID 0000.0001) > surfQFile ='shiQnet_cs32.bin',
181 (PID.TID 0000.0001) > EmPmRFile ='shiEmPR_cs32.bin',
182 (PID.TID 0000.0001) > /
183 (PID.TID 0000.0001)
184 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM01
185 (PID.TID 0000.0001) INI_PARMS ; read PARM01 : OK
186 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM02
187 (PID.TID 0000.0001) INI_PARMS ; read PARM02 : OK
188 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM03
189 (PID.TID 0000.0001) INI_PARMS ; read PARM03 : OK
190 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM04
191 (PID.TID 0000.0001) INI_PARMS ; read PARM04 : OK
192 (PID.TID 0000.0001) INI_PARMS ; starts to read PARM05
193 (PID.TID 0000.0001) INI_PARMS ; read PARM05 : OK
194 (PID.TID 0000.0001) INI_PARMS: finished reading file "data"
195 (PID.TID 0000.0001) PACKAGES_BOOT: opening data.pkg
196 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.pkg
197 (PID.TID 0000.0001) // =======================================================
198 (PID.TID 0000.0001) // Parameter file "data.pkg"
199 (PID.TID 0000.0001) // =======================================================
200 (PID.TID 0000.0001) ># Packages
201 (PID.TID 0000.0001) > &PACKAGES
202 (PID.TID 0000.0001) > useGMRedi=.TRUE.,
203 (PID.TID 0000.0001) >#useMNC=.TRUE.,
204 (PID.TID 0000.0001) > /
205 (PID.TID 0000.0001)
206 (PID.TID 0000.0001) PACKAGES_BOOT: finished reading data.pkg
207 (PID.TID 0000.0001) GM_READPARMS: opening data.gmredi
208 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.gmredi
209 (PID.TID 0000.0001) // =======================================================
210 (PID.TID 0000.0001) // Parameter file "data.gmredi"
211 (PID.TID 0000.0001) // =======================================================
212 (PID.TID 0000.0001) ># GM+Redi package parameters:
213 (PID.TID 0000.0001) >
214 (PID.TID 0000.0001) >#-from MOM :
215 (PID.TID 0000.0001) ># GM_background_K: G & Mc.W diffusion coefficient
216 (PID.TID 0000.0001) ># GM_maxSlope : max slope of isopycnals
217 (PID.TID 0000.0001) ># GM_Scrit : transition for scaling diffusion coefficient
218 (PID.TID 0000.0001) ># GM_Sd : half width scaling for diffusion coefficient
219 (PID.TID 0000.0001) ># GM_taper_scheme: slope clipping or one of the tapering schemes
220 (PID.TID 0000.0001) ># GM_Kmin_horiz : horizontal diffusion minimum value
221 (PID.TID 0000.0001) >
222 (PID.TID 0000.0001) >#-Option parameters (needs to "define" options in GMREDI_OPTIONS.h")
223 (PID.TID 0000.0001) ># GM_isopycK : isopycnal diffusion coefficient (default=GM_background_K)
224 (PID.TID 0000.0001) ># GM_AdvForm : turn on GM Advective form (default=Skew flux form)
225 (PID.TID 0000.0001) >
226 (PID.TID 0000.0001) > &GM_PARM01
227 (PID.TID 0000.0001) > GM_background_K = 800.,
228 (PID.TID 0000.0001) > GM_taper_scheme = 'gkw91',
229 (PID.TID 0000.0001) > GM_maxSlope = 1.e-2,
230 (PID.TID 0000.0001) > GM_Kmin_horiz = 50.,
231 (PID.TID 0000.0001) > GM_Scrit = 4.e-3,
232 (PID.TID 0000.0001) > GM_Sd = 1.e-3,
233 (PID.TID 0000.0001) ># GM_Visbeck_alpha = 0.,
234 (PID.TID 0000.0001) ># GM_Visbeck_length = 2.e+5,
235 (PID.TID 0000.0001) ># GM_Visbeck_depth = 1.e+3,
236 (PID.TID 0000.0001) ># GM_Visbeck_maxval_K= 2.5e+3,
237 (PID.TID 0000.0001) > /
238 (PID.TID 0000.0001) >
239 (PID.TID 0000.0001) >
240 (PID.TID 0000.0001)
241 (PID.TID 0000.0001) GM_READPARMS: finished reading data.gmredi
242 (PID.TID 0000.0001) CPL_READPARMS: opening data.cpl
243 (PID.TID 0000.0001) OPEN_COPY_DATA_FILE: opening file data.cpl
244 (PID.TID 0000.0001) // =======================================================
245 (PID.TID 0000.0001) // Parameter file "data.cpl"
246 (PID.TID 0000.0001) // =======================================================
247 (PID.TID 0000.0001) ># Coupling package parameters, OCN component:
248 (PID.TID 0000.0001) ># cpl_earlyExpImpCall :: call coupler early in the time stepping call sequence
249 (PID.TID 0000.0001) ># useImportHFlx :: True => use the Imported HeatFlux from couler
250 (PID.TID 0000.0001) ># useImportFW :: True => use the Imported Fresh Water flux fr cpl
251 (PID.TID 0000.0001) ># useImportTau :: True => use the Imported Wind-Stress from couler
252 (PID.TID 0000.0001) ># useImportSLP :: True => use the Imported Sea-level Atmos. Pressure
253 (PID.TID 0000.0001) ># useImportSIce :: True => use the Imported Sea-Ice loading
254 (PID.TID 0000.0001) ># cpl_taveFreq :: Frequency^-1 for time-Aver. output (s)
255 (PID.TID 0000.0001) > &CPL_OCN_PARAM
256 (PID.TID 0000.0001) ># cpl_earlyExpImpCall=.FALSE.,
257 (PID.TID 0000.0001) ># useImportHFlx=.FALSE.,
258 (PID.TID 0000.0001) ># useImportFW =.FALSE.,
259 (PID.TID 0000.0001) ># useImportTau =.FALSE.,
260 (PID.TID 0000.0001) > useImportSLP =.FALSE.,
261 (PID.TID 0000.0001) ># useImportSIce=.FALSE.,
262 (PID.TID 0000.0001) ># cpl_taveFreq=2592000.,
263 (PID.TID 0000.0001) > cpl_taveFreq=18000.,
264 (PID.TID 0000.0001) > /
265 (PID.TID 0000.0001) >
266 (PID.TID 0000.0001)
267 (PID.TID 0000.0001) CPL_READPARMS: finished reading data.cpl
268 (PID.TID 0000.0001)
269 (PID.TID 0000.0001) // ===================================
270 (PID.TID 0000.0001) // Coupling package parameters :
271 (PID.TID 0000.0001) // ===================================
272 (PID.TID 0000.0001) cpl_earlyExpImpCall= /* call coupler early in the time-stepping */
273 (PID.TID 0000.0001) T
274 (PID.TID 0000.0001) ;
275 (PID.TID 0000.0001) useImportHFlx= /* use Imported Heat-Flx fr Coupler on/off flag */
276 (PID.TID 0000.0001) T
277 (PID.TID 0000.0001) ;
278 (PID.TID 0000.0001) useImportFW = /* use Imported Fresh-Water fr Cpl. on/off flag */
279 (PID.TID 0000.0001) T
280 (PID.TID 0000.0001) ;
281 (PID.TID 0000.0001) useImportTau = /* use Imported Wind-Stress fr Cpl. on/off flag */
282 (PID.TID 0000.0001) T
283 (PID.TID 0000.0001) ;
284 (PID.TID 0000.0001) useImportSLP = /* use Imported Sea-level Atm Press on/off flag */
285 (PID.TID 0000.0001) F
286 (PID.TID 0000.0001) ;
287 (PID.TID 0000.0001) useImportSIce= /* use Imported Sea-Ice loading on/off flag */
288 (PID.TID 0000.0001) T
289 (PID.TID 0000.0001) ;
290 (PID.TID 0000.0001) useImportFIce= /* use Imported Sea-Ice Fract fr Cpl. on/off flag */
291 (PID.TID 0000.0001) F
292 (PID.TID 0000.0001) ;
293 (PID.TID 0000.0001) useImportCO2 = /* use Imported Atmos. CO2 fr Cpl. on/off flag */
294 (PID.TID 0000.0001) F
295 (PID.TID 0000.0001) ;
296 (PID.TID 0000.0001) useImportWSpd = /* use Imported Windspeed fr Cpl. on/off flag */
297 (PID.TID 0000.0001) F
298 (PID.TID 0000.0001) ;
299 (PID.TID 0000.0001) cpl_taveFreq = /* Frequency^-1 for time-Aver. output (s) */
300 (PID.TID 0000.0001) 1.800000000000000E+04
301 (PID.TID 0000.0001) ;
302 (PID.TID 0000.0001) cpl_timeave_mnc = /* write TimeAv to MNC file on/off flag */
303 (PID.TID 0000.0001) F
304 (PID.TID 0000.0001) ;
305 (PID.TID 0000.0001) cpl_timeave_mdsio = /* write TimeAv to MDSIO file on/off flag */
306 (PID.TID 0000.0001) T
307 (PID.TID 0000.0001) ;
308 (PID.TID 0000.0001) SET_PARMS: done
309 (PID.TID 0000.0001) Enter INI_VERTICAL_GRID: setInterFDr= T ; setCenterDr= F
310 (PID.TID 0000.0001) tile: 1 ; Read from file grid_cs32.face001.bin
311 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
312 (PID.TID 0000.0001) tile: 2 ; Read from file grid_cs32.face002.bin
313 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
314 (PID.TID 0000.0001) tile: 3 ; Read from file grid_cs32.face003.bin
315 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
316 (PID.TID 0000.0001) tile: 4 ; Read from file grid_cs32.face004.bin
317 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
318 (PID.TID 0000.0001) tile: 5 ; Read from file grid_cs32.face005.bin
319 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
320 (PID.TID 0000.0001) tile: 6 ; Read from file grid_cs32.face006.bin
321 (PID.TID 0000.0001) => xC yC dxF dyF rA xG yG dxV dyU rAz dxC dyC rAw rAs dxG dyG AngleCS AngleSN
322 (PID.TID 0000.0001) %MON XC_max = 1.7854351589505E+02
323 (PID.TID 0000.0001) %MON XC_min = -1.7854351589505E+02
324 (PID.TID 0000.0001) %MON XC_mean = -4.6999441375798E-15
325 (PID.TID 0000.0001) %MON XC_sd = 1.0355545336287E+02
326 (PID.TID 0000.0001) %MON XG_max = 1.8000000000000E+02
327 (PID.TID 0000.0001) %MON XG_min = -1.7708797161002E+02
328 (PID.TID 0000.0001) %MON XG_mean = 1.8603515625000E+00
329 (PID.TID 0000.0001) %MON XG_sd = 1.0357130300504E+02
330 (PID.TID 0000.0001) %MON DXC_max = 3.2375185836900E+05
331 (PID.TID 0000.0001) %MON DXC_min = 1.1142031410131E+05
332 (PID.TID 0000.0001) %MON DXC_mean = 2.8605689051214E+05
333 (PID.TID 0000.0001) %MON DXC_sd = 3.4042087138252E+04
334 (PID.TID 0000.0001) %MON DXF_max = 3.2369947500827E+05
335 (PID.TID 0000.0001) %MON DXF_min = 1.2020820513318E+05
336 (PID.TID 0000.0001) %MON DXF_mean = 2.8605437324820E+05
337 (PID.TID 0000.0001) %MON DXF_sd = 3.4050524252539E+04
338 (PID.TID 0000.0001) %MON DXG_max = 3.2375195872773E+05
339 (PID.TID 0000.0001) %MON DXG_min = 1.0098378008791E+05
340 (PID.TID 0000.0001) %MON DXG_mean = 2.8603818508931E+05
341 (PID.TID 0000.0001) %MON DXG_sd = 3.4140406908005E+04
342 (PID.TID 0000.0001) %MON DXV_max = 3.2380418162750E+05
343 (PID.TID 0000.0001) %MON DXV_min = 8.0152299824136E+04
344 (PID.TID 0000.0001) %MON DXV_mean = 2.8603970633619E+05
345 (PID.TID 0000.0001) %MON DXV_sd = 3.4145142117723E+04
346 (PID.TID 0000.0001) %MON YC_max = 8.7940663871962E+01
347 (PID.TID 0000.0001) %MON YC_min = -8.7940663871962E+01
348 (PID.TID 0000.0001) %MON YC_mean = 0.0000000000000E+00
349 (PID.TID 0000.0001) %MON YC_sd = 3.8676242969072E+01
350 (PID.TID 0000.0001) %MON YG_max = 9.0000000000000E+01
351 (PID.TID 0000.0001) %MON YG_min = -9.0000000000000E+01
352 (PID.TID 0000.0001) %MON YG_mean = -1.1842378929335E-15
353 (PID.TID 0000.0001) %MON YG_sd = 3.8676895860710E+01
354 (PID.TID 0000.0001) %MON DYC_max = 3.2375185836900E+05
355 (PID.TID 0000.0001) %MON DYC_min = 1.1142031410131E+05
356 (PID.TID 0000.0001) %MON DYC_mean = 2.8605689051214E+05
357 (PID.TID 0000.0001) %MON DYC_sd = 3.4042087138252E+04
358 (PID.TID 0000.0001) %MON DYF_max = 3.2369947500827E+05
359 (PID.TID 0000.0001) %MON DYF_min = 1.2020820513318E+05
360 (PID.TID 0000.0001) %MON DYF_mean = 2.8605437324820E+05
361 (PID.TID 0000.0001) %MON DYF_sd = 3.4050524252539E+04
362 (PID.TID 0000.0001) %MON DYG_max = 3.2375195872773E+05
363 (PID.TID 0000.0001) %MON DYG_min = 1.0098378008791E+05
364 (PID.TID 0000.0001) %MON DYG_mean = 2.8603818508931E+05
365 (PID.TID 0000.0001) %MON DYG_sd = 3.4140406908005E+04
366 (PID.TID 0000.0001) %MON DYU_max = 3.2380418162750E+05
367 (PID.TID 0000.0001) %MON DYU_min = 8.0152299824136E+04
368 (PID.TID 0000.0001) %MON DYU_mean = 2.8603970633619E+05
369 (PID.TID 0000.0001) %MON DYU_sd = 3.4145142117723E+04
370 (PID.TID 0000.0001) %MON RA_max = 1.0479260248419E+11
371 (PID.TID 0000.0001) %MON RA_min = 1.4019007022556E+10
372 (PID.TID 0000.0001) %MON RA_mean = 8.2992246709265E+10
373 (PID.TID 0000.0001) %MON RA_sd = 1.7509089299457E+10
374 (PID.TID 0000.0001) %MON RAW_max = 1.0480965274559E+11
375 (PID.TID 0000.0001) %MON RAW_min = 1.2166903467143E+10
376 (PID.TID 0000.0001) %MON RAW_mean = 8.2992246709235E+10
377 (PID.TID 0000.0001) %MON RAW_sd = 1.7481917919656E+10
378 (PID.TID 0000.0001) %MON RAS_max = 1.0480965274559E+11
379 (PID.TID 0000.0001) %MON RAS_min = 1.2166903467143E+10
380 (PID.TID 0000.0001) %MON RAS_mean = 8.2992246709235E+10
381 (PID.TID 0000.0001) %MON RAS_sd = 1.7481917919656E+10
382 (PID.TID 0000.0001) %MON RAZ_max = 1.0484349334619E+11
383 (PID.TID 0000.0001) %MON RAZ_min = 8.8317900612505E+09
384 (PID.TID 0000.0001) %MON RAZ_mean = 8.2992246709235E+10
385 (PID.TID 0000.0001) %MON RAZ_sd = 1.7482297311044E+10
386 (PID.TID 0000.0001) %MON AngleCS_max = 9.9999994756719E-01
387 (PID.TID 0000.0001) %MON AngleCS_min = -9.9968286884824E-01
388 (PID.TID 0000.0001) %MON AngleCS_mean = 3.3078850405987E-01
389 (PID.TID 0000.0001) %MON AngleCS_sd = 6.2496317138039E-01
390 (PID.TID 0000.0001) %MON AngleSN_max = 9.9968286884824E-01
391 (PID.TID 0000.0001) %MON AngleSN_min = -9.9999994756719E-01
392 (PID.TID 0000.0001) %MON AngleSN_mean = -3.3078850405987E-01
393 (PID.TID 0000.0001) %MON AngleSN_sd = 6.2496317138039E-01
394 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: bathy_Hmin50.bin
395 (PID.TID 0000.0001) // =======================================================
396 (PID.TID 0000.0001) // Field Model R_low (ini_masks_etc)
397 (PID.TID 0000.0001) // CMIN = -5.200000000000000E+03
398 (PID.TID 0000.0001) // CMAX = -5.000000000000000E+01
399 (PID.TID 0000.0001) // CINT = 1.907407407407407E+02
400 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
401 (PID.TID 0000.0001) // 0.0: .
402 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
403 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
404 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
405 (PID.TID 0000.0001) // =======================================================
406 (PID.TID 0000.0001) K = 1
407 (PID.TID 0000.0001) // I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
408 (PID.TID 0000.0001) // |--J--|101234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
409 (PID.TID 0000.0001) // 34 -ba-abcehjnldcclz+........spps...................................vkqn+xnbbcbba--aabfu+..............hcbaaaaaaaaaccdccbaaabbddddccdffffghfeeeeedeffefilhfcaaaacgceei.......zomggfcaeccaecbbccddefilihecbaacbaajfega-aesfe
410 (PID.TID 0000.0001) // 33 abbbccceiomkfdbbc+.......+s......................................xsrxzz+cddb-----adu+...............hcbaa--aa--accddba--bbbddddccdfffhhgfeeddcceeddfgikhfffdfgccffw........zohhgebbaebbaaaaaccdfhlhfefdcccaabjefbaaafoos
411 (PID.TID 0000.0001) // 32 bddefhhkqqlgfaakqz..v.+..+.....................................++..u+...fdba----adu+................kdcaaa-aaa-accdcb---bbbcdddddefffggfeeedccccbbdcdfgghhiihcbeiw.........+ynjgebaaebaaaa-aacccfikkhecccbbbaaabaadfklnq
412 (PID.TID 0000.0001) // 31 bcffijnpnqneaaat..umrr+s.z.....................................+++++.ztsfeb--dfdfu+................+lkdca--aa--abcccb---bbbbddddeffflhfeeeecbbbb-abbacbcdceffbbfw+..........++ujfbaafbaaa----aacffiljgfffcca--adfikkiihh
413 (PID.TID 0000.0001) // 30 adgillkkkifcadcx.ymmqzqikvnnps.................................+++++wmegifcacdlqx+++...............mligea---a---abbbb---abaaddddeedkmeddefdbbbaa---b--aaaaabaabm..............+viba-iba-------acdefinmlgiieb-chnnnmlmlgf
414 (PID.TID 0000.0001) // 29 cfiljigfjd--efdozy...+ximpnnuz..................................+++yqddhjhcbbchz+......++.........+mmhffc---c----aaba------acdddcbcineddgdbaaa--d--a------aa-bfz...............+qe--qe---aa---aedeegknmlgiigcdfhpokkimlf
415 (PID.TID 0000.0001) // 28 bgkhfcccea-bdei........t........................................++zwgfcfnhccbbhwwy.....+++........+njfeed---d-----aa-------abddcabcnfddegcaaa---f------------dk+................+ja-+ja------bffdddehfd--bedaacfhpnligii
416 (PID.TID 0000.0001) // 27 cghfbaaaa-achmy..........................+++....................++vnbbbcpkeeecflmqxy....++........+lhfeecc--cc------------aaadcbabcfhddccba-----d-----------irw.................++e-++e-----mhmijddda--------ahhfiokhede
417 (PID.TID 0000.0001) // 26 dhfca-----bfiv...........................++sy...................+tq-fdbbnqiheddefhiksz++++........zkhfdccb--cb------------aabdcaaaacfddbca------fa-abb-----vvv...................+wa.+wa---mlmkijhc----------cjjffiheb-a
418 (PID.TID 0000.0001) // 25 chfa------ch+..................w...........njo+................+x-----bcqqojfefiiiijmy.++.........zkhfdbaa--aa-------daa---acccaaaacccca--------udaabbb----tei...................++q.++qdeqnghiljcaaaaidaa----beedeeca--
419 (PID.TID 0000.0001) // 24 eifa--acbcei...................w...........likn+.....++.....++znpa----bbnlmnjhinlksssw............qhfeca------------addc--aeffaaaaaaccb-a----a--+udbbaba---ven....................++..++xywnfgllcbbabegkecba----ddddcaac
420 (PID.TID 0000.0001) // 23 fida-aabchjk...................zz...z.....nhhijz....tqq.....+ujgzgd---abegklkkknols..xuu..........zgfdba------------bcd---affaaadffabbb-----aa-b.+ufb-----l.gx...........s.........+...++zzkfilfccccoz..ulkcd---bccnfddd
421 (PID.TID 0000.0001) // 22 fhfaa---bfgi....................zz..zz..rnjffggm...nlmn+....+sffzya--aabaffdfhimrmp...yuu.++.......zudba------------adc---dda-adffe-aa--------aa..+ufc-baaqvhh..........dcfeeh..........++zggqvifefhz......zobbaccfwuffe
422 (PID.TID 0000.0001) // 21 bcgca----abe.....................yss.ysstlgeeeeoz..ijklt+....lfjzzf---adaadcehllotq....yy+++zzs.....+zcba---a-------cdd--aaa----df------------aa...+upjdcy.vohq.......+idcdfeeefwz..wz....+hhn.vklox.........gdccfjwrigf
423 (PID.TID 0000.0001) // 20 bbcgfcaa-aae+...........................lcgfdddhq.+hiilnz++.+oquxyz--adgaabcfmtooyxz......+yuiiy....++gb------------ddcca-a-----acbaa------bbaaa......ywxy.lulo.lv...kcdgddffefffilyfilyx+fffk.+xyyy.........mgeimvskjkl
424 (PID.TID 0000.0001) // 19 feccdghfeegcbt..........................aafifccgnrzgghjry.+++sr+lq.--edftkblwnnsp.vv......skhggt...+++t-------------bdaf---------edd-------adlaa.........vnhzy.tllqiedccdhggfggffiigfiiggfcbdgy..yz..........xigqophijkk
425 (PID.TID 0000.0001) // 18 wifedfkhfegbbcivlqfoz..............j...jaacfihggokeeffgt..++++..hhlfdedd.qcz+.zwxtsttz..ysrkhot++++++zig------------b--f---------egqqqaa----frb-.......+kkrhw.vqmlnieddcdehgggffgigegigedbaaceiy.............zilrddefikk
426 (PID.TID 0000.0001) // 17 +wfeefikhgcbbccaaacgn.............ic..icaaccfihfoedddeedy..++...nnqwgfee.z++..+zsjjllllljllpjos+++.+zhhi---------e-----ea--------foqqoqqo--hlwge.......+nk+..xiioonhfefddegihhghigfdigfdbaaabdgx..............nheddefikl
427 (PID.TID 0000.0001) // 16 ..wiheddeccdfhfbabdfl............jdb.jdbaddddgifkccccdccd+.++..++ynvz.tku....++zyslllllkhggkmpy++...ihhi---------ea---feb-----a-acnoohfghknvmwnu........qhu..hhhkojgffgeefghihhiieedieedbaaabcdy..............ygddeghilj
428 (PID.TID 0000.0001) // 15 ....ylea--acfihebcbbes..........sfcbsfcbbngfffigcaaabdbcac+.+++++zgmpx..m....++..zslwz.yhhhhnz+++...rhgc--------ab----ige----acaaalllkddfiy..ysw........thk.xgghiligfghfefhhhhiiheedheedcdbbabdmz.............zfdeghikki
429 (PID.TID 0000.0001) // 14 ......c---acgkhdcc--di..........ofddofddchohffikaaaaabaaa-aw+.+ysnggox++rv..........yzzzzrjil+++....qhgd---------a-----i---cccdeabkklldinqssy..x.........+y.uhghikihgfghefgihhhgeeeeeeeeeddbaadhw.............nedeghjjhf
430 (PID.TID 0000.0001) // 13 .....+b----cfkhec---afz.........nhfdnhfdffholghkaaaaaba-a---flkkuswyy+++r...........zzzzz++ry++......yd------------------aeecdeidfkkqnqlmqquukqq............iihiijjhfefgefhjihiffgggfgggffecaabelx...........zjecehijhfe
431 (PID.TID 0000.0001) // 12 .....ec----chjhec---ag..........skiqskiqddeiiiifaaabae--a---dd--iu+++.++++..........+z+++++.+++....++.s----------------a-ceccdejhlllkqlkklssiccd...........wjkkkjjjigeefffgjiiighiiihiiihhhdaabdffghtxx......mfccehjiffd
432 (PID.TID 0000.0001) // 11 ....pdca--achlheba--ai..........nkn.nkn.fdemijidaaaabi-------a--q+....++s...........+++++..........+yyza--------b-----a--ccccddkhieekkossssfbbbb..........njjijhhihijhgggggjjjjijkkkjkkkkjjhcaacddeegpy.....xfdccdhjgfdd
433 (PID.TID 0000.0001) // 10 ....wfdb--achlhea---an.........uos..os..dcemikkfdcaabi-------equ+..................................zyvuq--------cc----a---dcfhkopqjeissrnpfbbccc........zslihhigghgijjihhhhkllkkkkkkkkkkjkkkedccdeeeeipz..zwhccbcdhgfddc
434 (PID.TID 0000.0001) // 9 ....vgec---bfikca--cjl+.......+nnv.+nv.+ccffhkkiddaadha-----as++........z++........................zxuuk----------a---a----djmqrrnlllsoiddcccccd.......+zjijhfgfggffhjkkkiillljihhghhhghgihighdeeffgghimnnjgecbbcdgfeccb
435 (PID.TID 0000.0001) // 8 ...zleca---afjfca--hdfz.......vkky.jky.jceddefijffdddhb--a-afv............ss.........................+yku---u--------------ejnpqqnninnritqdccchk......wihgghgeffffeefhijkjkljiigeeffeeffefffhjhhikkklljklmhffeeeggfdcbaa
436 (PID.TID 0000.0001) // 7 .+zohec--abcfkhecbchbdx.......qiht.fht.faaaabdgijgfededcdcb-f+.............pz.........................+zu---u--------------edefqgqddsz+......+yu+....tiggfggfeeeefeeefiiiijkiihhedddeddddddddjjllliijhfkmmkkjjhijgdcba--
437 (PID.TID 0000.0001) // 6 +yomfddcaabefkifdchaadt......uqdeisceisc----dfefgifffkklldc--v.............pp.........................v.x---x---------a----fbbpqgzenx+........zdlkhhfffffffgfeeeeeeeefhhhhijihhffddcfddcbbbbdhhiihedddb-cfhhhjjjieca----
438 (PID.TID 0000.0001) // 5 +nhgffkghccfhkhffgdaackz....uoibcimlcimlaaacfbddfjjhijeehf-a-c.............su.........................qk.yi-.yi-------gha-fjddqs+xkrz.........q-kdccdeeeeeeedddedddddgghhhhjhhgffcbbfcbbaaaaddfegecca----dfeefhfgdb-----
439 (PID.TID 0000.0001) // 4 ujhgfllfhdffhkfffca-aady...llnabdopfdopfcbdgdbcdehlihgfddc--ms........................................okn.zdn.zd---eciiiicfkeeqy.ysz..........n-dcbbdeddedcdcccdddcddffggghiggfffdbafdbaa---acdcccba--abvfedeffdcca----b
440 (PID.TID 0000.0001) // 3 jggfcceeffffjlkjgaa---bfvheeln-aesphesphfdhgabddeflihhgfecbaaayq+++++.................................kqnz.vnz.vtpkllgdccfkkkkk..++..........+g-caaadcdddcbbbbcdddcccdffffghgffffdcafdcaa----abcaaaa-acxxmecdjmdbba----r
441 (PID.TID 0000.0001) // 2 feecbbccddefilihecbaacbaajfega-aesqhesqhffiea-cdeflkkljifeddcba---bry+...............................vkqn+.sn+.sghfcbcbbbdgfdek.++++.........+l-aaaaccdccbaaabbddddccdffffghfeeeeecbeecba------baaaa-euwxqdbcdkud-----sy
442 (PID.TID 0000.0001) // 1 bbbaaaaaccdfhlhfefdcccaabjefbaaafonhfonhglid--adfgkkkklkhffddca-----s+++.............................xsrxz.txz.tedcbbbbaaadddet.++++.........+l--a-accddba--bbbddddccdfffhhgfeeddccbdccba-------aaaabgns.qcbcchyzqngll++
443 (PID.TID 0000.0001) // 0 aaaaaa-aacccfikkhecccbbbaaabaadfkllikllilmgebaadfijjiiikjhffdcba-----lll...........................++..u+..z+..zmdfbd---a-aeef.xx+..........+++s---accdcb---bbbcdddddefffggfeeedcccbcccbba----aa--alrwwy.kcbccc+...++++.
444 (PID.TID 0000.0001) // -1 aaaaa----aacffiljgfffcca--adfikkiikiiikimiiheccfurkiffhijjigfecb-----l--...........................+++++.z+..z+.wqgbf-------dgzpoy+........+ys+yaa-abcccb---bbbbddddeffflhfeeeecbbcbbbcbbaa----a--bdflm.yuibbcc.......+.
445 (PID.TID 0000.0001) // =======================================================
446 (PID.TID 0000.0001) // END OF FIELD =
447 (PID.TID 0000.0001) // =======================================================
448 (PID.TID 0000.0001)
449 (PID.TID 0000.0001) // =======================================================
450 (PID.TID 0000.0001) // Field Model Ro_surf (ini_masks_etc)
451 (PID.TID 0000.0001) // CMIN = -7.105427357601002E-15
452 (PID.TID 0000.0001) // CMAX = -7.105427357601002E-15
453 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
454 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
455 (PID.TID 0000.0001) // 0.0: .
456 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
457 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
458 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
459 (PID.TID 0000.0001) // =======================================================
460 (PID.TID 0000.0001) // =======================================================
461 (PID.TID 0000.0001) // END OF FIELD =
462 (PID.TID 0000.0001) // =======================================================
463 (PID.TID 0000.0001)
464 (PID.TID 0000.0001) // =======================================================
465 (PID.TID 0000.0001) // Field hFacC at iteration 0
466 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
467 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
468 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
469 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
470 (PID.TID 0000.0001) // 0.0: .
471 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
472 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
473 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
474 (PID.TID 0000.0001) // =======================================================
475 (PID.TID 0000.0001) // =======================================================
476 (PID.TID 0000.0001) // END OF FIELD =
477 (PID.TID 0000.0001) // =======================================================
478 (PID.TID 0000.0001)
479 (PID.TID 0000.0001) // =======================================================
480 (PID.TID 0000.0001) // Field hFacW at iteration 0
481 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
482 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
483 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
484 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
485 (PID.TID 0000.0001) // 0.0: .
486 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
487 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
488 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
489 (PID.TID 0000.0001) // =======================================================
490 (PID.TID 0000.0001) // =======================================================
491 (PID.TID 0000.0001) // END OF FIELD =
492 (PID.TID 0000.0001) // =======================================================
493 (PID.TID 0000.0001)
494 (PID.TID 0000.0001) // =======================================================
495 (PID.TID 0000.0001) // Field hFacS at iteration 0
496 (PID.TID 0000.0001) // CMIN = 1.000000000000000E+00
497 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+00
498 (PID.TID 0000.0001) // CINT = 0.000000000000000E+00
499 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
500 (PID.TID 0000.0001) // 0.0: .
501 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
502 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
503 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
504 (PID.TID 0000.0001) // =======================================================
505 (PID.TID 0000.0001) // =======================================================
506 (PID.TID 0000.0001) // END OF FIELD =
507 (PID.TID 0000.0001) // =======================================================
508 (PID.TID 0000.0001)
509 (PID.TID 0000.0001) GAD_INIT_FIXED: GAD_OlMinSize= 1 0 1
510 (PID.TID 0000.0001)
511 (PID.TID 0000.0001) // ===================================
512 (PID.TID 0000.0001) // GAD parameters :
513 (PID.TID 0000.0001) // ===================================
514 (PID.TID 0000.0001) tempAdvScheme = /* Temp. Horiz.Advection scheme selector */
515 (PID.TID 0000.0001) 2
516 (PID.TID 0000.0001) ;
517 (PID.TID 0000.0001) tempVertAdvScheme = /* Temp. Vert. Advection scheme selector */
518 (PID.TID 0000.0001) 2
519 (PID.TID 0000.0001) ;
520 (PID.TID 0000.0001) tempMultiDimAdvec = /* use Muti-Dim Advec method for Temp */
521 (PID.TID 0000.0001) F
522 (PID.TID 0000.0001) ;
523 (PID.TID 0000.0001) tempSOM_Advection = /* use 2nd Order Moment Advection for Temp */
524 (PID.TID 0000.0001) F
525 (PID.TID 0000.0001) ;
526 (PID.TID 0000.0001) AdamsBashforthGt = /* apply Adams-Bashforth extrapolation on Gt */
527 (PID.TID 0000.0001) T
528 (PID.TID 0000.0001) ;
529 (PID.TID 0000.0001) AdamsBashforth_T = /* apply Adams-Bashforth extrapolation on Temp */
530 (PID.TID 0000.0001) F
531 (PID.TID 0000.0001) ;
532 (PID.TID 0000.0001) saltAdvScheme = /* Salt. Horiz.advection scheme selector */
533 (PID.TID 0000.0001) 2
534 (PID.TID 0000.0001) ;
535 (PID.TID 0000.0001) saltVertAdvScheme = /* Salt. Vert. Advection scheme selector */
536 (PID.TID 0000.0001) 2
537 (PID.TID 0000.0001) ;
538 (PID.TID 0000.0001) saltMultiDimAdvec = /* use Muti-Dim Advec method for Salt */
539 (PID.TID 0000.0001) F
540 (PID.TID 0000.0001) ;
541 (PID.TID 0000.0001) saltSOM_Advection = /* use 2nd Order Moment Advection for Salt */
542 (PID.TID 0000.0001) F
543 (PID.TID 0000.0001) ;
544 (PID.TID 0000.0001) AdamsBashforthGs = /* apply Adams-Bashforth extrapolation on Gs */
545 (PID.TID 0000.0001) T
546 (PID.TID 0000.0001) ;
547 (PID.TID 0000.0001) AdamsBashforth_S = /* apply Adams-Bashforth extrapolation on Salt */
548 (PID.TID 0000.0001) F
549 (PID.TID 0000.0001) ;
550 (PID.TID 0000.0001) // ===================================
551 (PID.TID 0000.0001) %MON fCori_max = 1.4574827780704E-04
552 (PID.TID 0000.0001) %MON fCori_min = -1.4574827780704E-04
553 (PID.TID 0000.0001) %MON fCori_mean = 0.0000000000000E+00
554 (PID.TID 0000.0001) %MON fCori_sd = 8.4202189509968E-05
555 (PID.TID 0000.0001) %MON fCoriG_max = 1.4584247033981E-04
556 (PID.TID 0000.0001) %MON fCoriG_min = -1.4584247033981E-04
557 (PID.TID 0000.0001) %MON fCoriG_mean = 2.2587545260115E-21
558 (PID.TID 0000.0001) %MON fCoriG_sd = 8.4202189509968E-05
559 (PID.TID 0000.0001) %MON fCoriCos_max = 1.4580166994612E-04
560 (PID.TID 0000.0001) %MON fCoriCos_min = 5.2407700865903E-06
561 (PID.TID 0000.0001) %MON fCoriCos_mean = 1.1514045869113E-04
562 (PID.TID 0000.0001) %MON fCoriCos_sd = 3.0375849106513E-05
563 (PID.TID 0000.0001) INI_CG2D: CG2D normalisation factor = 1.9156564154949553E-04
564 (PID.TID 0000.0001)
565 (PID.TID 0000.0001) // =======================================================
566 (PID.TID 0000.0001) // Model configuration
567 (PID.TID 0000.0001) // =======================================================
568 (PID.TID 0000.0001) //
569 (PID.TID 0000.0001) // "Physical" paramters ( PARM01 in namelist )
570 (PID.TID 0000.0001) //
571 (PID.TID 0000.0001) buoyancyRelation = /* Type of relation to get Buoyancy */
572 (PID.TID 0000.0001) 'OCEANIC'
573 (PID.TID 0000.0001) ;
574 (PID.TID 0000.0001) fluidIsAir = /* fluid major constituent is Air */
575 (PID.TID 0000.0001) F
576 (PID.TID 0000.0001) ;
577 (PID.TID 0000.0001) fluidIsWater = /* fluid major constituent is Water */
578 (PID.TID 0000.0001) T
579 (PID.TID 0000.0001) ;
580 (PID.TID 0000.0001) usingPCoords = /* use p (or p*) vertical coordinate */
581 (PID.TID 0000.0001) F
582 (PID.TID 0000.0001) ;
583 (PID.TID 0000.0001) usingZCoords = /* use z (or z*) vertical coordinate */
584 (PID.TID 0000.0001) T
585 (PID.TID 0000.0001) ;
586 (PID.TID 0000.0001) tRef = /* Reference temperature profile ( oC or K ) */
587 (PID.TID 0000.0001) 15 @ 2.000000000000000E+01 /* K = 1: 15 */
588 (PID.TID 0000.0001) ;
589 (PID.TID 0000.0001) sRef = /* Reference salinity profile ( psu ) */
590 (PID.TID 0000.0001) 15 @ 3.500000000000000E+01 /* K = 1: 15 */
591 (PID.TID 0000.0001) ;
592 (PID.TID 0000.0001) viscAh = /* Lateral eddy viscosity ( m^2/s ) */
593 (PID.TID 0000.0001) 3.000000000000000E+05
594 (PID.TID 0000.0001) ;
595 (PID.TID 0000.0001) viscAhMax = /* Maximum lateral eddy viscosity ( m^2/s ) */
596 (PID.TID 0000.0001) 1.000000000000000E+21
597 (PID.TID 0000.0001) ;
598 (PID.TID 0000.0001) viscAhGrid = /* Grid dependent lateral eddy viscosity ( non-dim. ) */
599 (PID.TID 0000.0001) 0.000000000000000E+00
600 (PID.TID 0000.0001) ;
601 (PID.TID 0000.0001) useFullLeith = /* Use Full Form of Leith Viscosity on/off flag*/
602 (PID.TID 0000.0001) F
603 (PID.TID 0000.0001) ;
604 (PID.TID 0000.0001) useStrainTensionVisc= /* Use StrainTension Form of Viscous Operator flag*/
605 (PID.TID 0000.0001) F
606 (PID.TID 0000.0001) ;
607 (PID.TID 0000.0001) useAreaViscLength = /* Use area for visc length instead of geom. mean*/
608 (PID.TID 0000.0001) F
609 (PID.TID 0000.0001) ;
610 (PID.TID 0000.0001) viscC2leith = /* Leith harmonic visc. factor (on grad(vort),non-dim.) */
611 (PID.TID 0000.0001) 0.000000000000000E+00
612 (PID.TID 0000.0001) ;
613 (PID.TID 0000.0001) viscC2leithD = /* Leith harmonic viscosity factor (on grad(div),non-dim.)*/
614 (PID.TID 0000.0001) 0.000000000000000E+00
615 (PID.TID 0000.0001) ;
616 (PID.TID 0000.0001) viscC2smag = /* Smagorinsky harmonic viscosity factor (non-dim.) */
617 (PID.TID 0000.0001) 0.000000000000000E+00
618 (PID.TID 0000.0001) ;
619 (PID.TID 0000.0001) viscA4 = /* Lateral biharmonic viscosity ( m^4/s ) */
620 (PID.TID 0000.0001) 0.000000000000000E+00
621 (PID.TID 0000.0001) ;
622 (PID.TID 0000.0001) viscA4Max = /* Maximum biharmonic viscosity ( m^2/s ) */
623 (PID.TID 0000.0001) 1.000000000000000E+21
624 (PID.TID 0000.0001) ;
625 (PID.TID 0000.0001) viscA4Grid = /* Grid dependent biharmonic viscosity ( non-dim. ) */
626 (PID.TID 0000.0001) 0.000000000000000E+00
627 (PID.TID 0000.0001) ;
628 (PID.TID 0000.0001) viscC4leith = /* Leith biharm viscosity factor (on grad(vort), non-dim.)*/
629 (PID.TID 0000.0001) 0.000000000000000E+00
630 (PID.TID 0000.0001) ;
631 (PID.TID 0000.0001) viscC4leithD = /* Leith biharm viscosity factor (on grad(div), non-dim.) */
632 (PID.TID 0000.0001) 0.000000000000000E+00
633 (PID.TID 0000.0001) ;
634 (PID.TID 0000.0001) viscC4Smag = /* Smagorinsky biharm viscosity factor (non-dim) */
635 (PID.TID 0000.0001) 0.000000000000000E+00
636 (PID.TID 0000.0001) ;
637 (PID.TID 0000.0001) no_slip_sides = /* Viscous BCs: No-slip sides */
638 (PID.TID 0000.0001) T
639 (PID.TID 0000.0001) ;
640 (PID.TID 0000.0001) sideDragFactor = /* side-drag scaling factor (non-dim) */
641 (PID.TID 0000.0001) 2.000000000000000E+00
642 (PID.TID 0000.0001) ;
643 (PID.TID 0000.0001) viscArNr = /* vertical profile of vertical viscosity ( m^2/s )*/
644 (PID.TID 0000.0001) 15 @ 1.000000000000000E-03 /* K = 1: 15 */
645 (PID.TID 0000.0001) ;
646 (PID.TID 0000.0001) no_slip_bottom = /* Viscous BCs: No-slip bottom */
647 (PID.TID 0000.0001) T
648 (PID.TID 0000.0001) ;
649 (PID.TID 0000.0001) bottomDragLinear = /* linear bottom-drag coefficient ( m/s ) */
650 (PID.TID 0000.0001) 0.000000000000000E+00
651 (PID.TID 0000.0001) ;
652 (PID.TID 0000.0001) bottomDragQuadratic = /* quadratic bottom-drag coefficient (-) */
653 (PID.TID 0000.0001) 0.000000000000000E+00
654 (PID.TID 0000.0001) ;
655 (PID.TID 0000.0001) diffKhT = /* Laplacian diffusion of heat laterally ( m^2/s ) */
656 (PID.TID 0000.0001) 0.000000000000000E+00
657 (PID.TID 0000.0001) ;
658 (PID.TID 0000.0001) diffK4T = /* Biharmonic diffusion of heat laterally ( m^4/s ) */
659 (PID.TID 0000.0001) 0.000000000000000E+00
660 (PID.TID 0000.0001) ;
661 (PID.TID 0000.0001) diffKhS = /* Laplacian diffusion of salt laterally ( m^2/s ) */
662 (PID.TID 0000.0001) 0.000000000000000E+00
663 (PID.TID 0000.0001) ;
664 (PID.TID 0000.0001) diffK4S = /* Biharmonic diffusion of salt laterally ( m^4/s ) */
665 (PID.TID 0000.0001) 0.000000000000000E+00
666 (PID.TID 0000.0001) ;
667 (PID.TID 0000.0001) diffKrNrT = /* vertical profile of vertical diffusion of Temp ( m^2/s )*/
668 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
669 (PID.TID 0000.0001) ;
670 (PID.TID 0000.0001) diffKrNrS = /* vertical profile of vertical diffusion of Salt ( m^2/s )*/
671 (PID.TID 0000.0001) 15 @ 3.000000000000000E-05 /* K = 1: 15 */
672 (PID.TID 0000.0001) ;
673 (PID.TID 0000.0001) diffKrBL79surf = /* Surface diffusion for Bryan and Lewis 79 ( m^2/s ) */
674 (PID.TID 0000.0001) 0.000000000000000E+00
675 (PID.TID 0000.0001) ;
676 (PID.TID 0000.0001) diffKrBL79deep = /* Deep diffusion for Bryan and Lewis 1979 ( m^2/s ) */
677 (PID.TID 0000.0001) 0.000000000000000E+00
678 (PID.TID 0000.0001) ;
679 (PID.TID 0000.0001) diffKrBL79scl = /* Depth scale for Bryan and Lewis 1979 ( m ) */
680 (PID.TID 0000.0001) 2.000000000000000E+02
681 (PID.TID 0000.0001) ;
682 (PID.TID 0000.0001) diffKrBL79Ho = /* Turning depth for Bryan and Lewis 1979 ( m ) */
683 (PID.TID 0000.0001) -2.000000000000000E+03
684 (PID.TID 0000.0001) ;
685 (PID.TID 0000.0001) ivdc_kappa = /* Implicit Vertical Diffusivity for Convection ( m^2/s) */
686 (PID.TID 0000.0001) 1.000000000000000E+01
687 (PID.TID 0000.0001) ;
688 (PID.TID 0000.0001) hMixCriteria= /* Criteria for mixed-layer diagnostic */
689 (PID.TID 0000.0001) -8.000000000000000E-01
690 (PID.TID 0000.0001) ;
691 (PID.TID 0000.0001) dRhoSmall = /* Parameter for mixed-layer diagnostic */
692 (PID.TID 0000.0001) 1.000000000000000E-06
693 (PID.TID 0000.0001) ;
694 (PID.TID 0000.0001) hMixSmooth= /* Smoothing parameter for mixed-layer diagnostic */
695 (PID.TID 0000.0001) 0.000000000000000E+00
696 (PID.TID 0000.0001) ;
697 (PID.TID 0000.0001) eosType = /* Type of Equation of State */
698 (PID.TID 0000.0001) 'JMD95Z'
699 (PID.TID 0000.0001) ;
700 (PID.TID 0000.0001) tAlpha = /* Linear EOS thermal expansion coefficient ( 1/oC ) */
701 (PID.TID 0000.0001) 1.234567000000000E+05
702 (PID.TID 0000.0001) ;
703 (PID.TID 0000.0001) sBeta = /* Linear EOS haline contraction coefficient ( 1/psu ) */
704 (PID.TID 0000.0001) 1.234567000000000E+05
705 (PID.TID 0000.0001) ;
706 (PID.TID 0000.0001) rhonil = /* Reference density ( kg/m^3 ) */
707 (PID.TID 0000.0001) 9.998000000000000E+02
708 (PID.TID 0000.0001) ;
709 (PID.TID 0000.0001) rhoConst = /* Reference density ( kg/m^3 ) */
710 (PID.TID 0000.0001) 1.030000000000000E+03
711 (PID.TID 0000.0001) ;
712 (PID.TID 0000.0001) rhoFacC = /* normalized Reference density @ cell-Center (-) */
713 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
714 (PID.TID 0000.0001) ;
715 (PID.TID 0000.0001) rhoFacF = /* normalized Reference density @ W-Interface (-) */
716 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
717 (PID.TID 0000.0001) ;
718 (PID.TID 0000.0001) rhoConstFresh = /* Reference density ( kg/m^3 ) */
719 (PID.TID 0000.0001) 1.000000000000000E+03
720 (PID.TID 0000.0001) ;
721 (PID.TID 0000.0001) gravity = /* Gravitational acceleration ( m/s^2 ) */
722 (PID.TID 0000.0001) 9.810000000000000E+00
723 (PID.TID 0000.0001) ;
724 (PID.TID 0000.0001) gBaro = /* Barotropic gravity ( m/s^2 ) */
725 (PID.TID 0000.0001) 9.810000000000000E+00
726 (PID.TID 0000.0001) ;
727 (PID.TID 0000.0001) rotationPeriod = /* Rotation Period ( s ) */
728 (PID.TID 0000.0001) 8.616400000000000E+04
729 (PID.TID 0000.0001) ;
730 (PID.TID 0000.0001) omega = /* Angular velocity ( rad/s ) */
731 (PID.TID 0000.0001) 7.292123516990375E-05
732 (PID.TID 0000.0001) ;
733 (PID.TID 0000.0001) f0 = /* Reference coriolis parameter ( 1/s ) */
734 (PID.TID 0000.0001) 1.000000000000000E-04
735 (PID.TID 0000.0001) ;
736 (PID.TID 0000.0001) beta = /* Beta ( 1/(m.s) ) */
737 (PID.TID 0000.0001) 9.999999999999999E-12
738 (PID.TID 0000.0001) ;
739 (PID.TID 0000.0001) fPrime = /* Second coriolis parameter ( 1/s ) */
740 (PID.TID 0000.0001) 0.000000000000000E+00
741 (PID.TID 0000.0001) ;
742 (PID.TID 0000.0001) rigidLid = /* Rigid lid on/off flag */
743 (PID.TID 0000.0001) F
744 (PID.TID 0000.0001) ;
745 (PID.TID 0000.0001) implicitFreeSurface = /* Implicit free surface on/off flag */
746 (PID.TID 0000.0001) T
747 (PID.TID 0000.0001) ;
748 (PID.TID 0000.0001) freeSurfFac = /* Implicit free surface factor */
749 (PID.TID 0000.0001) 1.000000000000000E+00
750 (PID.TID 0000.0001) ;
751 (PID.TID 0000.0001) implicSurfPress = /* Surface Pressure implicit factor (0-1)*/
752 (PID.TID 0000.0001) 1.000000000000000E+00
753 (PID.TID 0000.0001) ;
754 (PID.TID 0000.0001) implicDiv2Dflow = /* Barot. Flow Div. implicit factor (0-1)*/
755 (PID.TID 0000.0001) 1.000000000000000E+00
756 (PID.TID 0000.0001) ;
757 (PID.TID 0000.0001) exactConserv = /* Exact Volume Conservation on/off flag*/
758 (PID.TID 0000.0001) T
759 (PID.TID 0000.0001) ;
760 (PID.TID 0000.0001) linFSConserveTr = /* Tracer correction for Lin Free Surface on/off flag*/
761 (PID.TID 0000.0001) F
762 (PID.TID 0000.0001) ;
763 (PID.TID 0000.0001) uniformLin_PhiSurf = /* use uniform Bo_surf on/off flag*/
764 (PID.TID 0000.0001) T
765 (PID.TID 0000.0001) ;
766 (PID.TID 0000.0001) hFacMin = /* minimum partial cell factor (hFac) */
767 (PID.TID 0000.0001) 1.000000000000000E-01
768 (PID.TID 0000.0001) ;
769 (PID.TID 0000.0001) hFacMinDr = /* minimum partial cell thickness ( m) */
770 (PID.TID 0000.0001) 1.000000000000000E-01
771 (PID.TID 0000.0001) ;
772 (PID.TID 0000.0001) nonlinFreeSurf = /* Non-linear Free Surf. options (-1,0,1,2,3)*/
773 (PID.TID 0000.0001) 4
774 (PID.TID 0000.0001) -1,0= Off ; 1,2,3= On, 2=+rescale gU,gV, 3=+update cg2d solv.
775 (PID.TID 0000.0001) ;
776 (PID.TID 0000.0001) hFacInf = /* lower threshold for hFac (nonlinFreeSurf only)*/
777 (PID.TID 0000.0001) 2.000000000000000E-01
778 (PID.TID 0000.0001) ;
779 (PID.TID 0000.0001) hFacSup = /* upper threshold for hFac (nonlinFreeSurf only)*/
780 (PID.TID 0000.0001) 2.000000000000000E+00
781 (PID.TID 0000.0001) ;
782 (PID.TID 0000.0001) select_rStar = /* r* Vertical coord. options (=0 r coord.; >0 uses r*)*/
783 (PID.TID 0000.0001) 2
784 (PID.TID 0000.0001) ;
785 (PID.TID 0000.0001) selectAddFluid = /* option for mass source/sink of fluid (=0: off) */
786 (PID.TID 0000.0001) 0
787 (PID.TID 0000.0001) ;
788 (PID.TID 0000.0001) useRealFreshWaterFlux = /* Real Fresh Water Flux on/off flag*/
789 (PID.TID 0000.0001) T
790 (PID.TID 0000.0001) ;
791 (PID.TID 0000.0001) temp_EvPrRn = /* Temp. of Evap/Prec/R (UNSET=use local T)(oC)*/
792 (PID.TID 0000.0001) 0.000000000000000E+00
793 (PID.TID 0000.0001) ;
794 (PID.TID 0000.0001) salt_EvPrRn = /* Salin. of Evap/Prec/R (UNSET=use local S)(psu)*/
795 (PID.TID 0000.0001) 0.000000000000000E+00
796 (PID.TID 0000.0001) ;
797 (PID.TID 0000.0001) temp_addMass = /* Temp. of addMass array (UNSET=use local T)(oC)*/
798 (PID.TID 0000.0001) 0.000000000000000E+00
799 (PID.TID 0000.0001) ;
800 (PID.TID 0000.0001) salt_addMass = /* Salin. of addMass array (UNSET=use local S)(psu)*/
801 (PID.TID 0000.0001) 0.000000000000000E+00
802 (PID.TID 0000.0001) ;
803 (PID.TID 0000.0001) use3Dsolver = /* use 3-D pressure solver on/off flag */
804 (PID.TID 0000.0001) F
805 (PID.TID 0000.0001) ;
806 (PID.TID 0000.0001) nonHydrostatic = /* Non-Hydrostatic on/off flag */
807 (PID.TID 0000.0001) F
808 (PID.TID 0000.0001) ;
809 (PID.TID 0000.0001) nh_Am2 = /* Non-Hydrostatic terms scaling factor */
810 (PID.TID 0000.0001) 1.000000000000000E+00
811 (PID.TID 0000.0001) ;
812 (PID.TID 0000.0001) implicitNHPress = /* Non-Hyd Pressure implicit factor (0-1)*/
813 (PID.TID 0000.0001) 1.000000000000000E+00
814 (PID.TID 0000.0001) ;
815 (PID.TID 0000.0001) selectNHfreeSurf = /* Non-Hyd (free-)Surface option */
816 (PID.TID 0000.0001) 0
817 (PID.TID 0000.0001) ;
818 (PID.TID 0000.0001) quasiHydrostatic = /* Quasi-Hydrostatic on/off flag */
819 (PID.TID 0000.0001) F
820 (PID.TID 0000.0001) ;
821 (PID.TID 0000.0001) momStepping = /* Momentum equation on/off flag */
822 (PID.TID 0000.0001) T
823 (PID.TID 0000.0001) ;
824 (PID.TID 0000.0001) vectorInvariantMomentum= /* Vector-Invariant Momentum on/off */
825 (PID.TID 0000.0001) T
826 (PID.TID 0000.0001) ;
827 (PID.TID 0000.0001) momAdvection = /* Momentum advection on/off flag */
828 (PID.TID 0000.0001) T
829 (PID.TID 0000.0001) ;
830 (PID.TID 0000.0001) momViscosity = /* Momentum viscosity on/off flag */
831 (PID.TID 0000.0001) T
832 (PID.TID 0000.0001) ;
833 (PID.TID 0000.0001) momImplVertAdv= /* Momentum implicit vert. advection on/off*/
834 (PID.TID 0000.0001) F
835 (PID.TID 0000.0001) ;
836 (PID.TID 0000.0001) implicitViscosity = /* Implicit viscosity on/off flag */
837 (PID.TID 0000.0001) F
838 (PID.TID 0000.0001) ;
839 (PID.TID 0000.0001) metricTerms = /* metric-Terms on/off flag */
840 (PID.TID 0000.0001) F
841 (PID.TID 0000.0001) ;
842 (PID.TID 0000.0001) useNHMTerms = /* Non-Hydrostatic Metric-Terms on/off */
843 (PID.TID 0000.0001) F
844 (PID.TID 0000.0001) ;
845 (PID.TID 0000.0001) selectCoriMap = /* Coriolis Map options (0,1,2,3)*/
846 (PID.TID 0000.0001) 2
847 (PID.TID 0000.0001) 0= f-Plane ; 1= Beta-Plane ; 2= Spherical ; 3= read from file
848 (PID.TID 0000.0001) ;
849 (PID.TID 0000.0001) use3dCoriolis = /* 3-D Coriolis on/off flag */
850 (PID.TID 0000.0001) F
851 (PID.TID 0000.0001) ;
852 (PID.TID 0000.0001) useCoriolis = /* Coriolis on/off flag */
853 (PID.TID 0000.0001) T
854 (PID.TID 0000.0001) ;
855 (PID.TID 0000.0001) useCDscheme = /* CD scheme on/off flag */
856 (PID.TID 0000.0001) F
857 (PID.TID 0000.0001) ;
858 (PID.TID 0000.0001) useEnergyConservingCoriolis= /* Flx-Form Coriolis scheme flag */
859 (PID.TID 0000.0001) F
860 (PID.TID 0000.0001) ;
861 (PID.TID 0000.0001) useJamartWetPoints= /* Coriolis WetPoints method flag */
862 (PID.TID 0000.0001) F
863 (PID.TID 0000.0001) ;
864 (PID.TID 0000.0001) useJamartMomAdv= /* V.I Non-linear terms Jamart flag */
865 (PID.TID 0000.0001) F
866 (PID.TID 0000.0001) ;
867 (PID.TID 0000.0001) useAbsVorticity= /* V.I Works with f+zeta in Coriolis */
868 (PID.TID 0000.0001) F
869 (PID.TID 0000.0001) ;
870 (PID.TID 0000.0001) selectVortScheme= /* V.I Scheme selector for Vorticity-Term */
871 (PID.TID 0000.0001) 1
872 (PID.TID 0000.0001) = 0 : enstrophy (Shallow-Water Eq.) conserving scheme by Sadourny, JAS 75
873 (PID.TID 0000.0001) = 1 : same as 0 with modified hFac
874 (PID.TID 0000.0001) = 2 : energy conserving scheme (used by Sadourny in JAS 75 paper)
875 (PID.TID 0000.0001) = 3 : energy (general) and enstrophy (2D, nonDiv.) conserving scheme
876 (PID.TID 0000.0001) from Sadourny (Burridge & Haseler, ECMWF Rep.4, 1977)
877 (PID.TID 0000.0001) ;
878 (PID.TID 0000.0001) upwindVorticity= /* V.I Upwind bias vorticity flag */
879 (PID.TID 0000.0001) F
880 (PID.TID 0000.0001) ;
881 (PID.TID 0000.0001) highOrderVorticity= /* V.I High order vort. advect. flag */
882 (PID.TID 0000.0001) F
883 (PID.TID 0000.0001) ;
884 (PID.TID 0000.0001) upwindShear= /* V.I Upwind vertical Shear advection flag */
885 (PID.TID 0000.0001) F
886 (PID.TID 0000.0001) ;
887 (PID.TID 0000.0001) selectKEscheme= /* V.I Kinetic Energy scheme selector */
888 (PID.TID 0000.0001) 0
889 (PID.TID 0000.0001) ;
890 (PID.TID 0000.0001) momForcing = /* Momentum forcing on/off flag */
891 (PID.TID 0000.0001) T
892 (PID.TID 0000.0001) ;
893 (PID.TID 0000.0001) momPressureForcing = /* Momentum pressure term on/off flag */
894 (PID.TID 0000.0001) T
895 (PID.TID 0000.0001) ;
896 (PID.TID 0000.0001) implicitIntGravWave= /* Implicit Internal Gravity Wave flag */
897 (PID.TID 0000.0001) F
898 (PID.TID 0000.0001) ;
899 (PID.TID 0000.0001) staggerTimeStep = /* Stagger time stepping on/off flag */
900 (PID.TID 0000.0001) T
901 (PID.TID 0000.0001) ;
902 (PID.TID 0000.0001) multiDimAdvection = /* enable/disable Multi-Dim Advection */
903 (PID.TID 0000.0001) T
904 (PID.TID 0000.0001) ;
905 (PID.TID 0000.0001) useMultiDimAdvec = /* Multi-Dim Advection is/is-not used */
906 (PID.TID 0000.0001) F
907 (PID.TID 0000.0001) ;
908 (PID.TID 0000.0001) implicitDiffusion = /* Implicit Diffusion on/off flag */
909 (PID.TID 0000.0001) T
910 (PID.TID 0000.0001) ;
911 (PID.TID 0000.0001) tempStepping = /* Temperature equation on/off flag */
912 (PID.TID 0000.0001) T
913 (PID.TID 0000.0001) ;
914 (PID.TID 0000.0001) tempAdvection= /* Temperature advection on/off flag */
915 (PID.TID 0000.0001) T
916 (PID.TID 0000.0001) ;
917 (PID.TID 0000.0001) tempImplVertAdv = /* Temp. implicit vert. advection on/off */
918 (PID.TID 0000.0001) F
919 (PID.TID 0000.0001) ;
920 (PID.TID 0000.0001) tempForcing = /* Temperature forcing on/off flag */
921 (PID.TID 0000.0001) T
922 (PID.TID 0000.0001) ;
923 (PID.TID 0000.0001) tempIsActiveTr = /* Temp. is a dynamically Active Tracer */
924 (PID.TID 0000.0001) T
925 (PID.TID 0000.0001) ;
926 (PID.TID 0000.0001) saltStepping = /* Salinity equation on/off flag */
927 (PID.TID 0000.0001) T
928 (PID.TID 0000.0001) ;
929 (PID.TID 0000.0001) saltAdvection= /* Salinity advection on/off flag */
930 (PID.TID 0000.0001) T
931 (PID.TID 0000.0001) ;
932 (PID.TID 0000.0001) saltImplVertAdv = /* Sali. implicit vert. advection on/off */
933 (PID.TID 0000.0001) F
934 (PID.TID 0000.0001) ;
935 (PID.TID 0000.0001) saltForcing = /* Salinity forcing on/off flag */
936 (PID.TID 0000.0001) T
937 (PID.TID 0000.0001) ;
938 (PID.TID 0000.0001) saltIsActiveTr = /* Salt is a dynamically Active Tracer */
939 (PID.TID 0000.0001) T
940 (PID.TID 0000.0001) ;
941 (PID.TID 0000.0001) readBinaryPrec = /* Precision used for reading binary files */
942 (PID.TID 0000.0001) 64
943 (PID.TID 0000.0001) ;
944 (PID.TID 0000.0001) writeBinaryPrec = /* Precision used for writing binary files */
945 (PID.TID 0000.0001) 64
946 (PID.TID 0000.0001) ;
947 (PID.TID 0000.0001) globalFiles = /* write "global" (=not per tile) files */
948 (PID.TID 0000.0001) F
949 (PID.TID 0000.0001) ;
950 (PID.TID 0000.0001) useSingleCpuIO = /* only master MPI process does I/O */
951 (PID.TID 0000.0001) F
952 (PID.TID 0000.0001) ;
953 (PID.TID 0000.0001) /* debLev[*] : level of debug & auxiliary message printing */
954 (PID.TID 0000.0001) debLevZero = 0 ; /* level of disabled aux. msg printing */
955 (PID.TID 0000.0001) debLevA = 1 ; /* level of minimum aux. msg printing */
956 (PID.TID 0000.0001) debLevB = 2 ; /* level of low aux. print (report read-file opening)*/
957 (PID.TID 0000.0001) debLevC = 3 ; /* level of moderate debug prt (most pkgs debug msg) */
958 (PID.TID 0000.0001) debLevD = 4 ; /* level of enhanced debug prt (add DEBUG_STATS prt) */
959 (PID.TID 0000.0001) debLevE = 5 ; /* level of extensive debug printing */
960 (PID.TID 0000.0001) debugLevel = /* select debug printing level */
961 (PID.TID 0000.0001) 2
962 (PID.TID 0000.0001) ;
963 (PID.TID 0000.0001) //
964 (PID.TID 0000.0001) // Elliptic solver(s) paramters ( PARM02 in namelist )
965 (PID.TID 0000.0001) //
966 (PID.TID 0000.0001) cg2dMaxIters = /* Upper limit on 2d con. grad iterations */
967 (PID.TID 0000.0001) 200
968 (PID.TID 0000.0001) ;
969 (PID.TID 0000.0001) cg2dChkResFreq = /* 2d con. grad convergence test frequency */
970 (PID.TID 0000.0001) 1
971 (PID.TID 0000.0001) ;
972 (PID.TID 0000.0001) cg2dTargetResidual = /* 2d con. grad target residual */
973 (PID.TID 0000.0001) 1.000000000000000E-09
974 (PID.TID 0000.0001) ;
975 (PID.TID 0000.0001) cg2dTargetResWunit = /* CG2d target residual [W units] */
976 (PID.TID 0000.0001) -1.000000000000000E+00
977 (PID.TID 0000.0001) ;
978 (PID.TID 0000.0001) cg2dPreCondFreq = /* Freq. for updating cg2d preconditioner */
979 (PID.TID 0000.0001) 1
980 (PID.TID 0000.0001) ;
981 (PID.TID 0000.0001) useSRCGSolver = /* use single reduction CG solver(s) */
982 (PID.TID 0000.0001) F
983 (PID.TID 0000.0001) ;
984 (PID.TID 0000.0001) printResidualFreq = /* Freq. for printing CG residual */
985 (PID.TID 0000.0001) 0
986 (PID.TID 0000.0001) ;
987 (PID.TID 0000.0001) //
988 (PID.TID 0000.0001) // Time stepping paramters ( PARM03 in namelist )
989 (PID.TID 0000.0001) //
990 (PID.TID 0000.0001) deltaTmom = /* Momentum equation timestep ( s ) */
991 (PID.TID 0000.0001) 3.600000000000000E+03
992 (PID.TID 0000.0001) ;
993 (PID.TID 0000.0001) deltaTfreesurf = /* FreeSurface equation timestep ( s ) */
994 (PID.TID 0000.0001) 3.600000000000000E+03
995 (PID.TID 0000.0001) ;
996 (PID.TID 0000.0001) dTtracerLev = /* Tracer equation timestep ( s ) */
997 (PID.TID 0000.0001) 15 @ 3.600000000000000E+03 /* K = 1: 15 */
998 (PID.TID 0000.0001) ;
999 (PID.TID 0000.0001) deltaTClock = /* Model clock timestep ( s ) */
1000 (PID.TID 0000.0001) 3.600000000000000E+03
1001 (PID.TID 0000.0001) ;
1002 (PID.TID 0000.0001) cAdjFreq = /* Convective adjustment interval ( s ) */
1003 (PID.TID 0000.0001) 0.000000000000000E+00
1004 (PID.TID 0000.0001) ;
1005 (PID.TID 0000.0001) momForcingOutAB = /* =1: take Momentum Forcing out of Adams-Bash. stepping */
1006 (PID.TID 0000.0001) 0
1007 (PID.TID 0000.0001) ;
1008 (PID.TID 0000.0001) tracForcingOutAB = /* =1: take T,S,pTr Forcing out of Adams-Bash. stepping */
1009 (PID.TID 0000.0001) 1
1010 (PID.TID 0000.0001) ;
1011 (PID.TID 0000.0001) momDissip_In_AB = /* put Dissipation Tendency in Adams-Bash. stepping */
1012 (PID.TID 0000.0001) T
1013 (PID.TID 0000.0001) ;
1014 (PID.TID 0000.0001) doAB_onGtGs = /* apply AB on Tendencies (rather than on T,S)*/
1015 (PID.TID 0000.0001) T
1016 (PID.TID 0000.0001) ;
1017 (PID.TID 0000.0001) abEps = /* Adams-Bashforth-2 stabilizing weight */
1018 (PID.TID 0000.0001) 1.000000000000000E-01
1019 (PID.TID 0000.0001) ;
1020 (PID.TID 0000.0001) pickupStrictlyMatch= /* stop if pickup do not strictly match */
1021 (PID.TID 0000.0001) T
1022 (PID.TID 0000.0001) ;
1023 (PID.TID 0000.0001) nIter0 = /* Run starting timestep number */
1024 (PID.TID 0000.0001) 0
1025 (PID.TID 0000.0001) ;
1026 (PID.TID 0000.0001) nTimeSteps = /* Number of timesteps */
1027 (PID.TID 0000.0001) 5
1028 (PID.TID 0000.0001) ;
1029 (PID.TID 0000.0001) nEndIter = /* Run ending timestep number */
1030 (PID.TID 0000.0001) 5
1031 (PID.TID 0000.0001) ;
1032 (PID.TID 0000.0001) baseTime = /* Model base time ( s ) */
1033 (PID.TID 0000.0001) 0.000000000000000E+00
1034 (PID.TID 0000.0001) ;
1035 (PID.TID 0000.0001) startTime = /* Run start time ( s ) */
1036 (PID.TID 0000.0001) 0.000000000000000E+00
1037 (PID.TID 0000.0001) ;
1038 (PID.TID 0000.0001) endTime = /* Integration ending time ( s ) */
1039 (PID.TID 0000.0001) 1.800000000000000E+04
1040 (PID.TID 0000.0001) ;
1041 (PID.TID 0000.0001) pChkPtFreq = /* Permanent restart/pickup file interval ( s ) */
1042 (PID.TID 0000.0001) 2.592000000000000E+06
1043 (PID.TID 0000.0001) ;
1044 (PID.TID 0000.0001) chkPtFreq = /* Rolling restart/pickup file interval ( s ) */
1045 (PID.TID 0000.0001) 0.000000000000000E+00
1046 (PID.TID 0000.0001) ;
1047 (PID.TID 0000.0001) pickup_write_mdsio = /* Model IO flag. */
1048 (PID.TID 0000.0001) T
1049 (PID.TID 0000.0001) ;
1050 (PID.TID 0000.0001) pickup_read_mdsio = /* Model IO flag. */
1051 (PID.TID 0000.0001) T
1052 (PID.TID 0000.0001) ;
1053 (PID.TID 0000.0001) pickup_write_mnc = /* Model IO flag. */
1054 (PID.TID 0000.0001) F
1055 (PID.TID 0000.0001) ;
1056 (PID.TID 0000.0001) pickup_read_mnc = /* Model IO flag. */
1057 (PID.TID 0000.0001) F
1058 (PID.TID 0000.0001) ;
1059 (PID.TID 0000.0001) pickup_write_immed = /* Model IO flag. */
1060 (PID.TID 0000.0001) F
1061 (PID.TID 0000.0001) ;
1062 (PID.TID 0000.0001) writePickupAtEnd = /* Model IO flag. */
1063 (PID.TID 0000.0001) T
1064 (PID.TID 0000.0001) ;
1065 (PID.TID 0000.0001) dumpFreq = /* Model state write out interval ( s ). */
1066 (PID.TID 0000.0001) 8.640000000000000E+05
1067 (PID.TID 0000.0001) ;
1068 (PID.TID 0000.0001) dumpInitAndLast= /* write out Initial & Last iter. model state */
1069 (PID.TID 0000.0001) T
1070 (PID.TID 0000.0001) ;
1071 (PID.TID 0000.0001) snapshot_mdsio = /* Model IO flag. */
1072 (PID.TID 0000.0001) T
1073 (PID.TID 0000.0001) ;
1074 (PID.TID 0000.0001) snapshot_mnc = /* Model IO flag. */
1075 (PID.TID 0000.0001) F
1076 (PID.TID 0000.0001) ;
1077 (PID.TID 0000.0001) monitorFreq = /* Monitor output interval ( s ). */
1078 (PID.TID 0000.0001) 1.000000000000000E+00
1079 (PID.TID 0000.0001) ;
1080 (PID.TID 0000.0001) monitorSelect = /* select group of variables to monitor */
1081 (PID.TID 0000.0001) 3
1082 (PID.TID 0000.0001) ;
1083 (PID.TID 0000.0001) monitor_stdio = /* Model IO flag. */
1084 (PID.TID 0000.0001) T
1085 (PID.TID 0000.0001) ;
1086 (PID.TID 0000.0001) monitor_mnc = /* Model IO flag. */
1087 (PID.TID 0000.0001) F
1088 (PID.TID 0000.0001) ;
1089 (PID.TID 0000.0001) externForcingPeriod = /* forcing period (s) */
1090 (PID.TID 0000.0001) 2.592000000000000E+06
1091 (PID.TID 0000.0001) ;
1092 (PID.TID 0000.0001) externForcingCycle = /* period of the cyle (s). */
1093 (PID.TID 0000.0001) 3.110400000000000E+07
1094 (PID.TID 0000.0001) ;
1095 (PID.TID 0000.0001) tauThetaClimRelax = /* relaxation time scale (s) */
1096 (PID.TID 0000.0001) 0.000000000000000E+00
1097 (PID.TID 0000.0001) ;
1098 (PID.TID 0000.0001) tauSaltClimRelax = /* relaxation time scale (s) */
1099 (PID.TID 0000.0001) 6.220800000000000E+08
1100 (PID.TID 0000.0001) ;
1101 (PID.TID 0000.0001) latBandClimRelax = /* max. Lat. where relaxation */
1102 (PID.TID 0000.0001) 1.800000000000000E+02
1103 (PID.TID 0000.0001) ;
1104 (PID.TID 0000.0001) //
1105 (PID.TID 0000.0001) // Gridding paramters ( PARM04 in namelist )
1106 (PID.TID 0000.0001) //
1107 (PID.TID 0000.0001) usingCartesianGrid = /* Cartesian coordinates flag ( True/False ) */
1108 (PID.TID 0000.0001) F
1109 (PID.TID 0000.0001) ;
1110 (PID.TID 0000.0001) usingCylindricalGrid = /* Cylindrical coordinates flag ( True/False ) */
1111 (PID.TID 0000.0001) F
1112 (PID.TID 0000.0001) ;
1113 (PID.TID 0000.0001) usingSphericalPolarGrid = /* Spherical coordinates flag ( True/False ) */
1114 (PID.TID 0000.0001) F
1115 (PID.TID 0000.0001) ;
1116 (PID.TID 0000.0001) usingCurvilinearGrid = /* Curvilinear coordinates flag ( True/False ) */
1117 (PID.TID 0000.0001) T
1118 (PID.TID 0000.0001) ;
1119 (PID.TID 0000.0001) selectSigmaCoord = /* Hybrid-Sigma Vert. Coordinate option */
1120 (PID.TID 0000.0001) 0
1121 (PID.TID 0000.0001) ;
1122 (PID.TID 0000.0001) Ro_SeaLevel = /* r(1) ( units of r == m ) */
1123 (PID.TID 0000.0001) 0.000000000000000E+00
1124 (PID.TID 0000.0001) ;
1125 (PID.TID 0000.0001) rSigmaBnd = /* r/sigma transition ( units of r == m ) */
1126 (PID.TID 0000.0001) 1.234567000000000E+05
1127 (PID.TID 0000.0001) ;
1128 (PID.TID 0000.0001) rkSign = /* index orientation relative to vertical coordinate */
1129 (PID.TID 0000.0001) -1.000000000000000E+00
1130 (PID.TID 0000.0001) ;
1131 (PID.TID 0000.0001) gravitySign = /* gravity orientation relative to vertical coordinate */
1132 (PID.TID 0000.0001) -1.000000000000000E+00
1133 (PID.TID 0000.0001) ;
1134 (PID.TID 0000.0001) mass2rUnit = /* convert mass per unit area [kg/m2] to r-units [m] */
1135 (PID.TID 0000.0001) 9.708737864077669E-04
1136 (PID.TID 0000.0001) ;
1137 (PID.TID 0000.0001) rUnit2mass = /* convert r-units [m] to mass per unit area [kg/m2] */
1138 (PID.TID 0000.0001) 1.030000000000000E+03
1139 (PID.TID 0000.0001) ;
1140 (PID.TID 0000.0001) drC = /* C spacing ( units of r ) */
1141 (PID.TID 0000.0001) 2.500000000000000E+01, /* K = 1 */
1142 (PID.TID 0000.0001) 6.000000000000000E+01, /* K = 2 */
1143 (PID.TID 0000.0001) 8.500000000000000E+01, /* K = 3 */
1144 (PID.TID 0000.0001) 1.200000000000000E+02, /* K = 4 */
1145 (PID.TID 0000.0001) 1.650000000000000E+02, /* K = 5 */
1146 (PID.TID 0000.0001) 2.150000000000000E+02, /* K = 6 */
1147 (PID.TID 0000.0001) 2.650000000000000E+02, /* K = 7 */
1148 (PID.TID 0000.0001) 3.150000000000000E+02, /* K = 8 */
1149 (PID.TID 0000.0001) 3.650000000000000E+02, /* K = 9 */
1150 (PID.TID 0000.0001) 4.150000000000000E+02, /* K = 10 */
1151 (PID.TID 0000.0001) 4.650000000000000E+02, /* K = 11 */
1152 (PID.TID 0000.0001) 5.150000000000000E+02, /* K = 12 */
1153 (PID.TID 0000.0001) 5.650000000000000E+02, /* K = 13 */
1154 (PID.TID 0000.0001) 6.150000000000000E+02, /* K = 14 */
1155 (PID.TID 0000.0001) 6.650000000000000E+02 /* K = 15 */
1156 (PID.TID 0000.0001) ;
1157 (PID.TID 0000.0001) drF = /* W spacing ( units of r ) */
1158 (PID.TID 0000.0001) 5.000000000000000E+01, /* K = 1 */
1159 (PID.TID 0000.0001) 7.000000000000000E+01, /* K = 2 */
1160 (PID.TID 0000.0001) 1.000000000000000E+02, /* K = 3 */
1161 (PID.TID 0000.0001) 1.400000000000000E+02, /* K = 4 */
1162 (PID.TID 0000.0001) 1.900000000000000E+02, /* K = 5 */
1163 (PID.TID 0000.0001) 2.400000000000000E+02, /* K = 6 */
1164 (PID.TID 0000.0001) 2.900000000000000E+02, /* K = 7 */
1165 (PID.TID 0000.0001) 3.400000000000000E+02, /* K = 8 */
1166 (PID.TID 0000.0001) 3.900000000000000E+02, /* K = 9 */
1167 (PID.TID 0000.0001) 4.400000000000000E+02, /* K = 10 */
1168 (PID.TID 0000.0001) 4.900000000000000E+02, /* K = 11 */
1169 (PID.TID 0000.0001) 5.400000000000000E+02, /* K = 12 */
1170 (PID.TID 0000.0001) 5.900000000000000E+02, /* K = 13 */
1171 (PID.TID 0000.0001) 6.400000000000000E+02, /* K = 14 */
1172 (PID.TID 0000.0001) 6.900000000000000E+02 /* K = 15 */
1173 (PID.TID 0000.0001) ;
1174 (PID.TID 0000.0001) xgOrigin = /* X-axis origin of West edge (cartesian: m, lat-lon: deg.) */
1175 (PID.TID 0000.0001) 0.000000000000000E+00
1176 (PID.TID 0000.0001) ;
1177 (PID.TID 0000.0001) ygOrigin = /* Y-axis origin of South edge (cartesian: m, lat-lon: deg.) */
1178 (PID.TID 0000.0001) 0.000000000000000E+00
1179 (PID.TID 0000.0001) ;
1180 (PID.TID 0000.0001) rSphere = /* Radius ( ignored - cartesian, m - spherical ) */
1181 (PID.TID 0000.0001) 6.370000000000000E+06
1182 (PID.TID 0000.0001) ;
1183 (PID.TID 0000.0001) radius_fromHorizGrid = /* sphere Radius of input horiz. grid */
1184 (PID.TID 0000.0001) 6.370000000000000E+06
1185 (PID.TID 0000.0001) ;
1186 (PID.TID 0000.0001) deepAtmosphere = /* Deep/Shallow Atmosphere flag (True/False) */
1187 (PID.TID 0000.0001) F
1188 (PID.TID 0000.0001) ;
1189 (PID.TID 0000.0001) xC = /* xC(:,1,:,1) : P-point X coord ( deg. or m if cartesian) */
1190 (PID.TID 0000.0001) -4.439521994760536E+01, /* I = 1 */
1191 (PID.TID 0000.0001) -4.295641272275883E+01, /* I = 2 */
1192 (PID.TID 0000.0001) -4.122055553388957E+01, /* I = 3 */
1193 (PID.TID 0000.0001) . . .
1194 (PID.TID 0000.0001) 8.070819219728060E+01, /* I = 46 */
1195 (PID.TID 0000.0001) 8.439652466417766E+01, /* I = 47 */
1196 (PID.TID 0000.0001) 8.812739148696656E+01, /* I = 48 */
1197 (PID.TID 0000.0001) 9.187260851303344E+01, /* I = 49 */
1198 (PID.TID 0000.0001) 9.560347533582234E+01, /* I = 50 */
1199 (PID.TID 0000.0001) 9.929180780271940E+01, /* I = 51 */
1200 (PID.TID 0000.0001) . . .
1201 (PID.TID 0000.0001) 1.321863035748696E+02, /* I = 94 */
1202 (PID.TID 0000.0001) 1.337919453120370E+02, /* I = 95 */
1203 (PID.TID 0000.0001) 1.350000000000000E+02, /* I = 96 */
1204 (PID.TID 0000.0001) 1.356047800523947E+02, /* I = 97 */
1205 (PID.TID 0000.0001) 1.358367907661329E+02, /* I = 98 */
1206 (PID.TID 0000.0001) 1.359720382181193E+02, /* I = 99 */
1207 (PID.TID 0000.0001) . . .
1208 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =142 */
1209 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =143 */
1210 (PID.TID 0000.0001) -1.336449032499283E+02, /* I =144 */
1211 (PID.TID 0000.0001) -1.336449032499283E+02, /* I =145 */
1212 (PID.TID 0000.0001) -1.336469399409420E+02, /* I =146 */
1213 (PID.TID 0000.0001) -1.336511021209287E+02, /* I =147 */
1214 (PID.TID 0000.0001) . . .
1215 (PID.TID 0000.0001) 1.378136964251304E+02, /* I =190 */
1216 (PID.TID 0000.0001) 1.362080546879630E+02, /* I =191 */
1217 (PID.TID 0000.0001) 1.350000000000000E+02 /* I =192 */
1218 (PID.TID 0000.0001) ;
1219 (PID.TID 0000.0001) yC = /* yC(1,:,1,:) : P-point Y coord ( deg. or m if cartesian) */
1220 (PID.TID 0000.0001) -3.497677942598243E+01, /* J = 1 */
1221 (PID.TID 0000.0001) -3.374005967394886E+01, /* J = 2 */
1222 (PID.TID 0000.0001) -3.220655175667454E+01, /* J = 3 */
1223 (PID.TID 0000.0001) -3.045756348838641E+01, /* J = 4 */
1224 (PID.TID 0000.0001) -2.853728129852918E+01, /* J = 5 */
1225 (PID.TID 0000.0001) -2.647426640173173E+01, /* J = 6 */
1226 (PID.TID 0000.0001) -2.428936657094636E+01, /* J = 7 */
1227 (PID.TID 0000.0001) -2.199915808312262E+01, /* J = 8 */
1228 (PID.TID 0000.0001) -1.961768597440146E+01, /* J = 9 */
1229 (PID.TID 0000.0001) -1.715743888281371E+01, /* J = 10 */
1230 (PID.TID 0000.0001) -1.462993396899330E+01, /* J = 11 */
1231 (PID.TID 0000.0001) -1.204608340464756E+01, /* J = 12 */
1232 (PID.TID 0000.0001) -9.416429130284818E+00, /* J = 13 */
1233 (PID.TID 0000.0001) -6.751293662992216E+00, /* J = 14 */
1234 (PID.TID 0000.0001) -4.060875511835959E+00, /* J = 15 */
1235 (PID.TID 0000.0001) -1.355307764409121E+00, /* J = 16 */
1236 (PID.TID 0000.0001) 1.355307764409121E+00, /* J = 17 */
1237 (PID.TID 0000.0001) 4.060875511835959E+00, /* J = 18 */
1238 (PID.TID 0000.0001) 6.751293662992216E+00, /* J = 19 */
1239 (PID.TID 0000.0001) 9.416429130284818E+00, /* J = 20 */
1240 (PID.TID 0000.0001) 1.204608340464756E+01, /* J = 21 */
1241 (PID.TID 0000.0001) 1.462993396899330E+01, /* J = 22 */
1242 (PID.TID 0000.0001) 1.715743888281371E+01, /* J = 23 */
1243 (PID.TID 0000.0001) 1.961768597440146E+01, /* J = 24 */
1244 (PID.TID 0000.0001) 2.199915808312262E+01, /* J = 25 */
1245 (PID.TID 0000.0001) 2.428936657094636E+01, /* J = 26 */
1246 (PID.TID 0000.0001) 2.647426640173173E+01, /* J = 27 */
1247 (PID.TID 0000.0001) 2.853728129852918E+01, /* J = 28 */
1248 (PID.TID 0000.0001) 3.045756348838641E+01, /* J = 29 */
1249 (PID.TID 0000.0001) 3.220655175667454E+01, /* J = 30 */
1250 (PID.TID 0000.0001) 3.374005967394886E+01, /* J = 31 */
1251 (PID.TID 0000.0001) 3.497677942598243E+01 /* J = 32 */
1252 (PID.TID 0000.0001) ;
1253 (PID.TID 0000.0001) rcoord = /* P-point R coordinate ( units of r ) */
1254 (PID.TID 0000.0001) -2.500000000000000E+01, /* K = 1 */
1255 (PID.TID 0000.0001) -8.500000000000000E+01, /* K = 2 */
1256 (PID.TID 0000.0001) -1.700000000000000E+02, /* K = 3 */
1257 (PID.TID 0000.0001) -2.900000000000000E+02, /* K = 4 */
1258 (PID.TID 0000.0001) -4.550000000000000E+02, /* K = 5 */
1259 (PID.TID 0000.0001) -6.700000000000000E+02, /* K = 6 */
1260 (PID.TID 0000.0001) -9.350000000000000E+02, /* K = 7 */
1261 (PID.TID 0000.0001) -1.250000000000000E+03, /* K = 8 */
1262 (PID.TID 0000.0001) -1.615000000000000E+03, /* K = 9 */
1263 (PID.TID 0000.0001) -2.030000000000000E+03, /* K = 10 */
1264 (PID.TID 0000.0001) -2.495000000000000E+03, /* K = 11 */
1265 (PID.TID 0000.0001) -3.010000000000000E+03, /* K = 12 */
1266 (PID.TID 0000.0001) -3.575000000000000E+03, /* K = 13 */
1267 (PID.TID 0000.0001) -4.190000000000000E+03, /* K = 14 */
1268 (PID.TID 0000.0001) -4.855000000000000E+03 /* K = 15 */
1269 (PID.TID 0000.0001) ;
1270 (PID.TID 0000.0001) rF = /* W-Interf. R coordinate ( units of r ) */
1271 (PID.TID 0000.0001) 0.000000000000000E+00, /* K = 1 */
1272 (PID.TID 0000.0001) -5.000000000000000E+01, /* K = 2 */
1273 (PID.TID 0000.0001) -1.200000000000000E+02, /* K = 3 */
1274 (PID.TID 0000.0001) -2.200000000000000E+02, /* K = 4 */
1275 (PID.TID 0000.0001) -3.600000000000000E+02, /* K = 5 */
1276 (PID.TID 0000.0001) -5.500000000000000E+02, /* K = 6 */
1277 (PID.TID 0000.0001) -7.900000000000000E+02, /* K = 7 */
1278 (PID.TID 0000.0001) -1.080000000000000E+03, /* K = 8 */
1279 (PID.TID 0000.0001) -1.420000000000000E+03, /* K = 9 */
1280 (PID.TID 0000.0001) -1.810000000000000E+03, /* K = 10 */
1281 (PID.TID 0000.0001) -2.250000000000000E+03, /* K = 11 */
1282 (PID.TID 0000.0001) -2.740000000000000E+03, /* K = 12 */
1283 (PID.TID 0000.0001) -3.280000000000000E+03, /* K = 13 */
1284 (PID.TID 0000.0001) -3.870000000000000E+03, /* K = 14 */
1285 (PID.TID 0000.0001) -4.510000000000000E+03, /* K = 15 */
1286 (PID.TID 0000.0001) -5.200000000000000E+03 /* K = 16 */
1287 (PID.TID 0000.0001) ;
1288 (PID.TID 0000.0001) deepFacC = /* deep-model grid factor @ cell-Center (-) */
1289 (PID.TID 0000.0001) 15 @ 1.000000000000000E+00 /* K = 1: 15 */
1290 (PID.TID 0000.0001) ;
1291 (PID.TID 0000.0001) deepFacF = /* deep-model grid factor @ W-Interface (-) */
1292 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1293 (PID.TID 0000.0001) ;
1294 (PID.TID 0000.0001) rVel2wUnit = /* convert units: rVel -> wSpeed (=1 if z-coord)*/
1295 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1296 (PID.TID 0000.0001) ;
1297 (PID.TID 0000.0001) wUnit2rVel = /* convert units: wSpeed -> rVel (=1 if z-coord)*/
1298 (PID.TID 0000.0001) 16 @ 1.000000000000000E+00 /* K = 1: 16 */
1299 (PID.TID 0000.0001) ;
1300 (PID.TID 0000.0001) dBdrRef = /* Vertical grad. of reference buoyancy [(m/s/r)^2] */
1301 (PID.TID 0000.0001) 15 @ 0.000000000000000E+00 /* K = 1: 15 */
1302 (PID.TID 0000.0001) ;
1303 (PID.TID 0000.0001) rotateGrid = /* use rotated grid ( True/False ) */
1304 (PID.TID 0000.0001) F
1305 (PID.TID 0000.0001) ;
1306 (PID.TID 0000.0001) phiEuler = /* Euler angle, rotation about original z-coordinate [rad] */
1307 (PID.TID 0000.0001) 0.000000000000000E+00
1308 (PID.TID 0000.0001) ;
1309 (PID.TID 0000.0001) thetaEuler = /* Euler angle, rotation about new x-coordinate [rad] */
1310 (PID.TID 0000.0001) 0.000000000000000E+00
1311 (PID.TID 0000.0001) ;
1312 (PID.TID 0000.0001) psiEuler = /* Euler angle, rotation about new z-coordinate [rad] */
1313 (PID.TID 0000.0001) 0.000000000000000E+00
1314 (PID.TID 0000.0001) ;
1315 (PID.TID 0000.0001) dxF = /* dxF(:,1,:,1) ( units: m ) */
1316 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1317 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 2 */
1318 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 3 */
1319 (PID.TID 0000.0001) . . .
1320 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 46 */
1321 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 47 */
1322 (PID.TID 0000.0001) 3.012190981969055E+05, /* I = 48 */
1323 (PID.TID 0000.0001) 3.012190981969055E+05, /* I = 49 */
1324 (PID.TID 0000.0001) 3.000967749619962E+05, /* I = 50 */
1325 (PID.TID 0000.0001) 2.978501920522794E+05, /* I = 51 */
1326 (PID.TID 0000.0001) . . .
1327 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 94 */
1328 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 95 */
1329 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 96 */
1330 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 97 */
1331 (PID.TID 0000.0001) 1.563594089971120E+05, /* I = 98 */
1332 (PID.TID 0000.0001) 1.835530058121492E+05, /* I = 99 */
1333 (PID.TID 0000.0001) . . .
1334 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =142 */
1335 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =143 */
1336 (PID.TID 0000.0001) 3.012190981969055E+05, /* I =144 */
1337 (PID.TID 0000.0001) 3.012190981969055E+05, /* I =145 */
1338 (PID.TID 0000.0001) 3.000967749619962E+05, /* I =146 */
1339 (PID.TID 0000.0001) 2.978501920522794E+05, /* I =147 */
1340 (PID.TID 0000.0001) . . .
1341 (PID.TID 0000.0001) 1.835530058121492E+05, /* I =190 */
1342 (PID.TID 0000.0001) 1.563594089971120E+05, /* I =191 */
1343 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1344 (PID.TID 0000.0001) ;
1345 (PID.TID 0000.0001) dxF = /* dxF(1,:,1,:) ( units: m ) */
1346 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1347 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 2 */
1348 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 3 */
1349 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 4 */
1350 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 5 */
1351 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 6 */
1352 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 7 */
1353 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 8 */
1354 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 9 */
1355 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 10 */
1356 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 11 */
1357 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 12 */
1358 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 13 */
1359 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 14 */
1360 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 15 */
1361 (PID.TID 0000.0001) 2 @ 3.012844832048790E+05, /* J = 16: 17 */
1362 (PID.TID 0000.0001) 3.001626787528886E+05, /* J = 18 */
1363 (PID.TID 0000.0001) 2.979171143158405E+05, /* J = 19 */
1364 (PID.TID 0000.0001) 2.945429307892709E+05, /* J = 20 */
1365 (PID.TID 0000.0001) 2.900303768613599E+05, /* J = 21 */
1366 (PID.TID 0000.0001) 2.843615645344775E+05, /* J = 22 */
1367 (PID.TID 0000.0001) 2.775055554645015E+05, /* J = 23 */
1368 (PID.TID 0000.0001) 2.694110134598581E+05, /* J = 24 */
1369 (PID.TID 0000.0001) 2.599949918261881E+05, /* J = 25 */
1370 (PID.TID 0000.0001) 2.491250781852558E+05, /* J = 26 */
1371 (PID.TID 0000.0001) 2.365892017348392E+05, /* J = 27 */
1372 (PID.TID 0000.0001) 2.220405216043041E+05, /* J = 28 */
1373 (PID.TID 0000.0001) 2.048868197919576E+05, /* J = 29 */
1374 (PID.TID 0000.0001) 1.840412227747703E+05, /* J = 30 */
1375 (PID.TID 0000.0001) 1.572908084538706E+05, /* J = 31 */
1376 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1377 (PID.TID 0000.0001) ;
1378 (PID.TID 0000.0001) dyF = /* dyF(:,1,:,1) ( units: m ) */
1379 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 1 */
1380 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 2 */
1381 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 3 */
1382 (PID.TID 0000.0001) . . .
1383 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 46 */
1384 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 47 */
1385 (PID.TID 0000.0001) 3.012844832048790E+05, /* I = 48 */
1386 (PID.TID 0000.0001) 3.012844832048790E+05, /* I = 49 */
1387 (PID.TID 0000.0001) 3.001626787528886E+05, /* I = 50 */
1388 (PID.TID 0000.0001) 2.979171143158405E+05, /* I = 51 */
1389 (PID.TID 0000.0001) . . .
1390 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 94 */
1391 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 95 */
1392 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 96 */
1393 (PID.TID 0000.0001) 1.202082051331828E+05, /* I = 97 */
1394 (PID.TID 0000.0001) 1.572908084538706E+05, /* I = 98 */
1395 (PID.TID 0000.0001) 1.840412227747703E+05, /* I = 99 */
1396 (PID.TID 0000.0001) . . .
1397 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =142 */
1398 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =143 */
1399 (PID.TID 0000.0001) 3.012844832048790E+05, /* I =144 */
1400 (PID.TID 0000.0001) 3.012844832048790E+05, /* I =145 */
1401 (PID.TID 0000.0001) 3.001626787528886E+05, /* I =146 */
1402 (PID.TID 0000.0001) 2.979171143158405E+05, /* I =147 */
1403 (PID.TID 0000.0001) . . .
1404 (PID.TID 0000.0001) 1.840412227747703E+05, /* I =190 */
1405 (PID.TID 0000.0001) 1.572908084538706E+05, /* I =191 */
1406 (PID.TID 0000.0001) 1.202082051331828E+05 /* I =192 */
1407 (PID.TID 0000.0001) ;
1408 (PID.TID 0000.0001) dyF = /* dyF(1,:,1,:) ( units: m ) */
1409 (PID.TID 0000.0001) 1.202082051331828E+05, /* J = 1 */
1410 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 2 */
1411 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 3 */
1412 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 4 */
1413 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 5 */
1414 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 6 */
1415 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 7 */
1416 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 8 */
1417 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 9 */
1418 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 10 */
1419 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 11 */
1420 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 12 */
1421 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 13 */
1422 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 14 */
1423 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 15 */
1424 (PID.TID 0000.0001) 2 @ 3.012190981969055E+05, /* J = 16: 17 */
1425 (PID.TID 0000.0001) 3.000967749619962E+05, /* J = 18 */
1426 (PID.TID 0000.0001) 2.978501920522794E+05, /* J = 19 */
1427 (PID.TID 0000.0001) 2.944742915095688E+05, /* J = 20 */
1428 (PID.TID 0000.0001) 2.899590699694043E+05, /* J = 21 */
1429 (PID.TID 0000.0001) 2.842862532064524E+05, /* J = 22 */
1430 (PID.TID 0000.0001) 2.774243179696503E+05, /* J = 23 */
1431 (PID.TID 0000.0001) 2.693210245495156E+05, /* J = 24 */
1432 (PID.TID 0000.0001) 2.598919724358304E+05, /* J = 25 */
1433 (PID.TID 0000.0001) 2.490022710862746E+05, /* J = 26 */
1434 (PID.TID 0000.0001) 2.364352994647058E+05, /* J = 27 */
1435 (PID.TID 0000.0001) 2.218350349844185E+05, /* J = 28 */
1436 (PID.TID 0000.0001) 2.045883481718707E+05, /* J = 29 */
1437 (PID.TID 0000.0001) 1.835530058121492E+05, /* J = 30 */
1438 (PID.TID 0000.0001) 1.563594089971120E+05, /* J = 31 */
1439 (PID.TID 0000.0001) 1.202082051331828E+05 /* J = 32 */
1440 (PID.TID 0000.0001) ;
1441 (PID.TID 0000.0001) dxG = /* dxG(:,1,:,1) ( units: m ) */
1442 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1443 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 2 */
1444 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 3 */
1445 (PID.TID 0000.0001) . . .
1446 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 46 */
1447 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 47 */
1448 (PID.TID 0000.0001) 3.011625828699101E+05, /* I = 48 */
1449 (PID.TID 0000.0001) 3.011625828699101E+05, /* I = 49 */
1450 (PID.TID 0000.0001) 3.000380090330854E+05, /* I = 50 */
1451 (PID.TID 0000.0001) 2.977867909042096E+05, /* I = 51 */
1452 (PID.TID 0000.0001) . . .
1453 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 94 */
1454 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 95 */
1455 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 96 */
1456 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
1457 (PID.TID 0000.0001) 1.534505834330338E+05, /* I = 98 */
1458 (PID.TID 0000.0001) 1.823321598773926E+05, /* I = 99 */
1459 (PID.TID 0000.0001) . . .
1460 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =142 */
1461 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =143 */
1462 (PID.TID 0000.0001) 3.011625828699101E+05, /* I =144 */
1463 (PID.TID 0000.0001) 3.011625828699101E+05, /* I =145 */
1464 (PID.TID 0000.0001) 3.000380090330854E+05, /* I =146 */
1465 (PID.TID 0000.0001) 2.977867909042096E+05, /* I =147 */
1466 (PID.TID 0000.0001) . . .
1467 (PID.TID 0000.0001) 1.823321598773926E+05, /* I =190 */
1468 (PID.TID 0000.0001) 1.534505834330338E+05, /* I =191 */
1469 (PID.TID 0000.0001) 1.009837800879055E+05 /* I =192 */
1470 (PID.TID 0000.0001) ;
1471 (PID.TID 0000.0001) dxG = /* dxG(1,:,1,:) ( units: m ) */
1472 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
1473 (PID.TID 0000.0001) 1.403701524205398E+05, /* J = 2 */
1474 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 3 */
1475 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 4 */
1476 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 5 */
1477 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 6 */
1478 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 7 */
1479 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 8 */
1480 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 9 */
1481 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 10 */
1482 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 11 */
1483 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 12 */
1484 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 13 */
1485 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 14 */
1486 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 15 */
1487 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 16 */
1488 (PID.TID 0000.0001) 3.014246674484008E+05, /* J = 17 */
1489 (PID.TID 0000.0001) 3.008638765647886E+05, /* J = 18 */
1490 (PID.TID 0000.0001) 2.991805843171258E+05, /* J = 19 */
1491 (PID.TID 0000.0001) 2.963715635865306E+05, /* J = 20 */
1492 (PID.TID 0000.0001) 2.924298293668651E+05, /* J = 21 */
1493 (PID.TID 0000.0001) 2.873420591008078E+05, /* J = 22 */
1494 (PID.TID 0000.0001) 2.810845823202647E+05, /* J = 23 */
1495 (PID.TID 0000.0001) 2.736173771018112E+05, /* J = 24 */
1496 (PID.TID 0000.0001) 2.648750305193301E+05, /* J = 25 */
1497 (PID.TID 0000.0001) 2.547526806712889E+05, /* J = 26 */
1498 (PID.TID 0000.0001) 2.430829951739083E+05, /* J = 27 */
1499 (PID.TID 0000.0001) 2.295958105911512E+05, /* J = 28 */
1500 (PID.TID 0000.0001) 2.138410773065497E+05, /* J = 29 */
1501 (PID.TID 0000.0001) 1.950254041626018E+05, /* J = 30 */
1502 (PID.TID 0000.0001) 1.716197227386011E+05, /* J = 31 */
1503 (PID.TID 0000.0001) 1.403701524205398E+05 /* J = 32 */
1504 (PID.TID 0000.0001) ;
1505 (PID.TID 0000.0001) dyG = /* dyG(:,1,:,1) ( units: m ) */
1506 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 1 */
1507 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 2 */
1508 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 3 */
1509 (PID.TID 0000.0001) . . .
1510 (PID.TID 0000.0001) 2.963715635865306E+05, /* I = 46 */
1511 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 47 */
1512 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 48 */
1513 (PID.TID 0000.0001) 3.014246674484008E+05, /* I = 49 */
1514 (PID.TID 0000.0001) 3.008638765647886E+05, /* I = 50 */
1515 (PID.TID 0000.0001) 2.991805843171258E+05, /* I = 51 */
1516 (PID.TID 0000.0001) . . .
1517 (PID.TID 0000.0001) 1.950254041626018E+05, /* I = 94 */
1518 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 95 */
1519 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 96 */
1520 (PID.TID 0000.0001) 1.009837800879055E+05, /* I = 97 */
1521 (PID.TID 0000.0001) 1.403701524205398E+05, /* I = 98 */
1522 (PID.TID 0000.0001) 1.716197227386011E+05, /* I = 99 */
1523 (PID.TID 0000.0001) . . .
1524 (PID.TID 0000.0001) 2.963715635865306E+05, /* I =142 */
1525 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =143 */
1526 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =144 */
1527 (PID.TID 0000.0001) 3.014246674484008E+05, /* I =145 */
1528 (PID.TID 0000.0001) 3.008638765647886E+05, /* I =146 */
1529 (PID.TID 0000.0001) 2.991805843171258E+05, /* I =147 */
1530 (PID.TID 0000.0001) . . .
1531 (PID.TID 0000.0001) 1.950254041626018E+05, /* I =190 */
1532 (PID.TID 0000.0001) 1.716197227386011E+05, /* I =191 */
1533 (PID.TID 0000.0001) 1.403701524205398E+05 /* I =192 */
1534 (PID.TID 0000.0001) ;
1535 (PID.TID 0000.0001) dyG = /* dyG(1,:,1,:) ( units: m ) */
1536 (PID.TID 0000.0001) 1.009837800879055E+05, /* J = 1 */
1537 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 2 */
1538 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 3 */
1539 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 4 */
1540 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 5 */
1541 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 6 */
1542 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 7 */
1543 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 8 */
1544 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 9 */
1545 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 10 */
1546 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 11 */
1547 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 12 */
1548 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 13 */
1549 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 14 */
1550 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 15 */
1551 (PID.TID 0000.0001) 2 @ 3.011625828699101E+05, /* J = 16: 17 */
1552 (PID.TID 0000.0001) 3.000380090330854E+05, /* J = 18 */
1553 (PID.TID 0000.0001) 2.977867909042096E+05, /* J = 19 */
1554 (PID.TID 0000.0001) 2.944035815526416E+05, /* J = 20 */
1555 (PID.TID 0000.0001) 2.898778860929753E+05, /* J = 21 */
1556 (PID.TID 0000.0001) 2.841906470085516E+05, /* J = 22 */
1557 (PID.TID 0000.0001) 2.773091043277394E+05, /* J = 23 */
1558 (PID.TID 0000.0001) 2.691790288994575E+05, /* J = 24 */
1559 (PID.TID 0000.0001) 2.597126963772147E+05, /* J = 25 */
1560 (PID.TID 0000.0001) 2.487693460283865E+05, /* J = 26 */
1561 (PID.TID 0000.0001) 2.361211699596122E+05, /* J = 27 */
1562 (PID.TID 0000.0001) 2.213884732245467E+05, /* J = 28 */
1563 (PID.TID 0000.0001) 2.038999045536999E+05, /* J = 29 */
1564 (PID.TID 0000.0001) 1.823321598773926E+05, /* J = 30 */
1565 (PID.TID 0000.0001) 1.534505834330338E+05, /* J = 31 */
1566 (PID.TID 0000.0001) 1.009837800879055E+05 /* J = 32 */
1567 (PID.TID 0000.0001) ;
1568 (PID.TID 0000.0001) dxC = /* dxC(:,1,:,1) ( units: m ) */
1569 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
1570 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 2 */
1571 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 3 */
1572 (PID.TID 0000.0001) . . .
1573 (PID.TID 0000.0001) 2.963038832565530E+05, /* I = 46 */
1574 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 47 */
1575 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 48 */
1576 (PID.TID 0000.0001) 3.013593857228136E+05, /* I = 49 */
1577 (PID.TID 0000.0001) 3.007982711627968E+05, /* I = 50 */
1578 (PID.TID 0000.0001) 2.991142470004740E+05, /* I = 51 */
1579 (PID.TID 0000.0001) . . .
1580 (PID.TID 0000.0001) 1.946503699269892E+05, /* I = 94 */
1581 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 95 */
1582 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 96 */
1583 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
1584 (PID.TID 0000.0001) 1.391343389937106E+05, /* I = 98 */
1585 (PID.TID 0000.0001) 1.709574999026266E+05, /* I = 99 */
1586 (PID.TID 0000.0001) . . .
1587 (PID.TID 0000.0001) 2.963038832565530E+05, /* I =142 */
1588 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =143 */
1589 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =144 */
1590 (PID.TID 0000.0001) 3.013593857228136E+05, /* I =145 */
1591 (PID.TID 0000.0001) 3.007982711627968E+05, /* I =146 */
1592 (PID.TID 0000.0001) 2.991142470004740E+05, /* I =147 */
1593 (PID.TID 0000.0001) . . .
1594 (PID.TID 0000.0001) 1.946503699269892E+05, /* I =190 */
1595 (PID.TID 0000.0001) 1.709574999026266E+05, /* I =191 */
1596 (PID.TID 0000.0001) 1.391343389937106E+05 /* I =192 */
1597 (PID.TID 0000.0001) ;
1598 (PID.TID 0000.0001) dxC = /* dxC(1,:,1,:) ( units: m ) */
1599 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
1600 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 2 */
1601 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 3 */
1602 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 4 */
1603 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 5 */
1604 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 6 */
1605 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 7 */
1606 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 8 */
1607 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 9 */
1608 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 10 */
1609 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 11 */
1610 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 12 */
1611 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 13 */
1612 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 14 */
1613 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 15 */
1614 (PID.TID 0000.0001) 2 @ 3.012281885409289E+05, /* J = 16: 17 */
1615 (PID.TID 0000.0001) 3.001044073506459E+05, /* J = 18 */
1616 (PID.TID 0000.0001) 2.978547649292580E+05, /* J = 19 */
1617 (PID.TID 0000.0001) 2.944741346384699E+05, /* J = 20 */
1618 (PID.TID 0000.0001) 2.899523122489403E+05, /* J = 21 */
1619 (PID.TID 0000.0001) 2.842706922224557E+05, /* J = 22 */
1620 (PID.TID 0000.0001) 2.773972106720365E+05, /* J = 23 */
1621 (PID.TID 0000.0001) 2.692787333338535E+05, /* J = 24 */
1622 (PID.TID 0000.0001) 2.598293319150326E+05, /* J = 25 */
1623 (PID.TID 0000.0001) 2.489113743322025E+05, /* J = 26 */
1624 (PID.TID 0000.0001) 2.363029564123586E+05, /* J = 27 */
1625 (PID.TID 0000.0001) 2.216367828252819E+05, /* J = 28 */
1626 (PID.TID 0000.0001) 2.042717761866506E+05, /* J = 29 */
1627 (PID.TID 0000.0001) 1.829777599966776E+05, /* J = 30 */
1628 (PID.TID 0000.0001) 1.549545757850771E+05, /* J = 31 */
1629 (PID.TID 0000.0001) 1.114203141013064E+05 /* J = 32 */
1630 (PID.TID 0000.0001) ;
1631 (PID.TID 0000.0001) dyC = /* dyC(:,1,:,1) ( units: m ) */
1632 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 1 */
1633 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 2 */
1634 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 3 */
1635 (PID.TID 0000.0001) . . .
1636 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 46 */
1637 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 47 */
1638 (PID.TID 0000.0001) 3.012281885409289E+05, /* I = 48 */
1639 (PID.TID 0000.0001) 3.012281885409289E+05, /* I = 49 */
1640 (PID.TID 0000.0001) 3.001044073506459E+05, /* I = 50 */
1641 (PID.TID 0000.0001) 2.978547649292580E+05, /* I = 51 */
1642 (PID.TID 0000.0001) . . .
1643 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 94 */
1644 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 95 */
1645 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 96 */
1646 (PID.TID 0000.0001) 1.114203141013064E+05, /* I = 97 */
1647 (PID.TID 0000.0001) 1.549545757850771E+05, /* I = 98 */
1648 (PID.TID 0000.0001) 1.829777599966776E+05, /* I = 99 */
1649 (PID.TID 0000.0001) . . .
1650 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =142 */
1651 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =143 */
1652 (PID.TID 0000.0001) 3.012281885409289E+05, /* I =144 */
1653 (PID.TID 0000.0001) 3.012281885409289E+05, /* I =145 */
1654 (PID.TID 0000.0001) 3.001044073506459E+05, /* I =146 */
1655 (PID.TID 0000.0001) 2.978547649292580E+05, /* I =147 */
1656 (PID.TID 0000.0001) . . .
1657 (PID.TID 0000.0001) 1.829777599966776E+05, /* I =190 */
1658 (PID.TID 0000.0001) 1.549545757850771E+05, /* I =191 */
1659 (PID.TID 0000.0001) 1.114203141013064E+05 /* I =192 */
1660 (PID.TID 0000.0001) ;
1661 (PID.TID 0000.0001) dyC = /* dyC(1,:,1,:) ( units: m ) */
1662 (PID.TID 0000.0001) 1.114203141013064E+05, /* J = 1 */
1663 (PID.TID 0000.0001) 1.391343389937106E+05, /* J = 2 */
1664 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 3 */
1665 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 4 */
1666 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 5 */
1667 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 6 */
1668 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 7 */
1669 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 8 */
1670 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 9 */
1671 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 10 */
1672 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 11 */
1673 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 12 */
1674 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 13 */
1675 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 14 */
1676 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 15 */
1677 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 16 */
1678 (PID.TID 0000.0001) 3.013593857228136E+05, /* J = 17 */
1679 (PID.TID 0000.0001) 3.007982711627968E+05, /* J = 18 */
1680 (PID.TID 0000.0001) 2.991142470004740E+05, /* J = 19 */
1681 (PID.TID 0000.0001) 2.963038832565530E+05, /* J = 20 */
1682 (PID.TID 0000.0001) 2.923599955312932E+05, /* J = 21 */
1683 (PID.TID 0000.0001) 2.872689479506990E+05, /* J = 22 */
1684 (PID.TID 0000.0001) 2.810065951609633E+05, /* J = 23 */
1685 (PID.TID 0000.0001) 2.735321911346108E+05, /* J = 24 */
1686 (PID.TID 0000.0001) 2.647791839299727E+05, /* J = 25 */
1687 (PID.TID 0000.0001) 2.546408290696998E+05, /* J = 26 */
1688 (PID.TID 0000.0001) 2.429464709770498E+05, /* J = 27 */
1689 (PID.TID 0000.0001) 2.294195678257306E+05, /* J = 28 */
1690 (PID.TID 0000.0001) 2.135964483342134E+05, /* J = 29 */
1691 (PID.TID 0000.0001) 1.946503699269892E+05, /* J = 30 */
1692 (PID.TID 0000.0001) 1.709574999026266E+05, /* J = 31 */
1693 (PID.TID 0000.0001) 1.391343389937106E+05 /* J = 32 */
1694 (PID.TID 0000.0001) ;
1695 (PID.TID 0000.0001) dxV = /* dxV(:,1,:,1) ( units: m ) */
1696 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
1697 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 2 */
1698 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 3 */
1699 (PID.TID 0000.0001) . . .
1700 (PID.TID 0000.0001) 2.962371870847826E+05, /* I = 46 */
1701 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 47 */
1702 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 48 */
1703 (PID.TID 0000.0001) 3.013031486919771E+05, /* I = 49 */
1704 (PID.TID 0000.0001) 3.007409169495504E+05, /* I = 50 */
1705 (PID.TID 0000.0001) 2.990534755671296E+05, /* I = 51 */
1706 (PID.TID 0000.0001) . . .
1707 (PID.TID 0000.0001) 1.937548202849060E+05, /* I = 94 */
1708 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 95 */
1709 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 96 */
1710 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
1711 (PID.TID 0000.0001) 1.333130744933864E+05, /* I = 98 */
1712 (PID.TID 0000.0001) 1.691744868129062E+05, /* I = 99 */
1713 (PID.TID 0000.0001) . . .
1714 (PID.TID 0000.0001) 2.962371870847826E+05, /* I =142 */
1715 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =143 */
1716 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =144 */
1717 (PID.TID 0000.0001) 3.013031486919771E+05, /* I =145 */
1718 (PID.TID 0000.0001) 3.007409169495504E+05, /* I =146 */
1719 (PID.TID 0000.0001) 2.990534755671296E+05, /* I =147 */
1720 (PID.TID 0000.0001) . . .
1721 (PID.TID 0000.0001) 1.937548202849060E+05, /* I =190 */
1722 (PID.TID 0000.0001) 1.691744868129062E+05, /* I =191 */
1723 (PID.TID 0000.0001) 1.333130744933864E+05 /* I =192 */
1724 (PID.TID 0000.0001) ;
1725 (PID.TID 0000.0001) dxV = /* dxV(1,:,1,:) ( units: m ) */
1726 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
1727 (PID.TID 0000.0001) 1.362652340208229E+05, /* J = 2 */
1728 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 3 */
1729 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 4 */
1730 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 5 */
1731 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 6 */
1732 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 7 */
1733 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 8 */
1734 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 9 */
1735 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 10 */
1736 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 11 */
1737 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 12 */
1738 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 13 */
1739 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 14 */
1740 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 15 */
1741 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 16 */
1742 (PID.TID 0000.0001) 3.013686170436881E+05, /* J = 17 */
1743 (PID.TID 0000.0001) 3.008068453676764E+05, /* J = 18 */
1744 (PID.TID 0000.0001) 2.991205495886625E+05, /* J = 19 */
1745 (PID.TID 0000.0001) 2.963063101754721E+05, /* J = 20 */
1746 (PID.TID 0000.0001) 2.923567890694162E+05, /* J = 21 */
1747 (PID.TID 0000.0001) 2.872580915202295E+05, /* J = 22 */
1748 (PID.TID 0000.0001) 2.809856491525217E+05, /* J = 23 */
1749 (PID.TID 0000.0001) 2.734980225206389E+05, /* J = 24 */
1750 (PID.TID 0000.0001) 2.647274964828301E+05, /* J = 25 */
1751 (PID.TID 0000.0001) 2.545652950875683E+05, /* J = 26 */
1752 (PID.TID 0000.0001) 2.428369969078989E+05, /* J = 27 */
1753 (PID.TID 0000.0001) 2.292584591272880E+05, /* J = 28 */
1754 (PID.TID 0000.0001) 2.133486626971531E+05, /* J = 29 */
1755 (PID.TID 0000.0001) 1.942331448101592E+05, /* J = 30 */
1756 (PID.TID 0000.0001) 1.701080315742101E+05, /* J = 31 */
1757 (PID.TID 0000.0001) 1.362652340208229E+05 /* J = 32 */
1758 (PID.TID 0000.0001) ;
1759 (PID.TID 0000.0001) dyU = /* dyU(:,1,:,1) ( units: m ) */
1760 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 1 */
1761 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 2 */
1762 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 3 */
1763 (PID.TID 0000.0001) . . .
1764 (PID.TID 0000.0001) 2.963063101754721E+05, /* I = 46 */
1765 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 47 */
1766 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 48 */
1767 (PID.TID 0000.0001) 3.013686170436881E+05, /* I = 49 */
1768 (PID.TID 0000.0001) 3.008068453676764E+05, /* I = 50 */
1769 (PID.TID 0000.0001) 2.991205495886625E+05, /* I = 51 */
1770 (PID.TID 0000.0001) . . .
1771 (PID.TID 0000.0001) 1.942331448101592E+05, /* I = 94 */
1772 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 95 */
1773 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 96 */
1774 (PID.TID 0000.0001) 8.015229982413632E+04, /* I = 97 */
1775 (PID.TID 0000.0001) 1.362652340208229E+05, /* I = 98 */
1776 (PID.TID 0000.0001) 1.701080315742101E+05, /* I = 99 */
1777 (PID.TID 0000.0001) . . .
1778 (PID.TID 0000.0001) 2.963063101754721E+05, /* I =142 */
1779 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =143 */
1780 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =144 */
1781 (PID.TID 0000.0001) 3.013686170436881E+05, /* I =145 */
1782 (PID.TID 0000.0001) 3.008068453676764E+05, /* I =146 */
1783 (PID.TID 0000.0001) 2.991205495886625E+05, /* I =147 */
1784 (PID.TID 0000.0001) . . .
1785 (PID.TID 0000.0001) 1.942331448101592E+05, /* I =190 */
1786 (PID.TID 0000.0001) 1.701080315742101E+05, /* I =191 */
1787 (PID.TID 0000.0001) 1.362652340208229E+05 /* I =192 */
1788 (PID.TID 0000.0001) ;
1789 (PID.TID 0000.0001) dyU = /* dyU(1,:,1,:) ( units: m ) */
1790 (PID.TID 0000.0001) 8.015229982413632E+04, /* J = 1 */
1791 (PID.TID 0000.0001) 1.333130744933864E+05, /* J = 2 */
1792 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 3 */
1793 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 4 */
1794 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 5 */
1795 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 6 */
1796 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 7 */
1797 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 8 */
1798 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 9 */
1799 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 10 */
1800 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 11 */
1801 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 12 */
1802 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 13 */
1803 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 14 */
1804 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 15 */
1805 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 16 */
1806 (PID.TID 0000.0001) 3.013031486919771E+05, /* J = 17 */
1807 (PID.TID 0000.0001) 3.007409169495504E+05, /* J = 18 */
1808 (PID.TID 0000.0001) 2.990534755671296E+05, /* J = 19 */
1809 (PID.TID 0000.0001) 2.962371870847826E+05, /* J = 20 */
1810 (PID.TID 0000.0001) 2.922844849381675E+05, /* J = 21 */
1811 (PID.TID 0000.0001) 2.871811105274442E+05, /* J = 22 */
1812 (PID.TID 0000.0001) 2.809019351693761E+05, /* J = 23 */
1813 (PID.TID 0000.0001) 2.734046499619031E+05, /* J = 24 */
1814 (PID.TID 0000.0001) 2.646201463834826E+05, /* J = 25 */
1815 (PID.TID 0000.0001) 2.544372984215561E+05, /* J = 26 */
1816 (PID.TID 0000.0001) 2.426774358027003E+05, /* J = 27 */
1817 (PID.TID 0000.0001) 2.290479919481738E+05, /* J = 28 */
1818 (PID.TID 0000.0001) 2.130490056267208E+05, /* J = 29 */
1819 (PID.TID 0000.0001) 1.937548202849060E+05, /* J = 30 */
1820 (PID.TID 0000.0001) 1.691744868129062E+05, /* J = 31 */
1821 (PID.TID 0000.0001) 1.333130744933864E+05 /* J = 32 */
1822 (PID.TID 0000.0001) ;
1823 (PID.TID 0000.0001) rA = /* rA (:,1,:,1) ( units: m^2 ) */
1824 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 1 */
1825 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 2 */
1826 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 3 */
1827 (PID.TID 0000.0001) . . .
1828 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 46 */
1829 (PID.TID 0000.0001) 9.008620045350865E+10, /* I = 47 */
1830 (PID.TID 0000.0001) 9.076111290418457E+10, /* I = 48 */
1831 (PID.TID 0000.0001) 9.076111290422060E+10, /* I = 49 */
1832 (PID.TID 0000.0001) 9.008620045354469E+10, /* I = 50 */
1833 (PID.TID 0000.0001) 8.874277443041928E+10, /* I = 51 */
1834 (PID.TID 0000.0001) . . .
1835 (PID.TID 0000.0001) 3.378518544304265E+10, /* I = 94 */
1836 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 95 */
1837 (PID.TID 0000.0001) 1.401900702259215E+10, /* I = 96 */
1838 (PID.TID 0000.0001) 1.401900702255611E+10, /* I = 97 */
1839 (PID.TID 0000.0001) 2.459906945574446E+10, /* I = 98 */
1840 (PID.TID 0000.0001) 3.378518544307869E+10, /* I = 99 */
1841 (PID.TID 0000.0001) . . .
1842 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =142 */
1843 (PID.TID 0000.0001) 9.008620045350865E+10, /* I =143 */
1844 (PID.TID 0000.0001) 9.076111290418457E+10, /* I =144 */
1845 (PID.TID 0000.0001) 9.076111290422060E+10, /* I =145 */
1846 (PID.TID 0000.0001) 9.008620045354469E+10, /* I =146 */
1847 (PID.TID 0000.0001) 8.874277443041928E+10, /* I =147 */
1848 (PID.TID 0000.0001) . . .
1849 (PID.TID 0000.0001) 3.378518544304265E+10, /* I =190 */
1850 (PID.TID 0000.0001) 2.459906945574446E+10, /* I =191 */
1851 (PID.TID 0000.0001) 1.401900702259215E+10 /* I =192 */
1852 (PID.TID 0000.0001) ;
1853 (PID.TID 0000.0001) rA = /* rA (1,:,1,:) ( units: m^2 ) */
1854 (PID.TID 0000.0001) 1.401900702255611E+10, /* J = 1 */
1855 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 2 */
1856 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 3 */
1857 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 4 */
1858 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 5 */
1859 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 6 */
1860 (PID.TID 0000.0001) 6.203683527776127E+10, /* J = 7 */
1861 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 8 */
1862 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 9 */
1863 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 10 */
1864 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 11 */
1865 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 12 */
1866 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 13 */
1867 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 14 */
1868 (PID.TID 0000.0001) 9.008620045350865E+10, /* J = 15 */
1869 (PID.TID 0000.0001) 9.076111290418457E+10, /* J = 16 */
1870 (PID.TID 0000.0001) 9.076111290422060E+10, /* J = 17 */
1871 (PID.TID 0000.0001) 9.008620045354469E+10, /* J = 18 */
1872 (PID.TID 0000.0001) 8.874277443041928E+10, /* J = 19 */
1873 (PID.TID 0000.0001) 8.674306976737517E+10, /* J = 20 */
1874 (PID.TID 0000.0001) 8.410423102799828E+10, /* J = 21 */
1875 (PID.TID 0000.0001) 8.084683449728902E+10, /* J = 22 */
1876 (PID.TID 0000.0001) 7.699293007098555E+10, /* J = 23 */
1877 (PID.TID 0000.0001) 7.256353271748119E+10, /* J = 24 */
1878 (PID.TID 0000.0001) 6.757541173817516E+10, /* J = 25 */
1879 (PID.TID 0000.0001) 6.203683527772523E+10, /* J = 26 */
1880 (PID.TID 0000.0001) 5.594154126607553E+10, /* J = 27 */
1881 (PID.TID 0000.0001) 4.925938996118163E+10, /* J = 28 */
1882 (PID.TID 0000.0001) 4.192037169898667E+10, /* J = 29 */
1883 (PID.TID 0000.0001) 3.378518544307869E+10, /* J = 30 */
1884 (PID.TID 0000.0001) 2.459906945574446E+10, /* J = 31 */
1885 (PID.TID 0000.0001) 1.401900702259215E+10 /* J = 32 */
1886 (PID.TID 0000.0001) ;
1887 (PID.TID 0000.0001) rAw = /* rAw(:,1,:,1) ( units: m^2 ) */
1888 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
1889 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 2 */
1890 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 3 */
1891 (PID.TID 0000.0001) . . .
1892 (PID.TID 0000.0001) 8.781353403175085E+10, /* I = 46 */
1893 (PID.TID 0000.0001) 8.948571540392021E+10, /* I = 47 */
1894 (PID.TID 0000.0001) 9.049530583086168E+10, /* I = 48 */
1895 (PID.TID 0000.0001) 9.083293515008307E+10, /* I = 49 */
1896 (PID.TID 0000.0001) 9.049530583087070E+10, /* I = 50 */
1897 (PID.TID 0000.0001) 8.948571540391121E+10, /* I = 51 */
1898 (PID.TID 0000.0001) . . .
1899 (PID.TID 0000.0001) 3.801790263325260E+10, /* I = 94 */
1900 (PID.TID 0000.0001) 2.943712825251114E+10, /* I = 95 */
1901 (PID.TID 0000.0001) 1.974052138509018E+10, /* I = 96 */
1902 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
1903 (PID.TID 0000.0001) 1.974052138506315E+10, /* I = 98 */
1904 (PID.TID 0000.0001) 2.943712825252015E+10, /* I = 99 */
1905 (PID.TID 0000.0001) . . .
1906 (PID.TID 0000.0001) 8.781353403175085E+10, /* I =142 */
1907 (PID.TID 0000.0001) 8.948571540392021E+10, /* I =143 */
1908 (PID.TID 0000.0001) 9.049530583086168E+10, /* I =144 */
1909 (PID.TID 0000.0001) 9.083293515008307E+10, /* I =145 */
1910 (PID.TID 0000.0001) 9.049530583087070E+10, /* I =146 */
1911 (PID.TID 0000.0001) 8.948571540391121E+10, /* I =147 */
1912 (PID.TID 0000.0001) . . .
1913 (PID.TID 0000.0001) 3.801790263325260E+10, /* I =190 */
1914 (PID.TID 0000.0001) 2.943712825251114E+10, /* I =191 */
1915 (PID.TID 0000.0001) 1.974052138509018E+10 /* I =192 */
1916 (PID.TID 0000.0001) ;
1917 (PID.TID 0000.0001) rAw = /* rAw(1,:,1,:) ( units: m^2 ) */
1918 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
1919 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 2 */
1920 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 3 */
1921 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 4 */
1922 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 5 */
1923 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 6 */
1924 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 7 */
1925 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 8 */
1926 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 9 */
1927 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 10 */
1928 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 11 */
1929 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 12 */
1930 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 13 */
1931 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 14 */
1932 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 15 */
1933 (PID.TID 0000.0001) 2 @ 9.071447638299399E+10, /* J = 16: 17 */
1934 (PID.TID 0000.0001) 9.003884657168852E+10, /* J = 18 */
1935 (PID.TID 0000.0001) 8.869393350723613E+10, /* J = 19 */
1936 (PID.TID 0000.0001) 8.669186205742538E+10, /* J = 20 */
1937 (PID.TID 0000.0001) 8.404959656062837E+10, /* J = 21 */
1938 (PID.TID 0000.0001) 8.078743937057304E+10, /* J = 22 */
1939 (PID.TID 0000.0001) 7.692702995909871E+10, /* J = 23 */
1940 (PID.TID 0000.0001) 7.248875782324815E+10, /* J = 24 */
1941 (PID.TID 0000.0001) 6.748840226738273E+10, /* J = 25 */
1942 (PID.TID 0000.0001) 6.193257577506788E+10, /* J = 26 */
1943 (PID.TID 0000.0001) 5.581203765722643E+10, /* J = 27 */
1944 (PID.TID 0000.0001) 4.909074590409593E+10, /* J = 28 */
1945 (PID.TID 0000.0001) 4.168532893152940E+10, /* J = 29 */
1946 (PID.TID 0000.0001) 3.341968103208270E+10, /* J = 30 */
1947 (PID.TID 0000.0001) 2.390126200743558E+10, /* J = 31 */
1948 (PID.TID 0000.0001) 1.216690346714270E+10 /* J = 32 */
1949 (PID.TID 0000.0001) ;
1950 (PID.TID 0000.0001) rAs = /* rAs(:,1,:,1) ( units: m^2 ) */
1951 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 1 */
1952 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 2 */
1953 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 3 */
1954 (PID.TID 0000.0001) . . .
1955 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 46 */
1956 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 47 */
1957 (PID.TID 0000.0001) 9.071447638299399E+10, /* I = 48 */
1958 (PID.TID 0000.0001) 9.071447638299399E+10, /* I = 49 */
1959 (PID.TID 0000.0001) 9.003884657168852E+10, /* I = 50 */
1960 (PID.TID 0000.0001) 8.869393350723613E+10, /* I = 51 */
1961 (PID.TID 0000.0001) . . .
1962 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 94 */
1963 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 95 */
1964 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 96 */
1965 (PID.TID 0000.0001) 1.216690346714270E+10, /* I = 97 */
1966 (PID.TID 0000.0001) 2.390126200743558E+10, /* I = 98 */
1967 (PID.TID 0000.0001) 3.341968103208270E+10, /* I = 99 */
1968 (PID.TID 0000.0001) . . .
1969 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =142 */
1970 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =143 */
1971 (PID.TID 0000.0001) 9.071447638299399E+10, /* I =144 */
1972 (PID.TID 0000.0001) 9.071447638299399E+10, /* I =145 */
1973 (PID.TID 0000.0001) 9.003884657168852E+10, /* I =146 */
1974 (PID.TID 0000.0001) 8.869393350723613E+10, /* I =147 */
1975 (PID.TID 0000.0001) . . .
1976 (PID.TID 0000.0001) 3.341968103208270E+10, /* I =190 */
1977 (PID.TID 0000.0001) 2.390126200743558E+10, /* I =191 */
1978 (PID.TID 0000.0001) 1.216690346714270E+10 /* I =192 */
1979 (PID.TID 0000.0001) ;
1980 (PID.TID 0000.0001) rAs = /* rAs(1,:,1,:) ( units: m^2 ) */
1981 (PID.TID 0000.0001) 1.216690346714270E+10, /* J = 1 */
1982 (PID.TID 0000.0001) 1.974052138506315E+10, /* J = 2 */
1983 (PID.TID 0000.0001) 2.943712825252015E+10, /* J = 3 */
1984 (PID.TID 0000.0001) 3.801790263324359E+10, /* J = 4 */
1985 (PID.TID 0000.0001) 4.571243814189866E+10, /* J = 5 */
1986 (PID.TID 0000.0001) 5.269930713599979E+10, /* J = 6 */
1987 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 7 */
1988 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 8 */
1989 (PID.TID 0000.0001) 7.014205907741882E+10, /* J = 9 */
1990 (PID.TID 0000.0001) 7.484854821847499E+10, /* J = 10 */
1991 (PID.TID 0000.0001) 7.898934631431560E+10, /* J = 11 */
1992 (PID.TID 0000.0001) 8.254500894894537E+10, /* J = 12 */
1993 (PID.TID 0000.0001) 8.549360686473492E+10, /* J = 13 */
1994 (PID.TID 0000.0001) 8.781353403175085E+10, /* J = 14 */
1995 (PID.TID 0000.0001) 8.948571540392021E+10, /* J = 15 */
1996 (PID.TID 0000.0001) 9.049530583086168E+10, /* J = 16 */
1997 (PID.TID 0000.0001) 9.083293515008307E+10, /* J = 17 */
1998 (PID.TID 0000.0001) 9.049530583087070E+10, /* J = 18 */
1999 (PID.TID 0000.0001) 8.948571540391121E+10, /* J = 19 */
2000 (PID.TID 0000.0001) 8.781353403174185E+10, /* J = 20 */
2001 (PID.TID 0000.0001) 8.549360686467184E+10, /* J = 21 */
2002 (PID.TID 0000.0001) 8.254500894890933E+10, /* J = 22 */
2003 (PID.TID 0000.0001) 7.898934631434262E+10, /* J = 23 */
2004 (PID.TID 0000.0001) 7.484854821844795E+10, /* J = 24 */
2005 (PID.TID 0000.0001) 7.014205907742783E+10, /* J = 25 */
2006 (PID.TID 0000.0001) 6.488320895111514E+10, /* J = 26 */
2007 (PID.TID 0000.0001) 5.907428494299063E+10, /* J = 27 */
2008 (PID.TID 0000.0001) 5.269930713599078E+10, /* J = 28 */
2009 (PID.TID 0000.0001) 4.571243814190767E+10, /* J = 29 */
2010 (PID.TID 0000.0001) 3.801790263325260E+10, /* J = 30 */
2011 (PID.TID 0000.0001) 2.943712825251114E+10, /* J = 31 */
2012 (PID.TID 0000.0001) 1.974052138509018E+10 /* J = 32 */
2013 (PID.TID 0000.0001) ;
2014 (PID.TID 0000.0001) globalArea = /* Integrated horizontal Area (m^2) */
2015 (PID.TID 0000.0001) 3.638867375081598E+14
2016 (PID.TID 0000.0001) ;
2017 (PID.TID 0000.0001) // =======================================================
2018 (PID.TID 0000.0001) // End of Model config. summary
2019 (PID.TID 0000.0001) // =======================================================
2020 (PID.TID 0000.0001)
2021 (PID.TID 0000.0001) == Packages configuration : Check & print summary ==
2022 (PID.TID 0000.0001)
2023 (PID.TID 0000.0001) GMREDI_CHECK: #define GMREDI
2024 (PID.TID 0000.0001) GM_AdvForm = /* if FALSE => use SkewFlux Form */
2025 (PID.TID 0000.0001) F
2026 (PID.TID 0000.0001) ;
2027 (PID.TID 0000.0001) GM_InMomAsStress = /* if TRUE => apply as Eddy Stress */
2028 (PID.TID 0000.0001) F
2029 (PID.TID 0000.0001) ;
2030 (PID.TID 0000.0001) GM_AdvSeparate = /* Calc Bolus & Euler Adv. separately */
2031 (PID.TID 0000.0001) F
2032 (PID.TID 0000.0001) ;
2033 (PID.TID 0000.0001) GM_ExtraDiag = /* Tensor Extra Diag (line 1&2) non 0 */
2034 (PID.TID 0000.0001) F
2035 (PID.TID 0000.0001) ;
2036 (PID.TID 0000.0001) GM_isopycK = /* Background Isopyc. Diffusivity [m^2/s] */
2037 (PID.TID 0000.0001) 8.000000000000000E+02
2038 (PID.TID 0000.0001) ;
2039 (PID.TID 0000.0001) GM_skewflx*K = /* Background GM_SkewFlx Diffusivity [m^2/s] */
2040 (PID.TID 0000.0001) 8.000000000000000E+02
2041 (PID.TID 0000.0001) ;
2042 (PID.TID 0000.0001) GM_advec*K = /* Backg. GM-Advec(=Bolus) Diffusivity [m^2/s]*/
2043 (PID.TID 0000.0001) 0.000000000000000E+00
2044 (PID.TID 0000.0001) ;
2045 (PID.TID 0000.0001) GM_Kmin_horiz = /* Minimum Horizontal Diffusivity [m^2/s] */
2046 (PID.TID 0000.0001) 5.000000000000000E+01
2047 (PID.TID 0000.0001) ;
2048 (PID.TID 0000.0001) GM_Visbeck_alpha = /* Visbeck alpha coeff. [-] */
2049 (PID.TID 0000.0001) 0.000000000000000E+00
2050 (PID.TID 0000.0001) ;
2051 (PID.TID 0000.0001) GM_Small_Number = /* epsilon used in slope calc */
2052 (PID.TID 0000.0001) 9.999999999999999E-21
2053 (PID.TID 0000.0001) ;
2054 (PID.TID 0000.0001) GM_slopeSqCutoff = /* Slope^2 cut-off value */
2055 (PID.TID 0000.0001) 1.000000000000000E+48
2056 (PID.TID 0000.0001) ;
2057 (PID.TID 0000.0001) GM_taper_scheme = /* Type of Tapering/Clipping scheme */
2058 (PID.TID 0000.0001) 'gkw91 '
2059 (PID.TID 0000.0001) ;
2060 (PID.TID 0000.0001) GM_maxSlope = /* Maximum Slope (Tapering/Clipping) */
2061 (PID.TID 0000.0001) 1.000000000000000E-02
2062 (PID.TID 0000.0001) ;
2063 (PID.TID 0000.0001) GM_facTrL2dz = /* Minimum Trans.Layer Thick. (factor of dz) */
2064 (PID.TID 0000.0001) 1.000000000000000E+00
2065 (PID.TID 0000.0001) ;
2066 (PID.TID 0000.0001) GM_facTrL2ML = /* Max.Trans.Layer Thick. (factor of MxL Depth)*/
2067 (PID.TID 0000.0001) 5.000000000000000E+00
2068 (PID.TID 0000.0001) ;
2069 (PID.TID 0000.0001) GM_maxTransLay = /* Maximum Transition Layer Thickness [m] */
2070 (PID.TID 0000.0001) 5.000000000000000E+02
2071 (PID.TID 0000.0001) ;
2072 (PID.TID 0000.0001) GM_UseBVP = /* if TRUE => use bvp a la Ferrari et al. (2010) */
2073 (PID.TID 0000.0001) F
2074 (PID.TID 0000.0001) ;
2075 (PID.TID 0000.0001) GM_BVP_ModeNumber = /* Vertical mode number for BVP wave speed */
2076 (PID.TID 0000.0001) 1
2077 (PID.TID 0000.0001) ;
2078 (PID.TID 0000.0001) GM_BVP_cMin = /* Minimum wave speed for BVP [m/s] */
2079 (PID.TID 0000.0001) 1.000000000000000E-01
2080 (PID.TID 0000.0001) ;
2081 (PID.TID 0000.0001) GM_useSubMeso = /* if TRUE => use Sub-Meso param. (B.Fox-Kemper) */
2082 (PID.TID 0000.0001) F
2083 (PID.TID 0000.0001) ;
2084 (PID.TID 0000.0001) subMeso_Ceff = /* efficiency coeff. of Mixed-Layer Eddies [-] */
2085 (PID.TID 0000.0001) 7.000000000000001E-02
2086 (PID.TID 0000.0001) ;
2087 (PID.TID 0000.0001) subMeso_invTau = /* inverse of Sub-Meso mixing time-scale [/s] */
2088 (PID.TID 0000.0001) 2.000000000000000E-06
2089 (PID.TID 0000.0001) ;
2090 (PID.TID 0000.0001) subMeso_LfMin = /* minimum length-scale "Lf" [m] */
2091 (PID.TID 0000.0001) 1.000000000000000E+03
2092 (PID.TID 0000.0001) ;
2093 (PID.TID 0000.0001) subMeso_Lmax = /* maximum grid-scale length [m] */
2094 (PID.TID 0000.0001) 1.100000000000000E+05
2095 (PID.TID 0000.0001) ;
2097 (PID.TID 0000.0001) // =======================================================
2098 (PID.TID 0000.0001) // CONFIG_CHECK : Normal End
2099 (PID.TID 0000.0001) // =======================================================
2100 (PID.TID 0000.0001)
2101 (PID.TID 0000.0001) // =======================================================
2102 (PID.TID 0000.0001) // Field Atmosphere orography on ocean grid at iteration 1
2103 (PID.TID 0000.0001) // CMIN = 4.905667583685931E+04
2104 (PID.TID 0000.0001) // CMAX = 1.000000000000000E+05
2105 (PID.TID 0000.0001) // CINT = 1.886789783820026E+03
2106 (PID.TID 0000.0001) // SYMBOLS (CMIN->CMAX): -abcdefghijklmnopqrstuvwxyz+
2107 (PID.TID 0000.0001) // 0.0: .
2108 (PID.TID 0000.0001) // RANGE I (Lo:Hi:Step):( -1: 194: 1)
2109 (PID.TID 0000.0001) // RANGE J (Lo:Hi:Step):( 34: -1: -1)
2110 (PID.TID 0000.0001) // RANGE K (Lo:Hi:Step):( 1: 1: 1)
2111 (PID.TID 0000.0001) // =======================================================
2112 (PID.TID 0000.0001) K = 1
2113 (PID.TID 0000.0001) I=8 I=18 I=28 I=34 I=44 I=54 I=64 I=70 I=80 I=90 I=96 I=106 I=116 I=126 I=132 I=142 I=152 I=162 I=168 I=178 I=188
2114 (PID.TID 0000.0001) |--J--|101234567|901234567|901234567|901234123|567890123|567890123|567890123|563456789|123456789|123456789|123456785|789012345|789012345|789012345|789078901|345678901|345678901|345678901|901234567|901234567|901234567|901234
2115 (PID.TID 0000.0001) 34 ........................................................................................................................................................................................................................
2116 (PID.TID 0000.0001) 33 ........................................................................................................................................................................................................................
2117 (PID.TID 0000.0001) 32 ..++++++++++++++++wy+y+ww+xsrtwxyx....vonrywwzywommlmpppqtttsuy++yy++y....++++++++++yxxyyxxxxvqmnpqw++++++....++++++++++++++++++++++++++++++++....+++++++++++++++++zyxwwwww+++++++....++++++++++++++++++++++++++++++++..
2118 (PID.TID 0000.0001) 31 ..++++++++++++++wv++++++y+yxywxxyy....wqnotsswwphglqttrnnqssswz+++++++....+++++++++zxxxyyxxyxwuport+++++++....++++++++++++++++++++++++++++++++....+++++++++++++++++zyyxwwwww++++++....++++++++++++++++++++++++++++++++..
2119 (PID.TID 0000.0001) 30 ..++++++++++++++w+++++++++++++wwxz....yumnstsspmfdhmlhgfekosuxz+++++++....++++++++++xxxyzyyyxwwsptx+++++++....++++++++++++++++++++++++++++++++....++++++++++++++zzzzyyxxwxxwwy++++....++++++++++++++++++++++++++++++++..
2120 (PID.TID 0000.0001) 29 ..++++++++++++++++wwx+++++++++wwxy....zxrnosspllkeabbaabdhmsvyzz++++++....++++++++zxwwx++zyyxxwtps++++++++....++++++++++++++++++++++++++++++++....++++++++++++++yyzzyxxxxxxxxxz+++....++++++++++++++++++++++++++++++++..
2121 (PID.TID 0000.0001) 28 ..+++++++++++++xsvwxxxy+zzzzywwwwx....yzypnorqnrwnc--aaabelsvxyx++++++....++++++++zxxxx+++zyxxwvpr++++++++....++++++++++++++++++++++++++++++++....++++++++++++++yyzzyyxxyyyyyyzz++....++++++++++++++++++++++++++++++++..
2122 (PID.TID 0000.0001) 27 ..+++++++++++++vvwxxxxxxzzzyxwwvvw....xyz+++trrwzwkdabccbenvwxxw++++++....++++++++++xxyz++zyxxxwst++++++++....++++++++++++++++++++++++++++++++....+++++++++++++ywyz+zyxxyzz++zzz++....++++++++++++++++++++++++++++++++..
2123 (PID.TID 0000.0001) 26 ..++++++++++++yxxyxwwwwxyyxxyxyyvw....wxz++++yyyyyxvnmmmhhnuwxxy++++++....++++++++++++++++zyxxxwss++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywwx++zyyyxxxz++++z+....++++++++++++++++++++++++++++++++..
2124 (PID.TID 0000.0001) 25 ..+++++++++++yyyyyxvuvwwwxwxyxy+vv....wxzzx++++zxxxyxywwqorwxyy+++++++....++++++++++++x++yyyxxxwss++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywvwz+zzzwmkmrwyyzz+....++++++++++++++++++++++++++++++++..
2125 (PID.TID 0000.0001) 24 ..+++++++++++yyyyyxwwwwstwwxyxy+ws....wxyzz+++++xxxxy++xutvx++++++++++....++++++++++++xx+yyzyxxvst++++++++....++++++++++++++++++++++++++++++++....++++++++++++ywxz++zzukgfghkqvxzz....++++++++++++++++++++++++++++++++..
2126 (PID.TID 0000.0001) 23 ..+++++++++++zyyyyxxwwxxwwwxxxw++p....vwxz++++++yxxy+++ywwwx++++++++++....+++++++++oq+++xxzzyyxvsr++++++++....++++++++++++++++++++++++++++++++....++++++++++++trwy+++wher+yumhkrwx....y+++++++++++++++ww++++++++++++++..
2127 (PID.TID 0000.0001) 22 ..+++++++++++zyyyyxyxxyyxwwwxxvr++....wy++++++++yxy+++++yxxw++++++++++....+++++++++vlr+++x++zzywusw+++++++....++++++++++++++++++++++++++++++++....++++++++++++wpqvy+xrht++++++xuuv....ww+++++++++++++lhhknw+++++++++++..
2128 (PID.TID 0000.0001) 21 ..+++++++++++yxxyyyyxxyyxwwwxxrnv+....+++++++++++yy++++++zyxy+++++++++....+++++++++vkkn++++++++xuutw++++++....++++++++++++++++++++++++++++++++....x++++++++++++ywqsuop++++++++++++....wuwy++++++++++pkhghkklw+++++++++..
2129 (PID.TID 0000.0001) 20 ..+++++++++++yxxyyyxxwxxxwwxxxpmqv....wx+++++++++y++++++++++++++++++++....++++++++++khknwt++++++wwwx++++++....++++++++++++++++++++++++++++++++....xxxz++++++++++++wuw+++++++++++++....++++++++x+++++okhhhhklr+++++++++..
2130 (PID.TID 0000.0001) 19 ..++++++++++++yyyyyyxwwwxwwxxwrnqw....xy+++++++++++++++++y++++++++++++....+++++++x++qlkmxx++++++xyy+++++++....++++++++++++++++++++++++++++++++....xxwxz+++++++y+++++++++++++++++++....+++++++++ws++xqkhgghlow+++++++++..
2131 (PID.TID 0000.0001) 18 ..+++++++++++++++++++wwxxxxwwwutwx....z+++++++++++++++++yy++++yy++++++....+++z++++++++rs++++++++++++++++++....++++++++++++++++++++++++++++++++....yyxxz++++++y++++++++++++++++++++....++++++++++xv+xqlhgfghkr+++++++++..
2132 (PID.TID 0000.0001) 17 ..+++++++++++++++++++yxxyyxwturuy+....+++++++++++++++++++yy++ywy++++++....++zy++++++++++++++++++++y+++++++....++++++++++++++++++++++++++++++++....yzzyz++++zw+++++++++++++++++++++....++++++++++xuwupkhgffghkq++++++++..
2133 (PID.TID 0000.0001) 16 ..+++++++++++++++++++zxxxxxvrtqtz+....++++++++++++++++++++y++yy++++++z....wzz++++++++++++++++++++xxy++++++....++++++++++++++++++++++++++++++++....yyyzz++++yw+++++++++++++++++++++....++++++++++xsonnkhhggghho++++++++..
2134 (PID.TID 0000.0001) 15 ..zy++++++++++++++++++yxxxxvsusv++....+++++++++++++++++++++z++++++++++....txy++xw++++++++++++++++wwx++++++....++++++++++++++++++++++++++++++y+....xxxyz++++y++++++++++++++++++++++....+++++++++++uoqsvkkhhhhkp++++++++..
2135 (PID.TID 0000.0001) 14 ..yxxy++++++++++++++++ywwwwvtttw++....++++++++++++++++++++++++++++++++....twxzzxwwwx++++++++++++zxwx++++++....+++++++++++++++++++++++++++++++y....wwxxxyz++v++++++++++++++++++++++....+++++++++++woux+xmkhhklv++++++++..
2136 (PID.TID 0000.0001) 13 ..xxx++++++++++++++++++vvvvutsux++....++++++++++++++++++++++++++++++++....vwxz++zzyy+++++++++++zyxwxx+++++....++++++++++++++++++++++++++++++++....uttvwwvqot++++++++++++++++++++++....++++++++++++vwy++plkkko+++++++++..
2137 (PID.TID 0000.0001) 12 ..wwy+++++++++++++++++xsuvuuuuwx++....++++++++++++++++++++++++++++++++....wwxzzzzzyy+++++++z+++xwwv++x++++....++++++++++++++++++++++++++++++++....nmlossqoq+++++++++++++++++++++++....+++++++++++++++++qlkklw+++++++++..
2138 (PID.TID 0000.0001) 11 ..ww++++++++++++++++++wtvvvvvvwy++....+y++++++++++++++++++++++++++zzzz....wwxyzzzzzz+++++zzyzywvtrv+++++++....++++++++++++++++++++++++++++++++....mllnqpqw++++++++++++++++++++++++....+++++++++++++++++qmmmq++++++++++..
2139 (PID.TID 0000.0001) 10 ..wx++++++++++++++++++xuvwwvuwy+++....xw+++++++++++++++++++++++++zyyyy....wwxyzzzzzzzzy++zxxxywvtsx+++++++....++++++++++++++++++++++++++++++++....nnoquw++++++++++++++++++++++++++....++++++++++++++++++ww++++++++++++..
2140 (PID.TID 0000.0001) 9 ..wy+++++++++++++++++++tuvwvvw++++....w+++++++++++++++++++++++++zzyxyy....+yzzzzzzzzyxxzzywwxxyxxwx+++++++....++++++++++++++++++++++++++++++++....onrwy+++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2141 (PID.TID 0000.0001) 8 ..y++++++++++++++++++++tuvvvwy++++....x+++++++++++++++++++++++yxxyxxxx....+++zzzzzzyxyz+zzwwxxyxxwwxy+++++....++++++++++++++++++++++++++++++++....posx++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2142 (PID.TID 0000.0001) 7 ..+++++++++++++++++++++wvvusuz++++....y+++++++++++++++++++++++yxxxxxxx....y++zzzzzzyyzzzzzxxxxwwwvvvxx++++....+++++++++++++++++++++++++yxxxyy+....xyy+++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2143 (PID.TID 0000.0001) 6 ..+++++++++++++++++++++ywusqw+++++....++++++++++++++++++++++++yxxxxxxx....w++wzzzzyxyzzzzzxxxwuuwwxwxx++++....++++++++++++++++++++++++zyyyyxxy....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2144 (PID.TID 0000.0001) 5 ..++++++++++++++++++++++vtrv++++++....++++++++++++++++++++++++yxxyyyyy....q++py++zyxzzzzzyxxxwsuwwxxxx++++....+++++++++++++++++++++++yyxyzzzyy....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2145 (PID.TID 0000.0001) 4 ..++++++++++++++++++++++yyy+++++++....++++++++++++++++++++++++yyyzzzzz....snnny++zyyyyzzywvtuvtvwwxxwx+++y....++++++++++++++++++w+++xxyyzzzzzz....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2146 (PID.TID 0000.0001) 3 ..++++++++++++++++++++++++++++++++....+++++++++++++++++++++++++++++++z....tmnvz+zzzyxxxxwqpnotsuvwyxwy++++....y++++++++++++++++wv+++zyzzzzzyz+....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2147 (PID.TID 0000.0001) 2 ..++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++....unny+zzzzzxxwwrnmmmqsuvvxxw+++++....y++++++++++++++++w++++zyyz+zyyy+....++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++..
2148 (PID.TID 0000.0001) 1 ..++++++++++++++++++++++++++++++++....++++++++++++++++++++++++++++++++....uooy+yyzzyxwwqoomlmqtvutwyy+++++....y++++++++++++++++y++++zyyyzzzzz+....++++++++++++++++++++++++++++++++....++++++++++++++++++y+++++++++++++..
2149 (PID.TID 0000.0001) 0 ........................................................................................................................................................................................................................
2150 (PID.TID 0000.0001) -1 ........................................................................................................................................................................................................................
2151 (PID.TID 0000.0001) // =======================================================
2152 (PID.TID 0000.0001) // END OF FIELD =
2153 (PID.TID 0000.0001) // =======================================================
2154 (PID.TID 0000.0001)
2155 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_T_cs_15k.bin
2156 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_S_cs_15k.bin
2157 (PID.TID 0000.0001) Start initial hydrostatic pressure computation
2158 (PID.TID 0000.0001) Pressure is predetermined for buoyancyRelation OCEANIC
2159 (PID.TID 0000.0001)
2160 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
2161 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
2162 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
2163 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
2164 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
2165 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
2166 (PID.TID 0000.0001) // =======================================================
2167 (PID.TID 0000.0001) // Model current state
2168 (PID.TID 0000.0001) // =======================================================
2169 (PID.TID 0000.0001)
2170 (PID.TID 0000.0001) // =======================================================
2171 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2172 (PID.TID 0000.0001) // =======================================================
2173 (PID.TID 0000.0001) %MON time_tsnumber = 0
2174 (PID.TID 0000.0001) %MON time_secondsf = 0.0000000000000E+00
2175 (PID.TID 0000.0001) %MON dynstat_eta_max = 0.0000000000000E+00
2176 (PID.TID 0000.0001) %MON dynstat_eta_min = 0.0000000000000E+00
2177 (PID.TID 0000.0001) %MON dynstat_eta_mean = 0.0000000000000E+00
2178 (PID.TID 0000.0001) %MON dynstat_eta_sd = 0.0000000000000E+00
2179 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 0.0000000000000E+00
2180 (PID.TID 0000.0001) %MON dynstat_uvel_max = 0.0000000000000E+00
2181 (PID.TID 0000.0001) %MON dynstat_uvel_min = 0.0000000000000E+00
2182 (PID.TID 0000.0001) %MON dynstat_uvel_mean = 0.0000000000000E+00
2183 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 0.0000000000000E+00
2184 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 0.0000000000000E+00
2185 (PID.TID 0000.0001) %MON dynstat_vvel_max = 0.0000000000000E+00
2186 (PID.TID 0000.0001) %MON dynstat_vvel_min = 0.0000000000000E+00
2187 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 0.0000000000000E+00
2188 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 0.0000000000000E+00
2189 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 0.0000000000000E+00
2190 (PID.TID 0000.0001) %MON dynstat_wvel_max = 0.0000000000000E+00
2191 (PID.TID 0000.0001) %MON dynstat_wvel_min = 0.0000000000000E+00
2192 (PID.TID 0000.0001) %MON dynstat_wvel_mean = 0.0000000000000E+00
2193 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 0.0000000000000E+00
2194 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 0.0000000000000E+00
2195 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382676376985E+01
2196 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8552983134796E+00
2197 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030349459887E+00
2198 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406771433446E+00
2199 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1326598561892E-03
2200 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715748807407E+01
2201 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144841495627E+01
2202 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721451128586E+01
2203 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858744433685E-01
2204 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1558447735922E-04
2205 (PID.TID 0000.0001) %MON forcing_qnet_max = 4.6211611868841E+02
2206 (PID.TID 0000.0001) %MON forcing_qnet_min = -2.0410376912710E+02
2207 (PID.TID 0000.0001) %MON forcing_qnet_mean = -1.2329247921290E+01
2208 (PID.TID 0000.0001) %MON forcing_qnet_sd = 1.1327998988989E+02
2209 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 4.4323506322358E-01
2210 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2211 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2212 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2213 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2214 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2215 (PID.TID 0000.0001) %MON forcing_empmr_max = 7.6494447208479E-05
2216 (PID.TID 0000.0001) %MON forcing_empmr_min = -1.5362614137596E-04
2217 (PID.TID 0000.0001) %MON forcing_empmr_mean = 4.1932798010144E-22
2218 (PID.TID 0000.0001) %MON forcing_empmr_sd = 2.4051723601802E-05
2219 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 1.2276157049243E-07
2220 (PID.TID 0000.0001) %MON forcing_fu_max = 2.4892781143428E-01
2221 (PID.TID 0000.0001) %MON forcing_fu_min = -2.5159107438040E-01
2222 (PID.TID 0000.0001) %MON forcing_fu_mean = -3.8956966288612E-03
2223 (PID.TID 0000.0001) %MON forcing_fu_sd = 6.5480383395885E-02
2224 (PID.TID 0000.0001) %MON forcing_fu_del2 = 2.3114393556995E-04
2225 (PID.TID 0000.0001) %MON forcing_fv_max = 2.9305960402537E-01
2226 (PID.TID 0000.0001) %MON forcing_fv_min = -3.3950131228473E-01
2227 (PID.TID 0000.0001) %MON forcing_fv_mean = -1.3743384707768E-02
2228 (PID.TID 0000.0001) %MON forcing_fv_sd = 7.6816469815204E-02
2229 (PID.TID 0000.0001) %MON forcing_fv_del2 = 2.5671701728584E-04
2230 (PID.TID 0000.0001) %MON advcfl_uvel_max = 0.0000000000000E+00
2231 (PID.TID 0000.0001) %MON advcfl_vvel_max = 0.0000000000000E+00
2232 (PID.TID 0000.0001) %MON advcfl_wvel_max = 0.0000000000000E+00
2233 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 0.0000000000000E+00
2234 (PID.TID 0000.0001) %MON pe_b_mean = 0.0000000000000E+00
2235 (PID.TID 0000.0001) %MON ke_max = 0.0000000000000E+00
2236 (PID.TID 0000.0001) %MON ke_mean = 0.0000000000000E+00
2237 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
2238 (PID.TID 0000.0001) %MON vort_r_min = 0.0000000000000E+00
2239 (PID.TID 0000.0001) %MON vort_r_max = 0.0000000000000E+00
2240 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2241 (PID.TID 0000.0001) %MON vort_a_sd = 7.5259258474424E-05
2242 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783522345033E-05
2243 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810783121880E-04
2244 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 0.0000000000000E+00
2245 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 0.0000000000000E+00
2246 (PID.TID 0000.0001) // =======================================================
2247 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2248 (PID.TID 0000.0001) // =======================================================
2249 EXTERNAL_FIELDS_LOAD, 0 : iP,iLd,i0,i1= 12 0 12 1 ; Wght= 0.5000000000 0.5000000000
2250 EXTERNAL_FIELDS_LOAD, it= 0 : Reading new data, i0,i1= 12 1 (prev= 12 0 )
2251 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
2252 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_taux.bin
2253 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
2254 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: trenberth_tauy.bin
2255 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
2256 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiQnet_cs32.bin
2257 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
2258 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: shiEmPR_cs32.bin
2259 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
2260 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfT_cs_12m.bin
2261 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
2262 (PID.TID 0000.0001) MDS_READ_FIELD: opening global file: lev_surfS_cs_12m.bin
2263 (PID.TID 0000.0001) SOLVE_FOR_PRESSURE: putPmEinXvector = F
2264 cg2d: Sum(rhs),rhsMax = -2.30926389122033E-14 6.10578609137189E+00
2265 (PID.TID 0000.0001) cg2d_init_res = 5.53904960585195E+00
2266 (PID.TID 0000.0001) cg2d_iters = 49
2267 (PID.TID 0000.0001) cg2d_res = 7.50693820073779E-10
2268 (PID.TID 0000.0001) // =======================================================
2269 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2270 (PID.TID 0000.0001) // =======================================================
2271 (PID.TID 0000.0001) %MON time_tsnumber = 1
2272 (PID.TID 0000.0001) %MON time_secondsf = 3.6000000000000E+03
2273 (PID.TID 0000.0001) %MON dynstat_eta_max = 4.7883499216017E-01
2274 (PID.TID 0000.0001) %MON dynstat_eta_min = -3.4030863985822E-01
2275 (PID.TID 0000.0001) %MON dynstat_eta_mean = 6.8702696259820E-18
2276 (PID.TID 0000.0001) %MON dynstat_eta_sd = 8.3879658809608E-02
2277 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 9.2017759617008E-04
2278 (PID.TID 0000.0001) %MON dynstat_uvel_max = 4.9942617082279E-02
2279 (PID.TID 0000.0001) %MON dynstat_uvel_min = -7.3755561882739E-02
2280 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.1083483540148E-04
2281 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 6.0448690470875E-03
2282 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 2.0606684704258E-05
2283 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.0818638846528E-01
2284 (PID.TID 0000.0001) %MON dynstat_vvel_min = -7.3090007143658E-02
2285 (PID.TID 0000.0001) %MON dynstat_vvel_mean = 1.1283735080746E-04
2286 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 5.9247513959043E-03
2287 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 2.0664328554329E-05
2288 (PID.TID 0000.0001) %MON dynstat_wvel_max = 4.5007128250868E-04
2289 (PID.TID 0000.0001) %MON dynstat_wvel_min = -2.7660682820929E-04
2290 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.4769036829205E-07
2291 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 1.7448214030023E-05
2292 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 1.3593460510062E-07
2293 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9382560242271E+01
2294 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8553134165897E+00
2295 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6030167263574E+00
2296 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4406497621170E+00
2297 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1312432912674E-03
2298 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715747176514E+01
2299 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8144946330873E+01
2300 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721450527859E+01
2301 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858318091113E-01
2302 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1559405084284E-04
2303 (PID.TID 0000.0001) %MON forcing_qnet_max = 0.0000000000000E+00
2304 (PID.TID 0000.0001) %MON forcing_qnet_min = 0.0000000000000E+00
2305 (PID.TID 0000.0001) %MON forcing_qnet_mean = 0.0000000000000E+00
2306 (PID.TID 0000.0001) %MON forcing_qnet_sd = 0.0000000000000E+00
2307 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 0.0000000000000E+00
2308 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2309 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2310 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2311 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2312 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2313 (PID.TID 0000.0001) %MON forcing_empmr_max = 0.0000000000000E+00
2314 (PID.TID 0000.0001) %MON forcing_empmr_min = 0.0000000000000E+00
2315 (PID.TID 0000.0001) %MON forcing_empmr_mean = 0.0000000000000E+00
2316 (PID.TID 0000.0001) %MON forcing_empmr_sd = 0.0000000000000E+00
2317 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 0.0000000000000E+00
2318 (PID.TID 0000.0001) %MON forcing_fu_max = 0.0000000000000E+00
2319 (PID.TID 0000.0001) %MON forcing_fu_min = 0.0000000000000E+00
2320 (PID.TID 0000.0001) %MON forcing_fu_mean = 0.0000000000000E+00
2321 (PID.TID 0000.0001) %MON forcing_fu_sd = 0.0000000000000E+00
2322 (PID.TID 0000.0001) %MON forcing_fu_del2 = 0.0000000000000E+00
2323 (PID.TID 0000.0001) %MON forcing_fv_max = 0.0000000000000E+00
2324 (PID.TID 0000.0001) %MON forcing_fv_min = 0.0000000000000E+00
2325 (PID.TID 0000.0001) %MON forcing_fv_mean = 0.0000000000000E+00
2326 (PID.TID 0000.0001) %MON forcing_fv_sd = 0.0000000000000E+00
2327 (PID.TID 0000.0001) %MON forcing_fv_del2 = 0.0000000000000E+00
2328 (PID.TID 0000.0001) %MON advcfl_uvel_max = 8.8067110054872E-04
2329 (PID.TID 0000.0001) %MON advcfl_vvel_max = 1.2743531301164E-03
2330 (PID.TID 0000.0001) %MON advcfl_wvel_max = 5.4347868463013E-03
2331 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 6.0009104761243E-03
2332 (PID.TID 0000.0001) %MON pe_b_mean = 9.3729820076168E-06
2333 (PID.TID 0000.0001) %MON ke_max = 2.9553400625943E-03
2334 (PID.TID 0000.0001) %MON ke_mean = 3.3082111858406E-05
2335 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
2336 (PID.TID 0000.0001) %MON vort_r_min = -3.9597249380080E-07
2337 (PID.TID 0000.0001) %MON vort_r_max = 3.5145614217471E-07
2338 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2339 (PID.TID 0000.0001) %MON vort_a_sd = 7.5259122244102E-05
2340 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783522345033E-05
2341 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810870562703E-04
2342 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 1.8634237353357E-05
2343 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 6.0726603853640E-07
2344 (PID.TID 0000.0001) // =======================================================
2345 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2346 (PID.TID 0000.0001) // =======================================================
2347 EXTERNAL_FIELDS_LOAD, 1 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4986111111 0.5013888889
2348 cg2d: Sum(rhs),rhsMax = 2.83758588034033E-01 7.39321251910956E+00
2349 (PID.TID 0000.0001) cg2d_init_res = 1.84797889687225E+00
2350 (PID.TID 0000.0001) cg2d_iters = 48
2351 (PID.TID 0000.0001) cg2d_res = 7.82592176428893E-10
2352 (PID.TID 0000.0001) // =======================================================
2353 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2354 (PID.TID 0000.0001) // =======================================================
2355 (PID.TID 0000.0001) %MON time_tsnumber = 2
2356 (PID.TID 0000.0001) %MON time_secondsf = 7.2000000000000E+03
2357 (PID.TID 0000.0001) %MON dynstat_eta_max = 6.9525330368957E-01
2358 (PID.TID 0000.0001) %MON dynstat_eta_min = -6.2457069917821E-01
2359 (PID.TID 0000.0001) %MON dynstat_eta_mean = -3.9003480255755E-04
2360 (PID.TID 0000.0001) %MON dynstat_eta_sd = 1.7543128711363E-01
2361 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.1139491536972E-03
2362 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.0400023064372E-01
2363 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.3148852856980E-01
2364 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -5.4312979629330E-04
2365 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.0603054897577E-02
2366 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 4.0048095262905E-05
2367 (PID.TID 0000.0001) %MON dynstat_vvel_max = 1.8758155487040E-01
2368 (PID.TID 0000.0001) %MON dynstat_vvel_min = -1.5545567023259E-01
2369 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -2.5009170151270E-04
2370 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.0967738569424E-02
2371 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 4.0890089612913E-05
2372 (PID.TID 0000.0001) %MON dynstat_wvel_max = 8.6834832558558E-04
2373 (PID.TID 0000.0001) %MON dynstat_wvel_min = -5.3117919195938E-04
2374 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.7606158771749E-07
2375 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 3.1579976039128E-05
2376 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 2.3800266856365E-07
2377 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9372776525416E+01
2378 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8554552702312E+00
2379 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6029375703644E+00
2380 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4403094023883E+00
2381 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1287858830520E-03
2382 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746931265E+01
2383 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145180935236E+01
2384 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721453408502E+01
2385 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858278958864E-01
2386 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1563089187650E-04
2387 (PID.TID 0000.0001) %MON forcing_qnet_max = 6.7900181122401E+02
2388 (PID.TID 0000.0001) %MON forcing_qnet_min = -1.8270539258631E+03
2389 (PID.TID 0000.0001) %MON forcing_qnet_mean = 2.5845045301274E+02
2390 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.8487486614676E+02
2391 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 2.4491795427822E+00
2392 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2393 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2394 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2395 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2396 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2397 (PID.TID 0000.0001) %MON forcing_empmr_max = 6.0200591850818E-03
2398 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.2456490727359E-06
2399 (PID.TID 0000.0001) %MON forcing_empmr_mean = 1.1159329073175E-04
2400 (PID.TID 0000.0001) %MON forcing_empmr_sd = 2.0328570767976E-04
2401 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 7.1472503740442E-06
2402 (PID.TID 0000.0001) %MON forcing_fu_max = 1.0369097657018E-02
2403 (PID.TID 0000.0001) %MON forcing_fu_min = -1.0980986671836E-02
2404 (PID.TID 0000.0001) %MON forcing_fu_mean = -2.7084624105441E-05
2405 (PID.TID 0000.0001) %MON forcing_fu_sd = 9.7179070890621E-04
2406 (PID.TID 0000.0001) %MON forcing_fu_del2 = 4.8746681087596E-06
2407 (PID.TID 0000.0001) %MON forcing_fv_max = 9.0591806368859E-03
2408 (PID.TID 0000.0001) %MON forcing_fv_min = -1.3585772871941E-02
2409 (PID.TID 0000.0001) %MON forcing_fv_mean = -1.8235053047033E-05
2410 (PID.TID 0000.0001) %MON forcing_fv_sd = 9.2959339878143E-04
2411 (PID.TID 0000.0001) %MON forcing_fv_del2 = 4.3077031314065E-06
2412 (PID.TID 0000.0001) %MON advcfl_uvel_max = 1.5591674049743E-03
2413 (PID.TID 0000.0001) %MON advcfl_vvel_max = 2.2095676266883E-03
2414 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.0464139357579E-02
2415 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.1552296994490E-02
2416 (PID.TID 0000.0001) %MON pe_b_mean = 4.1005390463054E-05
2417 (PID.TID 0000.0001) %MON ke_max = 1.2599884923647E-02
2418 (PID.TID 0000.0001) %MON ke_mean = 1.0761553277162E-04
2419 (PID.TID 0000.0001) %MON ke_vol = 1.3398024453628E+18
2420 (PID.TID 0000.0001) %MON vort_r_min = -6.8428322652920E-07
2421 (PID.TID 0000.0001) %MON vort_r_max = 6.0938063053139E-07
2422 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2423 (PID.TID 0000.0001) %MON vort_a_sd = 7.5258593052697E-05
2424 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783519155748E-05
2425 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810802998040E-04
2426 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.1507147698950E-05
2427 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.1019883537025E-06
2428 (PID.TID 0000.0001) // =======================================================
2429 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2430 (PID.TID 0000.0001) // =======================================================
2431 EXTERNAL_FIELDS_LOAD, 2 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4972222222 0.5027777778
2432 cg2d: Sum(rhs),rhsMax = 5.75785258006206E-01 7.19620648890552E+00
2433 (PID.TID 0000.0001) cg2d_init_res = 1.39858837182383E+00
2434 (PID.TID 0000.0001) cg2d_iters = 48
2435 (PID.TID 0000.0001) cg2d_res = 8.54690267806293E-10
2436 (PID.TID 0000.0001) // =======================================================
2437 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2438 (PID.TID 0000.0001) // =======================================================
2439 (PID.TID 0000.0001) %MON time_tsnumber = 3
2440 (PID.TID 0000.0001) %MON time_secondsf = 1.0800000000000E+04
2441 (PID.TID 0000.0001) %MON dynstat_eta_max = 9.1440618209102E-01
2442 (PID.TID 0000.0001) %MON dynstat_eta_min = -8.1944926847402E-01
2443 (PID.TID 0000.0001) %MON dynstat_eta_mean = -7.7034508102752E-04
2444 (PID.TID 0000.0001) %MON dynstat_eta_sd = 2.5272794254153E-01
2445 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0698105551269E-03
2446 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.5259145693263E-01
2447 (PID.TID 0000.0001) %MON dynstat_uvel_min = -1.8823399084345E-01
2448 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.2029707346452E-03
2449 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.3651297867338E-02
2450 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 5.5697804338764E-05
2451 (PID.TID 0000.0001) %MON dynstat_vvel_max = 2.6296604712238E-01
2452 (PID.TID 0000.0001) %MON dynstat_vvel_min = -2.3199059297962E-01
2453 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -8.1253209565638E-04
2454 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.4624778881061E-02
2455 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 5.7766753632319E-05
2456 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.2503822316829E-03
2457 (PID.TID 0000.0001) %MON dynstat_wvel_min = -7.6794200987726E-04
2458 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -3.1950942889235E-07
2459 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.1390880283800E-05
2460 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 3.1342555762026E-07
2461 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9363891827602E+01
2462 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556103768461E+00
2463 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028842941245E+00
2464 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4400199440459E+00
2465 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1257136983428E-03
2466 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746905149E+01
2467 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145482716327E+01
2468 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721456643217E+01
2469 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858332476450E-01
2470 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1566559705424E-04
2471 (PID.TID 0000.0001) %MON forcing_qnet_max = 6.2177384837990E+02
2472 (PID.TID 0000.0001) %MON forcing_qnet_min = -1.8654075003467E+03
2473 (PID.TID 0000.0001) %MON forcing_qnet_mean = 2.1724258694672E+02
2474 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.7029182745100E+02
2475 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 2.4802913442059E+00
2476 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2477 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2478 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2479 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2480 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2481 (PID.TID 0000.0001) %MON forcing_empmr_max = 5.9730978485764E-03
2482 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.2239793301642E-06
2483 (PID.TID 0000.0001) %MON forcing_empmr_mean = 1.0881099634004E-04
2484 (PID.TID 0000.0001) %MON forcing_empmr_sd = 2.0123369711154E-04
2485 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 7.0915929823608E-06
2486 (PID.TID 0000.0001) %MON forcing_fu_max = 2.6839769195381E-02
2487 (PID.TID 0000.0001) %MON forcing_fu_min = -2.2844953050119E-02
2488 (PID.TID 0000.0001) %MON forcing_fu_mean = -9.9942574809234E-05
2489 (PID.TID 0000.0001) %MON forcing_fu_sd = 2.7153686001468E-03
2490 (PID.TID 0000.0001) %MON forcing_fu_del2 = 1.0350052997332E-05
2491 (PID.TID 0000.0001) %MON forcing_fv_max = 3.5283579142340E-02
2492 (PID.TID 0000.0001) %MON forcing_fv_min = -2.3856306561684E-02
2493 (PID.TID 0000.0001) %MON forcing_fv_mean = -5.0334297081474E-05
2494 (PID.TID 0000.0001) %MON forcing_fv_sd = 2.8399730657669E-03
2495 (PID.TID 0000.0001) %MON forcing_fv_del2 = 8.4471369493432E-06
2496 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.2320449260754E-03
2497 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.0975394411313E-03
2498 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.5028747056716E-02
2499 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 1.6590739420905E-02
2500 (PID.TID 0000.0001) %MON pe_b_mean = 8.5097204077461E-05
2501 (PID.TID 0000.0001) %MON ke_max = 2.6306502309827E-02
2502 (PID.TID 0000.0001) %MON ke_mean = 1.8580640863080E-04
2503 (PID.TID 0000.0001) %MON ke_vol = 1.3398023034343E+18
2504 (PID.TID 0000.0001) %MON vort_r_min = -9.5463965040662E-07
2505 (PID.TID 0000.0001) %MON vort_r_max = 8.5427597459941E-07
2506 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2507 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257995700711E-05
2508 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783516359115E-05
2509 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810708856836E-04
2510 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 3.2757875195705E-05
2511 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.3022917414705E-06
2512 (PID.TID 0000.0001) // =======================================================
2513 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2514 (PID.TID 0000.0001) // =======================================================
2515 EXTERNAL_FIELDS_LOAD, 3 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4958333333 0.5041666667
2516 cg2d: Sum(rhs),rhsMax = 8.63556185937398E-01 6.97143505122450E+00
2517 (PID.TID 0000.0001) cg2d_init_res = 1.13007581934836E+00
2518 (PID.TID 0000.0001) cg2d_iters = 48
2519 (PID.TID 0000.0001) cg2d_res = 7.09284972537215E-10
2520 (PID.TID 0000.0001) // =======================================================
2521 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2522 (PID.TID 0000.0001) // =======================================================
2523 (PID.TID 0000.0001) %MON time_tsnumber = 4
2524 (PID.TID 0000.0001) %MON time_secondsf = 1.4400000000000E+04
2525 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0448010660392E+00
2526 (PID.TID 0000.0001) %MON dynstat_eta_min = -9.3830074403222E-01
2527 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.1192676228263E-03
2528 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.0824126953693E-01
2529 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0263159333540E-03
2530 (PID.TID 0000.0001) %MON dynstat_uvel_max = 1.9675836795108E-01
2531 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.4218888170118E-01
2532 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -1.8823455986151E-03
2533 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.5907921336358E-02
2534 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 6.8993666048222E-05
2535 (PID.TID 0000.0001) %MON dynstat_vvel_max = 3.3469635093616E-01
2536 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.0237558317300E-01
2537 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.3984005095474E-03
2538 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.7151520465976E-02
2539 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 7.2251481210062E-05
2540 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.6041759979922E-03
2541 (PID.TID 0000.0001) %MON dynstat_wvel_min = -9.8917834491279E-04
2542 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -2.0027706043930E-07
2543 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 4.7890518814345E-05
2544 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 3.7041633760527E-07
2545 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9355311521602E+01
2546 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556828393219E+00
2547 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028430409321E+00
2548 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4397482252565E+00
2549 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1220940179797E-03
2550 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746809096E+01
2551 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8145845660490E+01
2552 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721460038171E+01
2553 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858551786487E-01
2554 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1571948754642E-04
2555 (PID.TID 0000.0001) %MON forcing_qnet_max = 5.9998458801755E+02
2556 (PID.TID 0000.0001) %MON forcing_qnet_min = -2.3689635244619E+02
2557 (PID.TID 0000.0001) %MON forcing_qnet_mean = 2.0527518181337E+02
2558 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.5967575950676E+02
2559 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 5.3307221177395E-01
2560 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2561 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2562 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2563 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2564 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2565 (PID.TID 0000.0001) %MON forcing_empmr_max = 6.6616444354000E-04
2566 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.1976571706684E-06
2567 (PID.TID 0000.0001) %MON forcing_empmr_mean = 9.9830616125765E-05
2568 (PID.TID 0000.0001) %MON forcing_empmr_sd = 7.4073381058492E-05
2569 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 9.9446650364171E-07
2570 (PID.TID 0000.0001) %MON forcing_fu_max = 1.6730353702280E-02
2571 (PID.TID 0000.0001) %MON forcing_fu_min = -2.0410341161972E-02
2572 (PID.TID 0000.0001) %MON forcing_fu_mean = -7.2779590394568E-05
2573 (PID.TID 0000.0001) %MON forcing_fu_sd = 3.2306822835477E-03
2574 (PID.TID 0000.0001) %MON forcing_fu_del2 = 8.6059842167803E-06
2575 (PID.TID 0000.0001) %MON forcing_fv_max = 1.9376565491467E-02
2576 (PID.TID 0000.0001) %MON forcing_fv_min = -1.8415212013371E-02
2577 (PID.TID 0000.0001) %MON forcing_fv_mean = -4.9097297831877E-05
2578 (PID.TID 0000.0001) %MON forcing_fv_sd = 3.4261643003565E-03
2579 (PID.TID 0000.0001) %MON forcing_fv_del2 = 7.6504114622640E-06
2580 (PID.TID 0000.0001) %MON advcfl_uvel_max = 2.8718323514831E-03
2581 (PID.TID 0000.0001) %MON advcfl_vvel_max = 3.9424677032354E-03
2582 (PID.TID 0000.0001) %MON advcfl_wvel_max = 1.9246794319784E-02
2583 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.1247121715282E-02
2584 (PID.TID 0000.0001) %MON pe_b_mean = 1.2658430308067E-04
2585 (PID.TID 0000.0001) %MON ke_max = 4.2178007399270E-02
2586 (PID.TID 0000.0001) %MON ke_mean = 2.5526389432349E-04
2587 (PID.TID 0000.0001) %MON ke_vol = 1.3398021650444E+18
2588 (PID.TID 0000.0001) %MON vort_r_min = -1.2138681740939E-06
2589 (PID.TID 0000.0001) %MON vort_r_max = 1.0873002599373E-06
2590 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2591 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257527710702E-05
2592 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783512811912E-05
2593 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810633081021E-04
2594 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.8146024151321E-05
2595 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 1.2422987797039E-06
2596 (PID.TID 0000.0001) // =======================================================
2597 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2598 (PID.TID 0000.0001) // =======================================================
2599 EXTERNAL_FIELDS_LOAD, 4 : iP,iLd,i0,i1= 12 1 12 1 ; Wght= 0.4944444444 0.5055555556
2600 cg2d: Sum(rhs),rhsMax = 1.14067523622320E+00 6.87396504344541E+00
2601 (PID.TID 0000.0001) cg2d_init_res = 9.39444503789617E-01
2602 (PID.TID 0000.0001) cg2d_iters = 47
2603 (PID.TID 0000.0001) cg2d_res = 9.74793326660694E-10
2604 (PID.TID 0000.0001) // =======================================================
2605 (PID.TID 0000.0001) // Begin MONITOR dynamic field statistics
2606 (PID.TID 0000.0001) // =======================================================
2607 (PID.TID 0000.0001) %MON time_tsnumber = 5
2608 (PID.TID 0000.0001) %MON time_secondsf = 1.8000000000000E+04
2609 (PID.TID 0000.0001) %MON dynstat_eta_max = 1.0999010826655E+00
2610 (PID.TID 0000.0001) %MON dynstat_eta_min = -1.0583608439230E+00
2611 (PID.TID 0000.0001) %MON dynstat_eta_mean = -1.4577749675065E-03
2612 (PID.TID 0000.0001) %MON dynstat_eta_sd = 3.4219510399650E-01
2613 (PID.TID 0000.0001) %MON dynstat_eta_del2 = 1.0108721850565E-03
2614 (PID.TID 0000.0001) %MON dynstat_uvel_max = 2.3755745639099E-01
2615 (PID.TID 0000.0001) %MON dynstat_uvel_min = -2.9216118394486E-01
2616 (PID.TID 0000.0001) %MON dynstat_uvel_mean = -2.3677620811022E-03
2617 (PID.TID 0000.0001) %MON dynstat_uvel_sd = 1.7688242304100E-02
2618 (PID.TID 0000.0001) %MON dynstat_uvel_del2 = 8.0774432888104E-05
2619 (PID.TID 0000.0001) %MON dynstat_vvel_max = 4.0197842637116E-01
2620 (PID.TID 0000.0001) %MON dynstat_vvel_min = -3.6776200122394E-01
2621 (PID.TID 0000.0001) %MON dynstat_vvel_mean = -1.9013948893136E-03
2622 (PID.TID 0000.0001) %MON dynstat_vvel_sd = 1.8879920445486E-02
2623 (PID.TID 0000.0001) %MON dynstat_vvel_del2 = 8.5212269956968E-05
2624 (PID.TID 0000.0001) %MON dynstat_wvel_max = 1.9358812195276E-03
2625 (PID.TID 0000.0001) %MON dynstat_wvel_min = -1.1954539974343E-03
2626 (PID.TID 0000.0001) %MON dynstat_wvel_mean = -4.8312674909854E-08
2627 (PID.TID 0000.0001) %MON dynstat_wvel_sd = 5.1976233115123E-05
2628 (PID.TID 0000.0001) %MON dynstat_wvel_del2 = 4.1430332009440E-07
2629 (PID.TID 0000.0001) %MON dynstat_theta_max = 2.9347054761730E+01
2630 (PID.TID 0000.0001) %MON dynstat_theta_min = -1.8556371379556E+00
2631 (PID.TID 0000.0001) %MON dynstat_theta_mean = 3.6028077991651E+00
2632 (PID.TID 0000.0001) %MON dynstat_theta_sd = 4.4394908609909E+00
2633 (PID.TID 0000.0001) %MON dynstat_theta_del2 = 2.1180457549520E-03
2634 (PID.TID 0000.0001) %MON dynstat_salt_max = 4.0715746705954E+01
2635 (PID.TID 0000.0001) %MON dynstat_salt_min = 1.8146261213062E+01
2636 (PID.TID 0000.0001) %MON dynstat_salt_mean = 3.4721463673065E+01
2637 (PID.TID 0000.0001) %MON dynstat_salt_sd = 4.8858780246827E-01
2638 (PID.TID 0000.0001) %MON dynstat_salt_del2 = 5.1575423055204E-04
2639 (PID.TID 0000.0001) %MON forcing_qnet_max = 5.7824479464126E+02
2640 (PID.TID 0000.0001) %MON forcing_qnet_min = -2.4448612662258E+02
2641 (PID.TID 0000.0001) %MON forcing_qnet_mean = 1.9389867569010E+02
2642 (PID.TID 0000.0001) %MON forcing_qnet_sd = 2.5588235604396E+02
2643 (PID.TID 0000.0001) %MON forcing_qnet_del2 = 4.5305016135755E-01
2644 (PID.TID 0000.0001) %MON forcing_qsw_max = 0.0000000000000E+00
2645 (PID.TID 0000.0001) %MON forcing_qsw_min = 0.0000000000000E+00
2646 (PID.TID 0000.0001) %MON forcing_qsw_mean = 0.0000000000000E+00
2647 (PID.TID 0000.0001) %MON forcing_qsw_sd = 0.0000000000000E+00
2648 (PID.TID 0000.0001) %MON forcing_qsw_del2 = 0.0000000000000E+00
2649 (PID.TID 0000.0001) %MON forcing_empmr_max = 9.1902395190082E-04
2650 (PID.TID 0000.0001) %MON forcing_empmr_min = 5.1749459039822E-06
2651 (PID.TID 0000.0001) %MON forcing_empmr_mean = 9.6850712505672E-05
2652 (PID.TID 0000.0001) %MON forcing_empmr_sd = 6.9303931338960E-05
2653 (PID.TID 0000.0001) %MON forcing_empmr_del2 = 7.3974100285252E-07
2654 (PID.TID 0000.0001) %MON forcing_fu_max = 2.0361613548319E-02
2655 (PID.TID 0000.0001) %MON forcing_fu_min = -1.9108714625643E-02
2656 (PID.TID 0000.0001) %MON forcing_fu_mean = 1.3412577863410E-04
2657 (PID.TID 0000.0001) %MON forcing_fu_sd = 3.4126455570675E-03
2658 (PID.TID 0000.0001) %MON forcing_fu_del2 = 1.0131748283709E-05
2659 (PID.TID 0000.0001) %MON forcing_fv_max = 1.4315088395398E-02
2660 (PID.TID 0000.0001) %MON forcing_fv_min = -1.3282070121439E-02
2661 (PID.TID 0000.0001) %MON forcing_fv_mean = -8.1237154951201E-05
2662 (PID.TID 0000.0001) %MON forcing_fv_sd = 3.4929160182159E-03
2663 (PID.TID 0000.0001) %MON forcing_fv_del2 = 8.8253473370052E-06
2664 (PID.TID 0000.0001) %MON advcfl_uvel_max = 3.4643949549084E-03
2665 (PID.TID 0000.0001) %MON advcfl_vvel_max = 4.7349992282047E-03
2666 (PID.TID 0000.0001) %MON advcfl_wvel_max = 2.3205999509167E-02
2667 (PID.TID 0000.0001) %MON advcfl_W_hf_max = 2.5617856711692E-02
2668 (PID.TID 0000.0001) %MON pe_b_mean = 1.5600896360673E-04
2669 (PID.TID 0000.0001) %MON ke_max = 5.9578471215915E-02
2670 (PID.TID 0000.0001) %MON ke_mean = 3.1335272134283E-04
2671 (PID.TID 0000.0001) %MON ke_vol = 1.3398020380761E+18
2672 (PID.TID 0000.0001) %MON vort_r_min = -1.4599028434070E-06
2673 (PID.TID 0000.0001) %MON vort_r_max = 1.3058739548849E-06
2674 (PID.TID 0000.0001) %MON vort_a_mean = -2.0549865324846E-05
2675 (PID.TID 0000.0001) %MON vort_a_sd = 7.5257267494359E-05
2676 (PID.TID 0000.0001) %MON vort_p_mean = -2.4783510593739E-05
2677 (PID.TID 0000.0001) %MON vort_p_sd = 1.2810582598825E-04
2678 (PID.TID 0000.0001) %MON surfExpan_theta_mean = 2.1397606468648E-05
2679 (PID.TID 0000.0001) %MON surfExpan_salt_mean = 9.5436788860660E-07
2680 (PID.TID 0000.0001) // =======================================================
2681 (PID.TID 0000.0001) // End MONITOR dynamic field statistics
2682 (PID.TID 0000.0001) // =======================================================
2683 (PID.TID 0000.0001) %CHECKPOINT 5 ckptA
2684 (PID.TID 0000.0001) Seconds in section "ALL [THE_MODEL_MAIN]":
2685 (PID.TID 0000.0001) User time: 9.4199999999999999
2686 (PID.TID 0000.0001) System time: 0.32000000000000001
2687 (PID.TID 0000.0001) Wall clock time: 9.7545139789581299
2688 (PID.TID 0000.0001) No. starts: 1
2689 (PID.TID 0000.0001) No. stops: 1
2690 (PID.TID 0000.0001) Seconds in section "INITIALISE_FIXED [THE_MODEL_MAIN]":
2691 (PID.TID 0000.0001) User time: 0.14999999999999999
2692 (PID.TID 0000.0001) System time: 2.00000000000000004E-002
2693 (PID.TID 0000.0001) Wall clock time: 0.16528105735778809
2694 (PID.TID 0000.0001) No. starts: 1
2695 (PID.TID 0000.0001) No. stops: 1
2696 (PID.TID 0000.0001) Seconds in section "THE_MAIN_LOOP [THE_MODEL_MAIN]":
2697 (PID.TID 0000.0001) User time: 9.2699999999999996
2698 (PID.TID 0000.0001) System time: 0.29999999999999999
2699 (PID.TID 0000.0001) Wall clock time: 9.5891969203948975
2700 (PID.TID 0000.0001) No. starts: 1
2701 (PID.TID 0000.0001) No. stops: 1
2702 (PID.TID 0000.0001) Seconds in section "INITIALISE_VARIA [THE_MAIN_LOOP]":
2703 (PID.TID 0000.0001) User time: 0.23000000000000001
2704 (PID.TID 0000.0001) System time: 2.00000000000000004E-002
2705 (PID.TID 0000.0001) Wall clock time: 0.26041197776794434
2706 (PID.TID 0000.0001) No. starts: 1
2707 (PID.TID 0000.0001) No. stops: 1
2708 (PID.TID 0000.0001) Seconds in section "MAIN LOOP [THE_MAIN_LOOP]":
2709 (PID.TID 0000.0001) User time: 9.0399999999999991
2710 (PID.TID 0000.0001) System time: 0.28000000000000003
2711 (PID.TID 0000.0001) Wall clock time: 9.3287580013275146
2712 (PID.TID 0000.0001) No. starts: 1
2713 (PID.TID 0000.0001) No. stops: 1
2714 (PID.TID 0000.0001) Seconds in section "FORWARD_STEP [THE_MAIN_LOOP]":
2715 (PID.TID 0000.0001) User time: 9.0399999999999991
2716 (PID.TID 0000.0001) System time: 0.28000000000000003
2717 (PID.TID 0000.0001) Wall clock time: 9.3287048339843750
2718 (PID.TID 0000.0001) No. starts: 5
2719 (PID.TID 0000.0001) No. stops: 5
2720 (PID.TID 0000.0001) Seconds in section "UPDATE_R_STAR [FORWARD_STEP]":
2721 (PID.TID 0000.0001) User time: 9.99999999999996447E-002
2722 (PID.TID 0000.0001) System time: 0.0000000000000000
2723 (PID.TID 0000.0001) Wall clock time: 8.57822895050048828E-002
2724 (PID.TID 0000.0001) No. starts: 10
2725 (PID.TID 0000.0001) No. stops: 10
2726 (PID.TID 0000.0001) Seconds in section "LOAD_FIELDS_DRIVER [FORWARD_STEP]":
2727 (PID.TID 0000.0001) User time: 9.99999999999978684E-003
2728 (PID.TID 0000.0001) System time: 0.0000000000000000
2729 (PID.TID 0000.0001) Wall clock time: 1.06000900268554688E-002
2730 (PID.TID 0000.0001) No. starts: 5
2731 (PID.TID 0000.0001) No. stops: 5
2732 (PID.TID 0000.0001) Seconds in section "EXTERNAL_FLDS_LOAD [LOAD_FLDS_DRIVER]":
2733 (PID.TID 0000.0001) User time: 9.99999999999978684E-003
2734 (PID.TID 0000.0001) System time: 0.0000000000000000
2735 (PID.TID 0000.0001) Wall clock time: 1.05082988739013672E-002
2736 (PID.TID 0000.0001) No. starts: 5
2737 (PID.TID 0000.0001) No. stops: 5
2738 (PID.TID 0000.0001) Seconds in section "CPL_EXPORT-IMPORT [FORWARD_STEP]":
2739 (PID.TID 0000.0001) User time: 5.7400000000000020
2740 (PID.TID 0000.0001) System time: 0.25000000000000000
2741 (PID.TID 0000.0001) Wall clock time: 6.0083951950073242
2742 (PID.TID 0000.0001) No. starts: 5
2743 (PID.TID 0000.0001) No. stops: 5
2744 (PID.TID 0000.0001) Seconds in section "DO_ATMOSPHERIC_PHYS [FORWARD_STEP]":
2745 (PID.TID 0000.0001) User time: 1.00000000000015632E-002
2746 (PID.TID 0000.0001) System time: 0.0000000000000000
2747 (PID.TID 0000.0001) Wall clock time: 4.88758087158203125E-005
2748 (PID.TID 0000.0001) No. starts: 5
2749 (PID.TID 0000.0001) No. stops: 5
2750 (PID.TID 0000.0001) Seconds in section "DO_OCEANIC_PHYS [FORWARD_STEP]":
2751 (PID.TID 0000.0001) User time: 0.43999999999999773
2752 (PID.TID 0000.0001) System time: 0.0000000000000000
2753 (PID.TID 0000.0001) Wall clock time: 0.45522999763488770
2754 (PID.TID 0000.0001) No. starts: 5
2755 (PID.TID 0000.0001) No. stops: 5
2756 (PID.TID 0000.0001) Seconds in section "DYNAMICS [FORWARD_STEP]":
2757 (PID.TID 0000.0001) User time: 0.92000000000000171
2758 (PID.TID 0000.0001) System time: 0.0000000000000000
2759 (PID.TID 0000.0001) Wall clock time: 0.91396927833557129
2760 (PID.TID 0000.0001) No. starts: 5
2761 (PID.TID 0000.0001) No. stops: 5
2762 (PID.TID 0000.0001) Seconds in section "UPDATE_CG2D [FORWARD_STEP]":
2763 (PID.TID 0000.0001) User time: 1.99999999999995737E-002
2764 (PID.TID 0000.0001) System time: 0.0000000000000000
2765 (PID.TID 0000.0001) Wall clock time: 2.44424343109130859E-002
2766 (PID.TID 0000.0001) No. starts: 5
2767 (PID.TID 0000.0001) No. stops: 5
2768 (PID.TID 0000.0001) Seconds in section "SOLVE_FOR_PRESSURE [FORWARD_STEP]":
2769 (PID.TID 0000.0001) User time: 0.26999999999999957
2770 (PID.TID 0000.0001) System time: 0.0000000000000000
2771 (PID.TID 0000.0001) Wall clock time: 0.26505613327026367
2772 (PID.TID 0000.0001) No. starts: 5
2773 (PID.TID 0000.0001) No. stops: 5
2774 (PID.TID 0000.0001) Seconds in section "MOM_CORRECTION_STEP [FORWARD_STEP]":
2775 (PID.TID 0000.0001) User time: 8.99999999999998579E-002
2776 (PID.TID 0000.0001) System time: 0.0000000000000000
2777 (PID.TID 0000.0001) Wall clock time: 9.15081501007080078E-002
2778 (PID.TID 0000.0001) No. starts: 5
2779 (PID.TID 0000.0001) No. stops: 5
2780 (PID.TID 0000.0001) Seconds in section "UPDATE_ETAH [FORWARD_STEP]":
2781 (PID.TID 0000.0001) User time: 0.0000000000000000
2782 (PID.TID 0000.0001) System time: 0.0000000000000000
2783 (PID.TID 0000.0001) Wall clock time: 6.72101974487304688E-004
2784 (PID.TID 0000.0001) No. starts: 5
2785 (PID.TID 0000.0001) No. stops: 5
2786 (PID.TID 0000.0001) Seconds in section "CALC_R_STAR [FORWARD_STEP]":
2787 (PID.TID 0000.0001) User time: 9.99999999999978684E-003
2788 (PID.TID 0000.0001) System time: 0.0000000000000000
2789 (PID.TID 0000.0001) Wall clock time: 9.89723205566406250E-003
2790 (PID.TID 0000.0001) No. starts: 5
2791 (PID.TID 0000.0001) No. stops: 5
2792 (PID.TID 0000.0001) Seconds in section "BLOCKING_EXCHANGES [FORWARD_STEP]":
2793 (PID.TID 0000.0001) User time: 4.99999999999989342E-002
2794 (PID.TID 0000.0001) System time: 0.0000000000000000
2795 (PID.TID 0000.0001) Wall clock time: 4.53901290893554688E-002
2796 (PID.TID 0000.0001) No. starts: 10
2797 (PID.TID 0000.0001) No. stops: 10
2798 (PID.TID 0000.0001) Seconds in section "THERMODYNAMICS [FORWARD_STEP]":
2799 (PID.TID 0000.0001) User time: 0.76999999999999957
2800 (PID.TID 0000.0001) System time: 1.00000000000000089E-002
2801 (PID.TID 0000.0001) Wall clock time: 0.77364873886108398
2802 (PID.TID 0000.0001) No. starts: 5
2803 (PID.TID 0000.0001) No. stops: 5
2804 (PID.TID 0000.0001) Seconds in section "TRC_CORRECTION_STEP [FORWARD_STEP]":
2805 (PID.TID 0000.0001) User time: 9.99999999999978684E-003
2806 (PID.TID 0000.0001) System time: 0.0000000000000000
2807 (PID.TID 0000.0001) Wall clock time: 1.16629600524902344E-002
2808 (PID.TID 0000.0001) No. starts: 5
2809 (PID.TID 0000.0001) No. stops: 5
2810 (PID.TID 0000.0001) Seconds in section "DO_STATEVARS_TAVE [FORWARD_STEP]":
2811 (PID.TID 0000.0001) User time: 0.18999999999999950
2812 (PID.TID 0000.0001) System time: 0.0000000000000000
2813 (PID.TID 0000.0001) Wall clock time: 0.19234824180603027
2814 (PID.TID 0000.0001) No. starts: 5
2815 (PID.TID 0000.0001) No. stops: 5
2816 (PID.TID 0000.0001) Seconds in section "MONITOR [FORWARD_STEP]":
2817 (PID.TID 0000.0001) User time: 0.33999999999999986
2818 (PID.TID 0000.0001) System time: 0.0000000000000000
2819 (PID.TID 0000.0001) Wall clock time: 0.34875512123107910
2820 (PID.TID 0000.0001) No. starts: 5
2821 (PID.TID 0000.0001) No. stops: 5
2822 (PID.TID 0000.0001) Seconds in section "DO_THE_MODEL_IO [FORWARD_STEP]":
2823 (PID.TID 0000.0001) User time: 4.00000000000009237E-002
2824 (PID.TID 0000.0001) System time: 1.00000000000000089E-002
2825 (PID.TID 0000.0001) Wall clock time: 4.59394454956054688E-002
2826 (PID.TID 0000.0001) No. starts: 5
2827 (PID.TID 0000.0001) No. stops: 5
2828 (PID.TID 0000.0001) Seconds in section "DO_WRITE_PICKUP [FORWARD_STEP]":
2829 (PID.TID 0000.0001) User time: 2.99999999999993605E-002
2830 (PID.TID 0000.0001) System time: 1.00000000000000089E-002
2831 (PID.TID 0000.0001) Wall clock time: 4.44099903106689453E-002
2832 (PID.TID 0000.0001) No. starts: 5
2833 (PID.TID 0000.0001) No. stops: 5
2834 (PID.TID 0000.0001) // ======================================================
2835 (PID.TID 0000.0001) // Tile <-> Tile communication statistics
2836 (PID.TID 0000.0001) // ======================================================
2837 (PID.TID 0000.0001) // o Tile number: 000001
2838 (PID.TID 0000.0001) // No. X exchanges = 0
2839 (PID.TID 0000.0001) // Max. X spins = 0
2840 (PID.TID 0000.0001) // Min. X spins = 1000000000
2841 (PID.TID 0000.0001) // Total. X spins = 0
2842 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
2843 (PID.TID 0000.0001) // No. Y exchanges = 0
2844 (PID.TID 0000.0001) // Max. Y spins = 0
2845 (PID.TID 0000.0001) // Min. Y spins = 1000000000
2846 (PID.TID 0000.0001) // Total. Y spins = 0
2847 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
2848 (PID.TID 0000.0001) // o Tile number: 000002
2849 (PID.TID 0000.0001) // No. X exchanges = 0
2850 (PID.TID 0000.0001) // Max. X spins = 0
2851 (PID.TID 0000.0001) // Min. X spins = 1000000000
2852 (PID.TID 0000.0001) // Total. X spins = 0
2853 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
2854 (PID.TID 0000.0001) // No. Y exchanges = 0
2855 (PID.TID 0000.0001) // Max. Y spins = 0
2856 (PID.TID 0000.0001) // Min. Y spins = 1000000000
2857 (PID.TID 0000.0001) // Total. Y spins = 0
2858 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
2859 (PID.TID 0000.0001) // o Tile number: 000003
2860 (PID.TID 0000.0001) // No. X exchanges = 0
2861 (PID.TID 0000.0001) // Max. X spins = 0
2862 (PID.TID 0000.0001) // Min. X spins = 1000000000
2863 (PID.TID 0000.0001) // Total. X spins = 0
2864 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
2865 (PID.TID 0000.0001) // No. Y exchanges = 0
2866 (PID.TID 0000.0001) // Max. Y spins = 0
2867 (PID.TID 0000.0001) // Min. Y spins = 1000000000
2868 (PID.TID 0000.0001) // Total. Y spins = 0
2869 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
2870 (PID.TID 0000.0001) // o Tile number: 000004
2871 (PID.TID 0000.0001) // No. X exchanges = 0
2872 (PID.TID 0000.0001) // Max. X spins = 0
2873 (PID.TID 0000.0001) // Min. X spins = 1000000000
2874 (PID.TID 0000.0001) // Total. X spins = 0
2875 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
2876 (PID.TID 0000.0001) // No. Y exchanges = 0
2877 (PID.TID 0000.0001) // Max. Y spins = 0
2878 (PID.TID 0000.0001) // Min. Y spins = 1000000000
2879 (PID.TID 0000.0001) // Total. Y spins = 0
2880 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
2881 (PID.TID 0000.0001) // o Tile number: 000005
2882 (PID.TID 0000.0001) // No. X exchanges = 0
2883 (PID.TID 0000.0001) // Max. X spins = 0
2884 (PID.TID 0000.0001) // Min. X spins = 1000000000
2885 (PID.TID 0000.0001) // Total. X spins = 0
2886 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
2887 (PID.TID 0000.0001) // No. Y exchanges = 0
2888 (PID.TID 0000.0001) // Max. Y spins = 0
2889 (PID.TID 0000.0001) // Min. Y spins = 1000000000
2890 (PID.TID 0000.0001) // Total. Y spins = 0
2891 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
2892 (PID.TID 0000.0001) // o Tile number: 000006
2893 (PID.TID 0000.0001) // No. X exchanges = 0
2894 (PID.TID 0000.0001) // Max. X spins = 0
2895 (PID.TID 0000.0001) // Min. X spins = 1000000000
2896 (PID.TID 0000.0001) // Total. X spins = 0
2897 (PID.TID 0000.0001) // Avg. X spins = 0.00E+00
2898 (PID.TID 0000.0001) // No. Y exchanges = 0
2899 (PID.TID 0000.0001) // Max. Y spins = 0
2900 (PID.TID 0000.0001) // Min. Y spins = 1000000000
2901 (PID.TID 0000.0001) // Total. Y spins = 0
2902 (PID.TID 0000.0001) // Avg. Y spins = 0.00E+00
2903 (PID.TID 0000.0001) // o Thread number: 000001
2904 (PID.TID 0000.0001) // No. barriers = 5262
2905 (PID.TID 0000.0001) // Max. barrier spins = 1
2906 (PID.TID 0000.0001) // Min. barrier spins = 1
2907 (PID.TID 0000.0001) // Total barrier spins = 5262
2908 (PID.TID 0000.0001) // Avg. barrier spins = 1.00E+00
2909 PROGRAM MAIN: Execution ended Normally

  ViewVC Help
Powered by ViewVC 1.1.22